BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G02 (870 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76010.1 68414.m08825 expressed protein 28 7.1 At1g72110.1 68414.m08335 expressed protein 28 7.1 At1g49670.1 68414.m05570 ARP protein (REF) identical to ARP prot... 28 9.3 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 9.3 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 28.3 bits (60), Expect = 7.1 Identities = 26/63 (41%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Frame = +1 Query: 172 DSGNGYE-PIDNRPYIVNPPKDYNPNGNG-YE-PIDNGAYYVDRPQG-RPYFKPTPFPGA 339 D G GY+ P ++R Y D P G G Y+ P G Y D PQG R Y P P Sbjct: 220 DGGYGYDAPHEHRGYDDRGGYDAPPQGRGGYDGPQGRGGY--DGPQGRRGYDGP---PQG 274 Query: 340 RGG 348 RGG Sbjct: 275 RGG 277 >At1g72110.1 68414.m08335 expressed protein Length = 479 Score = 28.3 bits (60), Expect = 7.1 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 421 NSYEILKYIVNTLFRY*-FSKIFFTSHREHQGK 326 N+ I++ I NTL + FS I T H EH+GK Sbjct: 41 NASTIVEGIKNTLINHPRFSSILVTGHGEHKGK 73 >At1g49670.1 68414.m05570 ARP protein (REF) identical to ARP protein GB:CAA89858 GI:886434 from [Arabidopsis thaliana]; contains Pfam profile PF00107: oxidoreductase, zinc-binding dehydrogenase family Length = 629 Score = 27.9 bits (59), Expect = 9.3 Identities = 23/95 (24%), Positives = 42/95 (44%) Frame = +2 Query: 92 EILHDFRPSLCWLWPTLKTPLG*WKTPTQETATNLLTTARTSLILPKTTTLMETATNLST 271 E++ D + + LW T + L W TP +ET + +++R K +T +E + Sbjct: 231 ELITDEKKAGACLWITKRRGLEYWPTPMEETKYLVGSSSRKRPSF-KVSTKIEFPQSFEK 289 Query: 272 TVHITWTVPKADLTSSLPLSLVLAVGSKEYLRKLI 376 + T + T + L L +G + L K+I Sbjct: 290 MIVHTLSHKFRSATRIVRAPLQLPIGPHQVLLKII 324 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 27.9 bits (59), Expect = 9.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +1 Query: 223 PPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPFP 333 PP + P +P+D Y PQG Y+ P+P P Sbjct: 141 PPPQHPPPRPQSQPLD----YYSAPQGNHYYSPSPPP 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,630,831 Number of Sequences: 28952 Number of extensions: 253907 Number of successful extensions: 491 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 490 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2038669600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -