BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G03 (896 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 4.3 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 23 4.3 AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 22 5.7 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 22 5.7 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 7.5 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.6 bits (46), Expect = 4.3 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -1 Query: 377 KLTSRFNNTSIYGIRFKYHFPIALAEPRTSIAGPALTMPSR 255 +L + + NT + + ++HF L PR +L + R Sbjct: 6 RLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTER 46 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 22.6 bits (46), Expect = 4.3 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = -1 Query: 377 KLTSRFNNTSIYGIRFKYHFPIALAEPRTSIAGPALTMPSR 255 +L + + NT + + ++HF L PR +L + R Sbjct: 137 RLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTER 177 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 358 IILVFMVYVLNIIF 317 ++LVF+ Y NI+F Sbjct: 79 VLLVFLTYFFNILF 92 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 22.2 bits (45), Expect = 5.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 358 IILVFMVYVLNIIF 317 ++LVF+ Y NI+F Sbjct: 75 VLLVFLTYFFNILF 88 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 448 NVCQSFLSDKRYVVKLKIN 504 ++CQ S K+ +VK+KI+ Sbjct: 312 DLCQEANSTKKLIVKIKID 330 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,617 Number of Sequences: 336 Number of extensions: 2875 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24927353 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -