BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_G01 (851 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 50 1e-05 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 50 1e-05 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 50 1e-05 D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 45 3e-04 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 45 3e-04 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 45 3e-04 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 45 3e-04 BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting pr... 44 0.001 AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. 44 0.001 AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. 44 0.001 AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant pr... 42 0.003 AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens ... 41 0.007 U88154-1|AAC17709.1| 1021|Homo sapiens proline and glutamic acid... 40 0.009 U88153-1|AAC17708.2| 1284|Homo sapiens PELP1 protein. 40 0.009 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 40 0.009 BC069058-1|AAH69058.1| 1130|Homo sapiens proline, glutamic acid ... 40 0.009 BC010457-1|AAH10457.2| 1048|Homo sapiens PELP1 protein protein. 40 0.009 BC002875-1|AAH02875.2| 743|Homo sapiens PELP1 protein protein. 40 0.009 AY882602-1|AAW80659.1| 1061|Homo sapiens transcription factor HM... 40 0.009 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 40 0.009 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 40 0.009 AF547989-1|AAN41255.1| 1130|Homo sapiens MNAR protein. 40 0.009 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 40 0.009 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 40 0.009 S80905-1|AAB50686.1| 382|Homo sapiens Con1 protein. 40 0.011 AK096970-1|BAC04915.1| 485|Homo sapiens protein ( Homo sapiens ... 40 0.011 AL646016-1|CAI17009.1| 1865|Homo sapiens formin 2 protein. 39 0.020 AL590490-1|CAH70931.1| 1865|Homo sapiens formin 2 protein. 39 0.020 AL513342-1|CAI17121.1| 1865|Homo sapiens formin 2 protein. 39 0.020 AL359918-1|CAI15795.1| 1865|Homo sapiens formin 2 protein. 39 0.020 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 39 0.020 AB209153-1|BAD92390.1| 1332|Homo sapiens formin 2 variant protein. 39 0.020 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 39 0.026 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 39 0.026 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 39 0.026 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 39 0.026 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 38 0.035 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 38 0.035 BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precu... 37 0.045 AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precu... 37 0.045 AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73... 37 0.045 X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage f... 38 0.046 X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. 38 0.046 K02575-1|AAA36502.1| 173|Homo sapiens protein ( Human salivary ... 38 0.046 BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. 38 0.046 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 38 0.046 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 38 0.046 AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenyl... 38 0.046 X07517-1|CAA30395.2| 236|Homo sapiens salivary proline-rich pro... 38 0.061 X07516-1|CAA30394.2| 297|Homo sapiens salivary proline-rich pro... 38 0.061 S62941-1|AAB27289.1| 358|Homo sapiens Ps 2 protein. 38 0.061 S62928-1|AAB27288.2| 297|Homo sapiens PRB1M protein precursor p... 38 0.061 S52986-1|AAA13341.2| 331|Homo sapiens basic salivary proline-ri... 38 0.061 M97220-1|AAB05816.1| 331|Homo sapiens salivary proline-rich pro... 38 0.061 K03204-1|AAA60185.1| 331|Homo sapiens PRB1 protein. 38 0.061 BC044827-1|AAH44827.1| 338|Homo sapiens PRB2 protein protein. 38 0.061 K03208-1|AAA60189.1| 251|Homo sapiens PRB2 protein. 37 0.081 DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. 37 0.081 DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. 37 0.081 BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (D... 37 0.081 BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. 37 0.081 AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. 37 0.081 AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. 37 0.081 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 37 0.081 AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant pr... 37 0.081 AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adapto... 34 0.100 X07704-1|CAA30542.1| 234|Homo sapiens Po protein protein. 37 0.11 Y14385-1|CAA74743.1| 1258|Homo sapiens inositol polyphosphate 5-... 36 0.14 Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. 36 0.14 Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. 36 0.14 M98776-1|AAB47721.1| 644|Homo sapiens keratin 1 protein. 36 0.14 L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1... 36 0.14 L36818-1|AAA96658.1| 1149|Homo sapiens 51C protein protein. 36 0.14 D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. 36 0.14 D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternativel... 36 0.14 BC063697-1|AAH63697.1| 644|Homo sapiens keratin 1 (epidermolyti... 36 0.14 BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. 36 0.14 BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. 36 0.14 BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. 36 0.14 BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger ... 36 0.14 AF304164-1|AAG41947.1| 644|Homo sapiens keratin 1 protein. 36 0.14 AF237621-1|AAF60327.1| 644|Homo sapiens keratin 1 protein. 36 0.14 M74027-1|AAA59875.1| 573|Homo sapiens mucin protein. 36 0.19 BC050072-1|AAH50072.1| 489|Homo sapiens forkhead box G1 protein. 36 0.19 BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding prote... 36 0.19 BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. 36 0.19 BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding prote... 36 0.19 AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding prot... 36 0.19 AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein N... 36 0.19 BC085004-1|AAH85004.1| 710|Homo sapiens KHSRP protein protein. 36 0.25 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 36 0.25 AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. 36 0.25 K03207-1|AAA60188.1| 247|Homo sapiens salivary proline-rich pro... 35 0.33 BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. 35 0.33 BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. 35 0.33 AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein pr... 35 0.33 M94131-1|AAA59163.1| 1270|Homo sapiens mucin protein. 35 0.43 L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein. 35 0.43 BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p... 35 0.43 BC012062-1|AAH12062.1| 407|Homo sapiens DAZ associated protein ... 35 0.43 AY675556-1|AAV91783.1| 474|Homo sapiens myocyte enhancer factor... 35 0.43 AK056850-1|BAB71295.1| 289|Homo sapiens protein ( Homo sapiens ... 35 0.43 AF181719-1|AAF78364.1| 407|Homo sapiens DAZ associated protein ... 35 0.43 AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. 35 0.43 AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE... 35 0.43 AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. 35 0.43 Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated ph... 34 0.57 X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated ph... 34 0.57 BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosop... 34 0.57 BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. 34 0.57 BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated ... 34 0.57 BC029566-1|AAH29566.1| 189|Homo sapiens DMRTB1 protein protein. 34 0.57 BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated ... 34 0.57 AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. 34 0.57 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 34 0.57 AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosop... 34 0.57 AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosop... 34 0.57 AL365445-2|CAI22836.1| 342|Homo sapiens DMRT-like family B with... 34 0.57 AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosop... 34 0.57 AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosop... 34 0.57 AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens ... 34 0.57 AK057273-1|BAB71407.1| 342|Homo sapiens protein ( Homo sapiens ... 34 0.57 AJ291671-1|CAC40654.1| 336|Homo sapiens doublesex-mab-3 (DM) do... 34 0.57 AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. 34 0.57 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 34 0.57 BC108290-1|AAI08291.1| 316|Homo sapiens LOR protein protein. 34 0.75 BC034690-1|AAH34690.1| 316|Homo sapiens LOR protein protein. 34 0.75 AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activ... 28 0.81 X07881-1|CAA30728.1| 309|Homo sapiens proline-rich protein G1 p... 33 1.00 Y13440-1|CAA73851.1| 582|Homo sapiens Rox protein. 33 1.3 X96401-1|CAA65265.1| 582|Homo sapiens ROX protein protein. 33 1.3 X07882-1|CAA30729.1| 226|Homo sapiens Po protein protein. 33 1.3 S80916-1|AAB50687.2| 238|Homo sapiens parotid 'o' protein protein. 33 1.3 D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. 33 1.3 BC130531-1|AAI30532.1| 491|Homo sapiens Cas-Br-M (murine) ecotr... 33 1.3 BC130529-1|AAI30530.1| 491|Homo sapiens Cas-Br-M (murine) ecotr... 33 1.3 BC130386-1|AAI30387.1| 268|Homo sapiens PRB4 protein protein. 33 1.3 BC128191-1|AAI28192.1| 183|Homo sapiens PRB4 protein protein. 33 1.3 BC117563-1|AAI17564.1| 582|Homo sapiens MAX binding protein pro... 33 1.3 BC044636-1|AAH44636.1| 520|Homo sapiens YLPM1 protein protein. 33 1.3 BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, mem... 33 1.3 BC027460-1|AAH27460.2| 488|Homo sapiens CBLL1 protein protein. 33 1.3 AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, mem... 33 1.3 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 33 1.3 AK091050-1|BAC03574.1| 723|Homo sapiens protein ( Homo sapiens ... 33 1.3 AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. 33 1.3 AK026762-1|BAB15544.1| 491|Homo sapiens protein ( Homo sapiens ... 33 1.3 AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. 33 1.3 AC002467-2|AAS07390.1| 491|Homo sapiens unknown protein. 33 1.3 Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfami... 27 1.5 X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. 27 1.5 U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. 27 1.5 U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. 27 1.5 EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfa... 27 1.5 D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. 27 1.5 BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfa... 27 1.5 AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. 27 1.5 AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. 27 1.5 AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. 27 1.6 Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for ... 33 1.7 X99720-1|CAA68060.1| 491|Homo sapiens TPRC protein. 33 1.7 X97124-1|CAA65791.1| 491|Homo sapiens prcc protein. 33 1.7 X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. 33 1.7 X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. 33 1.7 M94077-1|AAA36181.1| 316|Homo sapiens loricrin protein. 33 1.7 M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. 33 1.7 M61120-1|AAA36180.1| 316|Homo sapiens loricrin protein. 33 1.7 K03205-1|AAA60186.1| 198|Homo sapiens PRB1 protein. 33 1.7 CR536555-1|CAG38792.1| 316|Homo sapiens LOR protein. 33 1.7 CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. 33 1.7 BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein pr... 33 1.7 BC111727-1|AAI11728.1| 1077|Homo sapiens transcription elongatio... 33 1.7 BC096211-1|AAH96211.1| 309|Homo sapiens PRB3 protein protein. 33 1.7 BC096210-1|AAH96210.1| 309|Homo sapiens PRB3 protein protein. 33 1.7 BC096209-1|AAH96209.1| 309|Homo sapiens PRB3 protein protein. 33 1.7 BC010450-1|AAH10450.1| 491|Homo sapiens papillary renal cell ca... 33 1.7 BC004913-1|AAH04913.1| 491|Homo sapiens papillary renal cell ca... 33 1.7 AL590666-16|CAI16350.1| 491|Homo sapiens papillary renal cell c... 33 1.7 AL161636-5|CAI19560.1| 312|Homo sapiens loricrin protein. 33 1.7 AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 p... 33 1.7 AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. 33 1.7 AF106062-1|AAD45972.1| 312|Homo sapiens Wiskott-Aldrich syndrom... 33 1.7 AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protei... 33 1.7 AF017789-1|AAB80727.1| 1098|Homo sapiens putative transcription ... 33 1.7 AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. 33 1.7 AB209910-1|BAD93147.1| 1081|Homo sapiens transcription elongatio... 33 1.7 AB013076-1|BAA25794.1| 338|Homo sapiens loricrin protein. 33 1.7 AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. 33 1.7 AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. 27 1.8 AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens ... 27 2.0 Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Dro... 32 2.3 Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Dro... 32 2.3 Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. 32 2.3 Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. 32 2.3 X63522-1|CAA45087.1| 533|Homo sapiens retinoic acid X receptor ... 32 2.3 U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc ... 32 2.3 M84820-1|AAA60293.1| 533|Homo sapiens retinoid X receptor beta ... 32 2.3 BT007280-1|AAP35944.1| 533|Homo sapiens retinoid X receptor, be... 32 2.3 BC141917-1|AAI41918.1| 198|Homo sapiens PRB1 protein protein. 32 2.3 BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. 32 2.3 BC064990-1|AAH64990.1| 1147|Homo sapiens splicing factor, argini... 32 2.3 BC052286-1|AAH52286.1| 1147|Homo sapiens splicing factor, argini... 32 2.3 BC043353-1|AAH43353.1| 1146|Homo sapiens splicing factor, argini... 32 2.3 BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 32 2.3 BC014921-1|AAH14921.1| 1147|Homo sapiens splicing factor, argini... 32 2.3 BC001167-1|AAH01167.1| 533|Homo sapiens retinoid X receptor, be... 32 2.3 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 32 2.3 AL844527-9|CAI41836.2| 537|Homo sapiens retinoid X receptor, be... 32 2.3 AL844527-8|CAI41837.1| 533|Homo sapiens retinoid X receptor, be... 32 2.3 AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL662824-21|CAI17612.2| 537|Homo sapiens retinoid X receptor, b... 32 2.3 AL662824-20|CAI17614.1| 533|Homo sapiens retinoid X receptor, b... 32 2.3 AL645940-7|CAI18064.2| 537|Homo sapiens retinoid X receptor, be... 32 2.3 AL645940-6|CAI18066.1| 533|Homo sapiens retinoid X receptor, be... 32 2.3 AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL117417-1|CAB55911.1| 667|Homo sapiens hypothetical protein pr... 32 2.3 AL031228-14|CAI95622.1| 482|Homo sapiens retinoid X receptor, b... 32 2.3 AL031228-13|CAA20239.1| 533|Homo sapiens retinoid X receptor, b... 32 2.3 AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (D... 32 2.3 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 32 2.3 AF120161-1|AAD13794.1| 533|Homo sapiens retinoic X receptor bet... 32 2.3 AF065396-1|AAC18599.1| 533|Homo sapiens retinoic X receptor B p... 32 2.3 AF023142-1|AAD09327.1| 1157|Homo sapiens pre-mRNA splicing SR pr... 32 2.3 AB209244-1|BAD92481.1| 577|Homo sapiens retinoid X receptor, be... 32 2.3 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 32 2.3 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 32 2.3 AB032998-1|BAA86486.1| 929|Homo sapiens KIAA1172 protein protein. 32 2.3 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 26 2.3 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 26 2.3 Z29074-1|CAA82315.1| 623|Homo sapiens cytokeratin 9 protein. 32 3.0 X75015-1|CAA52924.1| 622|Homo sapiens keratin 9 protein. 32 3.0 U94832-1|AAB53222.1| 711|Homo sapiens KSRP protein. 32 3.0 S69510-1|AAC60619.1| 622|Homo sapiens cytokeratin 9 protein. 32 3.0 L21990-1|AAA60301.1| 464|Homo sapiens spiceosomal protein protein. 32 3.0 BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein pr... 32 3.0 BX284695-2|CAI17373.1| 1461|Homo sapiens KIAA0460 protein. 32 3.0 BX284695-1|CAI17374.1| 1435|Homo sapiens KIAA0460 protein. 32 3.0 BC121170-1|AAI21171.1| 467|Homo sapiens KRT9 protein protein. 32 3.0 BC111697-1|AAI11698.1| 983|Homo sapiens RBM26 protein protein. 32 3.0 BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (D... 32 3.0 BC066943-1|AAH66943.1| 148|Homo sapiens proline rich 13 protein. 32 3.0 BC048963-1|AAH48963.1| 849|Homo sapiens diaphanous homolog 3 (D... 32 3.0 BC045623-1|AAH45623.2| 1398|Homo sapiens KIAA0460 protein protein. 32 3.0 BC041655-1|AAH41655.1| 980|Homo sapiens RNA binding motif prote... 32 3.0 BC034952-1|AAH34952.1| 849|Homo sapiens diaphanous homolog 3 (D... 32 3.0 BC016064-1|AAH16064.1| 148|Homo sapiens proline rich 13 protein. 32 3.0 BC015804-1|AAH15804.1| 481|Homo sapiens SF3A2 protein protein. 32 3.0 BC014257-1|AAH14257.1| 148|Homo sapiens proline rich 13 protein. 32 3.0 BC009903-1|AAH09903.1| 464|Homo sapiens splicing factor 3a, sub... 32 3.0 BC004434-1|AAH04434.1| 464|Homo sapiens splicing factor 3a, sub... 32 3.0 AY818645-1|AAW78862.1| 1112|Homo sapiens diaphanous-related form... 32 3.0 AY750055-1|AAW73254.1| 1152|Homo sapiens diaphanous homolog 3 pr... 32 3.0 AL611942-3|CAH70314.1| 1461|Homo sapiens KIAA0460 protein. 32 3.0 AL611942-2|CAH70313.1| 1435|Homo sapiens KIAA0460 protein. 32 3.0 AL390878-5|CAI14158.2| 1193|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL390878-4|CAM19740.1| 1123|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL390878-3|CAM19739.1| 1182|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL390878-2|CAM19741.1| 1147|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL390878-1|CAM19738.1| 1112|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL359266-4|CAM15405.1| 1193|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL359266-3|CAM15403.1| 1123|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL359266-2|CAM15406.1| 1182|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL359266-1|CAM15404.1| 1147|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL356502-5|CAI14102.2| 1193|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL356502-4|CAM19400.1| 1123|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL356502-3|CAM19399.1| 1182|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL356502-2|CAM19401.1| 1147|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL356502-1|CAM19398.1| 1112|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL356356-11|CAI15496.1| 1435|Homo sapiens KIAA0460 protein. 32 3.0 AL356356-10|CAI15497.1| 1461|Homo sapiens KIAA0460 protein. 32 3.0 AL354829-5|CAM14267.1| 1193|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL354829-4|CAM14265.1| 1123|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL354829-3|CAI39756.2| 1182|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL354829-2|CAM14266.1| 1147|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL354829-1|CAI39757.2| 1112|Homo sapiens diaphanous homolog 3 (D... 32 3.0 AL159974-2|CAI12923.3| 980|Homo sapiens RNA binding motif prote... 32 3.0 AL159974-1|CAI12921.2| 1008|Homo sapiens RNA binding motif prote... 32 3.0 AL139006-2|CAI95137.2| 980|Homo sapiens RNA binding motif prote... 32 3.0 AL139006-1|CAI95136.1| 1008|Homo sapiens RNA binding motif prote... 32 3.0 AK128682-1|BAC87569.1| 303|Homo sapiens protein ( Homo sapiens ... 32 3.0 AK092024-1|BAC03793.1| 699|Homo sapiens protein ( Homo sapiens ... 32 3.0 AK027456-1|BAB55125.1| 680|Homo sapiens protein ( Homo sapiens ... 32 3.0 AF093747-1|AAD29861.1| 115|Homo sapiens KH type splicing regula... 32 3.0 AC005263-1|AAC25613.1| 464|Homo sapiens SP62_HUMAN protein. 32 3.0 AB244758-1|BAE96352.1| 1123|Homo sapiens mammalian diaphanous ho... 32 3.0 AB244756-1|BAE96350.1| 1182|Homo sapiens mammalian diaphanous ho... 32 3.0 AB083343-1|BAE96598.1| 3599|Homo sapiens zinc-finger homeodomain... 32 3.0 AB007929-1|BAA32305.2| 1452|Homo sapiens KIAA0460 protein protein. 32 3.0 AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 32 3.0 K03206-1|AAA60187.1| 178|Homo sapiens PRB1 protein. 31 4.0 BC054003-1|AAH54003.1| 1192|Homo sapiens RNASEN protein protein. 31 4.0 BC028050-1|AAH28050.1| 634|Homo sapiens CREB regulated transcri... 31 4.0 BC023614-1|AAH23614.2| 604|Homo sapiens CRTC1 protein protein. 31 4.0 BC017075-1|AAH17075.2| 475|Homo sapiens CRTC1 protein protein. 31 4.0 BC002914-1|AAH02914.1| 358|Homo sapiens WIPF1 protein protein. 31 4.0 AY360171-1|AAQ98856.1| 650|Homo sapiens transducer of regulated... 31 4.0 AY040323-1|AAK93832.1| 593|Homo sapiens mucoepidermoid suscepti... 31 4.0 AF189011-1|AAF80558.1| 1374|Homo sapiens ribonuclease III protein. 31 4.0 AC006123-1|AAC97072.1| 414|Homo sapiens KIAA0616 protein protein. 31 4.0 AB014516-1|BAA31591.1| 634|Homo sapiens KIAA0616 protein protein. 31 4.0 AB023231-1|BAA76858.2| 1050|Homo sapiens KIAA1014 protein protein. 27 5.0 BC037404-1|AAH37404.1| 1015|Homo sapiens formin binding protein ... 27 5.0 AK022987-1|BAB14348.1| 560|Homo sapiens protein ( Homo sapiens ... 27 5.2 X14487-1|CAA32649.1| 593|Homo sapiens protein ( Human gene for ... 31 5.3 L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease prot... 31 5.3 EF695425-1|ABS01463.1| 240|Homo sapiens extraembryonic spermato... 31 5.3 BC113380-1|AAI13381.1| 1147|Homo sapiens KIAA1429 protein. 31 5.3 BC112288-1|AAI12289.1| 1147|Homo sapiens hypothetical protein LO... 31 5.3 BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. 31 5.3 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 31 5.3 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 31 5.3 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 31 5.3 AB037850-1|BAA92667.1| 1795|Homo sapiens KIAA1429 protein protein. 31 5.3 AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. 31 5.3 BX537864-1|CAD97867.1| 270|Homo sapiens hypothetical protein pr... 27 5.5 U89336-8|AAB47496.1| 200|Homo sapiens NG5 protein. 31 7.0 L40027-1|AAA62432.1| 483|Homo sapiens glycogen synthase kinase ... 31 7.0 D63424-1|BAA23608.1| 483|Homo sapiens glycogen synthase kinase ... 31 7.0 BX284686-3|CAM26211.1| 225|Homo sapiens proline-rich transmembr... 31 7.0 BX284686-2|CAM26210.1| 306|Homo sapiens proline-rich transmembr... 31 7.0 BC096212-1|AAH96212.1| 162|Homo sapiens PRB3 protein protein. 31 7.0 BC063046-1|AAH63046.1| 306|Homo sapiens proline-rich transmembr... 31 7.0 BC051865-1|AAH51865.1| 483|Homo sapiens glycogen synthase kinas... 31 7.0 BC027984-1|AAH27984.1| 483|Homo sapiens glycogen synthase kinas... 31 7.0 BC023587-1|AAH23587.1| 523|Homo sapiens REST corepressor 2 prot... 31 7.0 BC013201-1|AAH13201.1| 225|Homo sapiens PRRT1 protein protein. 31 7.0 BC010608-1|AAH10608.1| 305|Homo sapiens RCOR2 protein protein. 31 7.0 AL845464-2|CAI41796.2| 225|Homo sapiens proline-rich transmembr... 31 7.0 AL845464-1|CAI41794.2| 306|Homo sapiens proline-rich transmembr... 31 7.0 AL662884-8|CAI18341.2| 225|Homo sapiens proline-rich transmembr... 31 7.0 AL662884-7|CAI18339.2| 306|Homo sapiens proline-rich transmembr... 31 7.0 AL662828-8|CAI17421.2| 225|Homo sapiens proline-rich transmembr... 31 7.0 AL662828-7|CAI17422.2| 306|Homo sapiens proline-rich transmembr... 31 7.0 AL591375-2|CAI12099.1| 1652|Homo sapiens NHS-like 1 protein. 31 7.0 AL391669-2|CAI14157.1| 1652|Homo sapiens NHS-like 1 protein. 31 7.0 AK054885-1|BAB70821.1| 306|Homo sapiens protein ( Homo sapiens ... 31 7.0 AK023345-1|BAB14533.1| 533|Homo sapiens protein ( Homo sapiens ... 31 7.0 AC006486-1|AAD11986.1| 483|Homo sapiens KG3A_HUMAN protein. 31 7.0 AB037778-1|BAA92595.1| 836|Homo sapiens KIAA1357 protein protein. 31 7.0 BC110383-1|AAI10384.1| 594|Homo sapiens FIP1 like 1 (S. cerevis... 26 8.7 AY366510-1|AAQ88277.1| 594|Homo sapiens pre-mRNA 3'end processi... 26 8.7 BC052959-1|AAH52959.1| 559|Homo sapiens FIP1L1 protein protein. 26 8.8 BC024016-1|AAH24016.1| 559|Homo sapiens FIP1L1 protein protein. 26 8.8 BC011543-1|AAH11543.1| 328|Homo sapiens FIP1L1 protein protein. 26 9.2 Z93020-1|CAI21594.1| 729|Homo sapiens RAN binding protein 9 pro... 30 9.3 X71428-1|CAA50559.1| 525|Homo sapiens FUS gycline rich protein ... 30 9.3 X71427-1|CAA50558.1| 462|Homo sapiens FUS-CHOP protein fusion p... 30 9.3 S62140-1|AAB27102.1| 526|Homo sapiens TLS protein. 30 9.3 S62138-1|AAB27103.1| 462|Homo sapiens TLS-CHOP protein. 30 9.3 M10938-1|AAA36153.1| 493|Homo sapiens protein ( Human epidermal... 30 9.3 D29833-1|BAA06213.1| 79|Homo sapiens proline rich peptide P-B ... 30 9.3 CR456747-1|CAG33028.1| 526|Homo sapiens FUS protein. 30 9.3 BT007131-1|AAP35795.1| 526|Homo sapiens fusion, derived from t(... 30 9.3 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 30 9.3 BC052781-1|AAH52781.1| 802|Homo sapiens RANBP9 protein protein. 30 9.3 BC049204-1|AAH49204.1| 251|Homo sapiens homeobox B4 protein. 30 9.3 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 30 9.3 BC026062-1|AAH26062.1| 526|Homo sapiens fusion (involved in t(1... 30 9.3 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 30 9.3 BC015327-1|AAH15327.1| 79|Homo sapiens submaxillary gland andr... 30 9.3 BC002459-1|AAH02459.1| 526|Homo sapiens fusion (involved in t(1... 30 9.3 BC000402-1|AAH00402.1| 526|Homo sapiens fusion (involved in t(1... 30 9.3 AY157990-1|AAN76325.1| 1778|Homo sapiens myeloid/lymphoid or mix... 30 9.3 AY147037-1|AAN17675.1| 1858|Homo sapiens MLL5 protein. 30 9.3 AL441883-5|CAI19841.1| 729|Homo sapiens RAN binding protein 9 p... 30 9.3 AL137449-1|CAB70742.1| 246|Homo sapiens hypothetical protein pr... 30 9.3 AK025837-1|BAB15254.1| 616|Homo sapiens protein ( Homo sapiens ... 30 9.3 AF519459-1|AAM74947.1| 1858|Homo sapiens MLL5 protein. 30 9.3 AF307160-1|AAG45052.1| 251|Homo sapiens HOXB4 protein. 30 9.3 AF287967-4|AAG31554.1| 251|Homo sapiens homeobox B4 protein. 30 9.3 AF071213-2|AAC35284.1| 525|Homo sapiens FUS/TLS protein protein. 30 9.3 AF071213-1|AAC35285.1| 526|Homo sapiens FUS/TLS protein protein. 30 9.3 AB055311-1|BAB62525.1| 729|Homo sapiens RanBPM protein. 30 9.3 AB037732-1|BAA92549.1| 889|Homo sapiens KIAA1311 protein protein. 30 9.3 AB031740-1|BAA88517.1| 79|Homo sapiens salivary proline-rich p... 30 9.3 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 30 9.3 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 50.0 bits (114), Expect = 1e-05 Identities = 27/86 (31%), Positives = 28/86 (32%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PP P PPP P PPPP PP Sbjct: 324 PPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPL 383 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 +P GG PPPPPP P Sbjct: 384 SQPT----GGAPPPPPPPPPPGPPPP 405 Score = 45.6 bits (103), Expect = 2e-04 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 2/92 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXX--GXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PPP G S P P P PPPPP P PP Sbjct: 325 PPPPMIGIPPPPPPVGFGSPGTP----PPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPP 380 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GGA PPPPP PP P Sbjct: 381 PPLSQPT----GGAP----PPPPPPPPPGPPP 404 Score = 38.3 bits (85), Expect = 0.035 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP PP P PPP P PPPP PP Sbjct: 300 PPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIP---------PPPPPVGFGSPGTPPPP 350 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P PPPPPP P P Sbjct: 351 SPPSFPPHPDFAAPPPPPPPPAADYPTLPP 380 Score = 37.1 bits (82), Expect = 0.081 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = +1 Query: 583 PPPXXXXPXPXXGXXLLXXXXXXXPXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXX 762 PPP P P P P P PPPP PP P Sbjct: 326 PPPMIGIPPPPPPVGFGSPGTPPPPSPPSF----PPHPDFAAPPPPPPPPAADY--PTLP 379 Query: 763 XNPXXXRGGGXXXXXXPPPPPXXPXP 840 P GG PPPPP P P Sbjct: 380 PPPLSQPTGGAPPPPPPPPPPGPPPP 405 Score = 33.1 bits (72), Expect = 1.3 Identities = 30/122 (24%), Positives = 32/122 (26%), Gaps = 5/122 (4%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPP-----XGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXP 583 P P P F PP PPP P P G G+ P Sbjct: 310 PGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGS----PGTPPPPSPPSFPPHPDFAAPP 365 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP + P P PPPP P PP Sbjct: 366 PPP----PPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLS 421 Query: 764 XT 769 T Sbjct: 422 DT 423 Score = 33.1 bits (72), Expect = 1.3 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 4/82 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXP----PPPXPXXXXXXX 749 PPPPS PP P P PPP P P PPP P Sbjct: 347 PPPPS----PPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPP-----PP 397 Query: 750 PPXXXKPXXXXGGGXXXXXPPP 815 PP P G PPP Sbjct: 398 PPPGPPPPPFTGADGQPAIPPP 419 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 50.0 bits (114), Expect = 1e-05 Identities = 27/86 (31%), Positives = 28/86 (32%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PP P PPP P PPPP PP Sbjct: 324 PPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPL 383 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 +P GG PPPPPP P Sbjct: 384 SQPT----GGAPPPPPPPPPPGPPPP 405 Score = 45.6 bits (103), Expect = 2e-04 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 2/92 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXX--GXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PPP G S P P P PPPPP P PP Sbjct: 325 PPPPMIGIPPPPPPVGFGSPGTP----PPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPP 380 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GGA PPPPP PP P Sbjct: 381 PPLSQPT----GGAP----PPPPPPPPPGPPP 404 Score = 38.3 bits (85), Expect = 0.035 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP PP P PPP P PPPP PP Sbjct: 300 PPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIP---------PPPPPVGFGSPGTPPPP 350 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P PPPPPP P P Sbjct: 351 SPPSFPPHPDFAAPPPPPPPPAADYPTLPP 380 Score = 37.1 bits (82), Expect = 0.081 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = +1 Query: 583 PPPXXXXPXPXXGXXLLXXXXXXXPXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXX 762 PPP P P P P P PPPP PP P Sbjct: 326 PPPMIGIPPPPPPVGFGSPGTPPPPSPPSF----PPHPDFAAPPPPPPPPAADY--PTLP 379 Query: 763 XNPXXXRGGGXXXXXXPPPPPXXPXP 840 P GG PPPPP P P Sbjct: 380 PPPLSQPTGGAPPPPPPPPPPGPPPP 405 Score = 33.1 bits (72), Expect = 1.3 Identities = 30/122 (24%), Positives = 32/122 (26%), Gaps = 5/122 (4%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPP-----XGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXP 583 P P P F PP PPP P P G G+ P Sbjct: 310 PGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGS----PGTPPPPSPPSFPPHPDFAAPP 365 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP + P P PPPP P PP Sbjct: 366 PPP----PPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLS 421 Query: 764 XT 769 T Sbjct: 422 DT 423 Score = 33.1 bits (72), Expect = 1.3 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 4/82 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXP----PPPXPXXXXXXX 749 PPPPS PP P P PPP P P PPP P Sbjct: 347 PPPPS----PPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPP-----PP 397 Query: 750 PPXXXKPXXXXGGGXXXXXPPP 815 PP P G PPP Sbjct: 398 PPPGPPPPPFTGADGQPAIPPP 419 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 50.0 bits (114), Expect = 1e-05 Identities = 27/86 (31%), Positives = 28/86 (32%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PP P PPP P PPPP PP Sbjct: 324 PPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPL 383 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 +P GG PPPPPP P Sbjct: 384 SQPT----GGAPPPPPPPPPPGPPPP 405 Score = 45.6 bits (103), Expect = 2e-04 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 2/92 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXX--GXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PPP G S P P P PPPPP P PP Sbjct: 325 PPPPMIGIPPPPPPVGFGSPGTP----PPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPP 380 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GGA PPPPP PP P Sbjct: 381 PPLSQPT----GGAP----PPPPPPPPPGPPP 404 Score = 38.3 bits (85), Expect = 0.035 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP PP P PPP P PPPP PP Sbjct: 300 PPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIP---------PPPPPVGFGSPGTPPPP 350 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P PPPPPP P P Sbjct: 351 SPPSFPPHPDFAAPPPPPPPPAADYPTLPP 380 Score = 37.1 bits (82), Expect = 0.081 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = +1 Query: 583 PPPXXXXPXPXXGXXLLXXXXXXXPXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXX 762 PPP P P P P P PPPP PP P Sbjct: 326 PPPMIGIPPPPPPVGFGSPGTPPPPSPPSF----PPHPDFAAPPPPPPPPAADY--PTLP 379 Query: 763 XNPXXXRGGGXXXXXXPPPPPXXPXP 840 P GG PPPPP P P Sbjct: 380 PPPLSQPTGGAPPPPPPPPPPGPPPP 405 Score = 33.1 bits (72), Expect = 1.3 Identities = 30/122 (24%), Positives = 32/122 (26%), Gaps = 5/122 (4%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPP-----XGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXP 583 P P P F PP PPP P P G G+ P Sbjct: 310 PGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGS----PGTPPPPSPPSFPPHPDFAAPP 365 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP + P P PPPP P PP Sbjct: 366 PPP----PPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLS 421 Query: 764 XT 769 T Sbjct: 422 DT 423 Score = 33.1 bits (72), Expect = 1.3 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 4/82 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXP----PPPXPXXXXXXX 749 PPPPS PP P P PPP P P PPP P Sbjct: 347 PPPPS----PPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPP-----PP 397 Query: 750 PPXXXKPXXXXGGGXXXXXPPP 815 PP P G PPP Sbjct: 398 PPPGPPPPPFTGADGQPAIPPP 419 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 45.2 bits (102), Expect = 3e-04 Identities = 28/92 (30%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS--PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP+ P PS P PP P PPPP PP Sbjct: 300 PPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVEVPPPPPNRMYPPPPPALPSSAPSGPP 359 Query: 756 XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPPPP P P Sbjct: 360 PP--PPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/115 (25%), Positives = 29/115 (25%), Gaps = 3/115 (2%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXG---PXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPP 589 P P P P PPP P P G GA PPP Sbjct: 278 PPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVEVPPP 337 Query: 590 PXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 P PP P P P PPPPP PP P Sbjct: 338 PPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 38.7 bits (86), Expect = 0.026 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 6/87 (6%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP P P P PPP P PPPP P PP Sbjct: 277 PPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVEVPP 336 Query: 756 XXXK----PXXXXGGGXXXXXPPPPPP 824 P PPPPPP Sbjct: 337 PPPNRMYPPPPPALPSSAPSGPPPPPP 363 Score = 37.9 bits (84), Expect = 0.046 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +1 Query: 583 PPPXXXXPXPXXGXXLLXXXXXXXPXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXX 762 PPP P P P P PPPP P P Sbjct: 301 PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVEVPPPPPNRMYPPPP-PALPSSAPSGPP 359 Query: 763 XNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P G G PPPPP P P P Sbjct: 360 PPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP P G PPPPP P P Sbjct: 278 PPPPPSRGGPPPPPPPPHSSGPPPPPARG---RGAPPPPPSRAPTAAP 322 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P A PPPPP P P Sbjct: 289 PPPPPPHSSGPPPPPARGRGAPPPP-PSRAPTAAPPPPPPSRPSVEVP 335 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 45.2 bits (102), Expect = 3e-04 Identities = 28/92 (30%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS--PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP+ P PS P PP P PPPP PP Sbjct: 300 PPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPP 359 Query: 756 XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPPPP P P Sbjct: 360 PP--PPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 40.7 bits (91), Expect = 0.007 Identities = 30/115 (26%), Positives = 30/115 (26%), Gaps = 4/115 (3%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXG---PXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXX-GXXPP 586 P P P P PPP P P G GA PP Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPP 337 Query: 587 PPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 PP PPP S P P PPPPP PP P Sbjct: 338 PPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 38.7 bits (86), Expect = 0.026 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 6/87 (6%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP P P P PPP P PPPP P PP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPP 336 Query: 756 XXXK----PXXXXGGGXXXXXPPPPPP 824 P PPPPPP Sbjct: 337 PPPNRMYPPPPPALPSSAPSGPPPPPP 363 Score = 37.9 bits (84), Expect = 0.046 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +1 Query: 583 PPPXXXXPXPXXGXXLLXXXXXXXPXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXX 762 PPP P P P P PPPP P P Sbjct: 301 PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPP-PALPSSAPSGPP 359 Query: 763 XNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P G G PPPPP P P P Sbjct: 360 PPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP P G PPPPP P P Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPPPPARG---RGAPPPPPSRAPTAAP 322 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P A PPPPP P P Sbjct: 289 PPPPPPHNSGPPPPPARGRGAPPPP-PSRAPTAAPPPPPPSRPSVAVP 335 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 45.2 bits (102), Expect = 3e-04 Identities = 28/92 (30%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS--PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP+ P PS P PP P PPPP PP Sbjct: 300 PPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALLSSAPSGPP 359 Query: 756 XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPPPP P P Sbjct: 360 PP--PPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 40.7 bits (91), Expect = 0.007 Identities = 30/115 (26%), Positives = 30/115 (26%), Gaps = 4/115 (3%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXG---PXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXX-GXXPP 586 P P P P PPP P P G GA PP Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPP 337 Query: 587 PPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 PP PPP S P P PPPPP PP P Sbjct: 338 PPNRMYPPPPPALLSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 37.9 bits (84), Expect = 0.046 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 6/87 (6%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP P P P PPP P PPPP P PP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPP 336 Query: 756 XXXK----PXXXXGGGXXXXXPPPPPP 824 P PPPPPP Sbjct: 337 PPPNRMYPPPPPALLSSAPSGPPPPPP 363 Score = 37.9 bits (84), Expect = 0.046 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +1 Query: 583 PPPXXXXPXPXXGXXLLXXXXXXXPXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXX 762 PPP P P P P PPPP P P Sbjct: 301 PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPP-PALLSSAPSGPP 359 Query: 763 XNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P G G PPPPP P P P Sbjct: 360 PPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP P G PPPPP P P Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPPPPARG---RGAPPPPPSRAPTAAP 322 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P A PPPPP P P Sbjct: 289 PPPPPPHNSGPPPPPARGRGAPPPP-PSRAPTAAPPPPPPSRPSVAVP 335 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 45.2 bits (102), Expect = 3e-04 Identities = 28/92 (30%), Positives = 29/92 (31%), Gaps = 2/92 (2%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS--PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP+ P PS P PP P PPPP PP Sbjct: 300 PPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPP 359 Query: 756 XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPPPP P P Sbjct: 360 PP--PPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 40.7 bits (91), Expect = 0.007 Identities = 30/115 (26%), Positives = 30/115 (26%), Gaps = 4/115 (3%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXG---PXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXX-GXXPP 586 P P P P PPP P P G GA PP Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPP 337 Query: 587 PPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 PP PPP S P P PPPPP PP P Sbjct: 338 PPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 Score = 38.7 bits (86), Expect = 0.026 Identities = 25/87 (28%), Positives = 25/87 (28%), Gaps = 6/87 (6%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP P P P PPP P PPPP P PP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPP 336 Query: 756 XXXK----PXXXXGGGXXXXXPPPPPP 824 P PPPPPP Sbjct: 337 PPPNRMYPPPPPALPSSAPSGPPPPPP 363 Score = 37.9 bits (84), Expect = 0.046 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +1 Query: 583 PPPXXXXPXPXXGXXLLXXXXXXXPXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXX 762 PPP P P P P PPPP P P Sbjct: 301 PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPP-PALPSSAPSGPP 359 Query: 763 XNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P G G PPPPP P P P Sbjct: 360 PPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 36.7 bits (81), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP P G PPPPP P P Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPPPPARG---RGAPPPPPSRAPTAAP 322 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P A PPPPP P P Sbjct: 289 PPPPPPHNSGPPPPPARGRGAPPPP-PSRAPTAAPPPPPPSRPSVAVP 335 >BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting protein family, member 2 protein. Length = 440 Score = 43.6 bits (98), Expect = 0.001 Identities = 27/90 (30%), Positives = 29/90 (32%), Gaps = 6/90 (6%) Frame = +3 Query: 573 GXXPPPPSXXXX------PPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXX 734 G PPPP+ PP P PPP P + PPPP P Sbjct: 293 GLAPPPPTSASPSLLSNRPPPPARDPPSRGAAPPPP-----PPVIRNGARDAPPPPPPYR 347 Query: 735 XXXXXPPXXXKPXXXXGGGXXXXXPPPPPP 824 PP KP PPPPPP Sbjct: 348 MHGSEPPSRGKPPPPPSRTPAGPPPPPPPP 377 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/92 (27%), Positives = 28/92 (30%), Gaps = 2/92 (2%) Frame = +2 Query: 581 PPPPXXXX--PPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P + PP P PP PP Sbjct: 179 PPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAP-----PPVKPP 233 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 +P G + PPPPP P P Sbjct: 234 P---SPVNIRTGPSGQSLAPPPPPYRQPPGVP 262 >AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. Length = 440 Score = 43.6 bits (98), Expect = 0.001 Identities = 27/90 (30%), Positives = 29/90 (32%), Gaps = 6/90 (6%) Frame = +3 Query: 573 GXXPPPPSXXXX------PPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXX 734 G PPPP+ PP P PPP P + PPPP P Sbjct: 293 GLAPPPPTSASPSLLSNRPPPPARDPPSRGAAPPPP-----PPVIRNGARDAPPPPPPYR 347 Query: 735 XXXXXPPXXXKPXXXXGGGXXXXXPPPPPP 824 PP KP PPPPPP Sbjct: 348 MHGSEPPSRGKPPPPPSRTPAGPPPPPPPP 377 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/92 (27%), Positives = 28/92 (30%), Gaps = 2/92 (2%) Frame = +2 Query: 581 PPPPXXXX--PPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P + PP P PP PP Sbjct: 179 PPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAP-----PPVKPP 233 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 +P G + PPPPP P P Sbjct: 234 P---SPVNIRTGPSGQSLAPPPPPYRQPPGVP 262 >AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. Length = 440 Score = 43.6 bits (98), Expect = 0.001 Identities = 27/90 (30%), Positives = 29/90 (32%), Gaps = 6/90 (6%) Frame = +3 Query: 573 GXXPPPPSXXXX------PPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXX 734 G PPPP+ PP P PPP P + PPPP P Sbjct: 293 GLAPPPPTSASPSLLSNRPPPPARDPPSRGAAPPPP-----PPVIRNGARDAPPPPPPYR 347 Query: 735 XXXXXPPXXXKPXXXXGGGXXXXXPPPPPP 824 PP KP PPPPPP Sbjct: 348 MHGSEPPSRGKPPPPPSRTPAGPPPPPPPP 377 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/92 (27%), Positives = 28/92 (30%), Gaps = 2/92 (2%) Frame = +2 Query: 581 PPPPXXXX--PPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P + PP P PP PP Sbjct: 179 PPPPGRRANAPPTPLPMHSSKAPAYNREKPLPPTPGQRLHPGREGPPAP-----PPVKPP 233 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 +P G + PPPPP P P Sbjct: 234 P---SPVNIRTGPSGQSLAPPPPPYRQPPGVP 262 >AB209373-1|BAD92610.1| 410|Homo sapiens CS0DA006YC23 variant protein. Length = 410 Score = 41.9 bits (94), Expect = 0.003 Identities = 27/91 (29%), Positives = 27/91 (29%), Gaps = 2/91 (2%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPP--PXXXXXPPXXPPX 757 PPP PPP S P P P PPPP P PP PP Sbjct: 312 PPPPPVPPPPA----SFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPG 367 Query: 758 XXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P PP PP PP P Sbjct: 368 LGLPPASYPPPAVPPGGQPPVPPPIPPPGMP 398 Score = 38.7 bits (86), Expect = 0.026 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP PP P P PP P PP P PP Sbjct: 316 PVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHP-PPGLGLPPAS 374 Query: 762 XKPXXXXGGGXXXXXPPPPPP 824 P GG PP PPP Sbjct: 375 YPPPAVPPGGQPPVPPPIPPP 395 >AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens cDNA FLJ90750 fis, clone PLACE2000118, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN HOMOLOG. ). Length = 169 Score = 40.7 bits (91), Expect = 0.007 Identities = 28/82 (34%), Positives = 28/82 (34%) Frame = +2 Query: 605 PPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXXXTPXXXG 784 PPP G S P P P PPPPP P PP P Sbjct: 7 PPPPVGFGSPGTP----PPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPT--- 59 Query: 785 GGGAXXXXXPPPPPXXPPXXXP 850 GGA PPPPP PP P Sbjct: 60 -GGA-----PPPPPPPPPGPPP 75 Score = 39.5 bits (88), Expect = 0.015 Identities = 28/86 (32%), Positives = 28/86 (32%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PP SP PPP P PPPP P PP Sbjct: 5 PPPP-----PPVGFGSPGT-----PPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPP- 53 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 P GG PPPPP P Sbjct: 54 --PLSQPTGGAPPPPPPPPPGPPPPP 77 Score = 33.1 bits (72), Expect = 1.3 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP P GG PPPPP P P P Sbjct: 36 PPPPPPPPAADYPTLPPPPLSQPTGGAP-----PPPPPPPPGPPPP 76 Score = 32.3 bits (70), Expect = 2.3 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PPPP PP P PPPPPP P P Sbjct: 6 PPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPP 52 Score = 32.3 bits (70), Expect = 2.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 715 PPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXP 840 PPP PP P P GG PPPP P P Sbjct: 36 PPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPGPPPPP 77 Score = 30.3 bits (65), Expect = 9.3 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 5/88 (5%) Frame = +2 Query: 572 GXXPPPPXXXX-----PPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXX 736 G PPPP PPP P P P PP Sbjct: 3 GIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGA 62 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPP 820 PP PP P G PPP Sbjct: 63 PPPPPPPPPGPPPPPFTGADGQPAIPPP 90 >U88154-1|AAC17709.1| 1021|Homo sapiens proline and glutamic acid rich nuclear protein isoform protein. Length = 1021 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPPS PP P P P PPPP P PP Sbjct: 682 PPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLPPPQ 741 Query: 762 XKPXXXXGGG 791 P GGG Sbjct: 742 LVPEGTPGGG 751 Score = 31.1 bits (67), Expect = 5.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP--PXXXXTPXXXGGGG----AXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P P A PPPPP PP P Sbjct: 681 PPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGP 734 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXK--PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PPP P PP K P PPPPPP P P Sbjct: 690 PPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLP 738 >U88153-1|AAC17708.2| 1284|Homo sapiens PELP1 protein. Length = 1284 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPPS PP P P P PPPP P PP Sbjct: 945 PPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLPPPQ 1004 Query: 762 XKPXXXXGGG 791 P GGG Sbjct: 1005 LVPEGTPGGG 1014 Score = 31.1 bits (67), Expect = 5.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP--PXXXXTPXXXGGGG----AXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P P A PPPPP PP P Sbjct: 944 PPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGP 997 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXK--PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PPP P PP K P PPPPPP P P Sbjct: 953 PPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLP 1001 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 40.3 bits (90), Expect = 0.009 Identities = 23/83 (27%), Positives = 25/83 (30%) Frame = +3 Query: 591 PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKP 770 P+ PP P P PP P + P PP P PP P Sbjct: 118 PAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPP 177 Query: 771 XXXXGGGXXXXXPPPPPPXXXXP 839 G PPPPPP P Sbjct: 178 GTD---GPVPPPPPPPPPPPGGP 197 Score = 38.7 bits (86), Expect = 0.026 Identities = 29/90 (32%), Positives = 30/90 (33%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP P P S P P P + PP PP PP PP Sbjct: 126 PPPPLPGLPSPQEAPPSA--PPQAPPLPGSP---------EPPPAPPLPGDLPPPPPPP- 173 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P G G PPPPP PP P Sbjct: 174 ---PPPPGTDGPVPP--PPPPPPPPPGGPP 198 Score = 33.5 bits (73), Expect = 1.00 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 715 PPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXP 840 PPP PP PP P G PPPPP P Sbjct: 156 PPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 197 >BC069058-1|AAH69058.1| 1130|Homo sapiens proline, glutamic acid and leucine rich protein 1 protein. Length = 1130 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPPS PP P P P PPPP P PP Sbjct: 800 PPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLPPPQ 859 Query: 762 XKPXXXXGGG 791 P GGG Sbjct: 860 LVPEGTPGGG 869 Score = 31.1 bits (67), Expect = 5.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP--PXXXXTPXXXGGGG----AXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P P A PPPPP PP P Sbjct: 799 PPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGP 852 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXK--PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PPP P PP K P PPPPPP P P Sbjct: 808 PPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLP 856 >BC010457-1|AAH10457.2| 1048|Homo sapiens PELP1 protein protein. Length = 1048 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPPS PP P P P PPPP P PP Sbjct: 718 PPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLPPPQ 777 Query: 762 XKPXXXXGGG 791 P GGG Sbjct: 778 LVPEGTPGGG 787 Score = 31.1 bits (67), Expect = 5.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP--PXXXXTPXXXGGGG----AXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P P A PPPPP PP P Sbjct: 717 PPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGP 770 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXK--PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PPP P PP K P PPPPPP P P Sbjct: 726 PPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLP 774 >BC002875-1|AAH02875.2| 743|Homo sapiens PELP1 protein protein. Length = 743 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPPS PP P P P PPPP P PP Sbjct: 413 PPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLPPPQ 472 Query: 762 XKPXXXXGGG 791 P GGG Sbjct: 473 LVPEGTPGGG 482 Score = 31.1 bits (67), Expect = 5.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP--PXXXXTPXXXGGGG----AXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P P A PPPPP PP P Sbjct: 412 PPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGP 465 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXK--PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PPP P PP K P PPPPPP P P Sbjct: 421 PPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLP 469 >AY882602-1|AAW80659.1| 1061|Homo sapiens transcription factor HMX3 protein. Length = 1061 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPPS PP P P P PPPP P PP Sbjct: 731 PPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLPPPQ 790 Query: 762 XKPXXXXGGG 791 P GGG Sbjct: 791 LVPEGTPGGG 800 Score = 31.1 bits (67), Expect = 5.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP--PXXXXTPXXXGGGG----AXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P P A PPPPP PP P Sbjct: 730 PPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGP 783 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXK--PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PPP P PP K P PPPPPP P P Sbjct: 739 PPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLP 787 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 40.3 bits (90), Expect = 0.009 Identities = 23/83 (27%), Positives = 25/83 (30%) Frame = +3 Query: 591 PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKP 770 P+ PP P P PP P + P PP P PP P Sbjct: 536 PAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPP 595 Query: 771 XXXXGGGXXXXXPPPPPPXXXXP 839 G PPPPPP P Sbjct: 596 GTD---GPVPPPPPPPPPPPGGP 615 Score = 38.7 bits (86), Expect = 0.026 Identities = 29/90 (32%), Positives = 30/90 (33%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP P P S P P P + PP PP PP PP Sbjct: 544 PPPPLPGLPSPQEAPPSA--PPQAPPLPGSP---------EPPPAPPLPGDLPPPPPPP- 591 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P G G PPPPP PP P Sbjct: 592 ---PPPPGTDGPVPP--PPPPPPPPPGGPP 616 Score = 33.5 bits (73), Expect = 1.00 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 715 PPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXP 840 PPP PP PP P G PPPPP P Sbjct: 574 PPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 615 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 40.3 bits (90), Expect = 0.009 Identities = 25/90 (27%), Positives = 26/90 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PP P PPP P PPP PP Sbjct: 452 PPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPL 511 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PPPPPP P P Sbjct: 512 SQP--------TRGAPPPPPPPPPGPPPPP 533 Score = 37.1 bits (82), Expect = 0.081 Identities = 24/86 (27%), Positives = 24/86 (27%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP P P PPP P P PP P PP Sbjct: 451 PPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPP-- 508 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 P PPPPPP P Sbjct: 509 --PPLSQPTRGAPPPPPPPPPGPPPP 532 Score = 34.3 bits (75), Expect = 0.57 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP PP P PPP P PPPP PP Sbjct: 428 PPPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIP---------PPPPPIGFGSPGTPPPP 478 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P PPPP P P Sbjct: 479 SSPSFPPHPDFAAPPPLPPPPAADYPTLPP 508 Score = 31.1 bits (67), Expect = 5.3 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 5/88 (5%) Frame = +2 Query: 572 GXXPPPPXXXX-----PPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXX 736 G PPPP PPP P P P PP Sbjct: 459 GIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGA 518 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPP 820 PP PP P G PPP Sbjct: 519 PPPPPPPPPGPPPPPFTGADGQPAVPPP 546 Score = 30.3 bits (65), Expect = 9.3 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 4/93 (4%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPPS PSP PPP P P PP Sbjct: 375 PPPSQSDSASS--PSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP 432 Query: 765 K----PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 433 PLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPP 465 >AF547989-1|AAN41255.1| 1130|Homo sapiens MNAR protein. Length = 1130 Score = 40.3 bits (90), Expect = 0.009 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPPS PP P P P PPPP P PP Sbjct: 800 PPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLPPPQ 859 Query: 762 XKPXXXXGGG 791 P GGG Sbjct: 860 LVPEGTPGGG 869 Score = 31.1 bits (67), Expect = 5.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP--PXXXXTPXXXGGGG----AXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P P A PPPPP PP P Sbjct: 799 PPPPPSGATPPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGP 852 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXK--PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PPP P PP K P PPPPPP P P Sbjct: 808 PPPIAPTGPPTASPPVPAKEEPEELPAAPGPLPPPPPPPPPVPGPVTLP 856 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 40.3 bits (90), Expect = 0.009 Identities = 23/83 (27%), Positives = 25/83 (30%) Frame = +3 Query: 591 PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKP 770 P+ PP P P PP P + P PP P PP P Sbjct: 427 PAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPP 486 Query: 771 XXXXGGGXXXXXPPPPPPXXXXP 839 G PPPPPP P Sbjct: 487 GTD---GPVPPPPPPPPPPPGGP 506 Score = 38.7 bits (86), Expect = 0.026 Identities = 29/90 (32%), Positives = 30/90 (33%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP P P S P P P + PP PP PP PP Sbjct: 435 PPPPLPGLPSPQEAPPSA--PPQAPPLPGSP---------EPPPAPPLPGDLPPPPPPP- 482 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P G G PPPPP PP P Sbjct: 483 ---PPPPGTDGPVPP--PPPPPPPPPGGPP 507 Score = 33.5 bits (73), Expect = 1.00 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 715 PPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXP 840 PPP PP PP P G PPPPP P Sbjct: 465 PPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGP 506 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 40.3 bits (90), Expect = 0.009 Identities = 25/90 (27%), Positives = 26/90 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PP P PPP P PPP PP Sbjct: 323 PPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPL 382 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PPPPPP P P Sbjct: 383 SQP--------TRGAPPPPPPPPPGPPPPP 404 Score = 37.1 bits (82), Expect = 0.081 Identities = 24/86 (27%), Positives = 24/86 (27%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP P P PPP P P PP P PP Sbjct: 322 PPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPP-- 379 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 P PPPPPP P Sbjct: 380 --PPLSQPTRGAPPPPPPPPPGPPPP 403 Score = 34.3 bits (75), Expect = 0.57 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP PP P PPP P PPPP PP Sbjct: 299 PPPAPPLGSPPSSKPGFAPPPAPPPPPPPMIGIP---------PPPPPIGFGSPGTPPPP 349 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P PPPP P P Sbjct: 350 SSPSFPPHPDFAAPPPLPPPPAADYPTLPP 379 Score = 31.1 bits (67), Expect = 5.3 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 5/88 (5%) Frame = +2 Query: 572 GXXPPPPXXXX-----PPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXX 736 G PPPP PPP P P P PP Sbjct: 330 GIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTRGA 389 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPP 820 PP PP P G PPP Sbjct: 390 PPPPPPPPPGPPPPPFTGADGQPAVPPP 417 Score = 30.3 bits (65), Expect = 9.3 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 4/93 (4%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPPS PSP PPP P P PP Sbjct: 246 PPPSQSDSASS--PSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAP 303 Query: 765 K----PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 304 PLGSPPSSKPGFAPPPAPPPPPPPMIGIPPPPP 336 >S80905-1|AAB50686.1| 382|Homo sapiens Con1 protein. Length = 382 Score = 39.9 bits (89), Expect = 0.011 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP----PPPXXXXXP 739 G PPP PPP G S P P + PP PP Sbjct: 221 GPPPPPGKPQGPPPQGGNKSQGPPPPGKPQGPPPQGGSKSRSSRSPPGKPQGPPPQGGNQ 280 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P PP P G PPPP P PP Sbjct: 281 PQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 315 Score = 37.9 bits (84), Expect = 0.046 Identities = 26/95 (27%), Positives = 27/95 (28%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP----PPPXXXXXP 739 G PPP PPP G P P + PP PP Sbjct: 97 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSRSSRSPPGKPQGPPPQGGNQ 156 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P PP P G PPPP P PP Sbjct: 157 PQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 191 Score = 37.9 bits (84), Expect = 0.046 Identities = 29/98 (29%), Positives = 31/98 (31%), Gaps = 9/98 (9%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PPP Sbjct: 159 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQ 218 Query: 737 P--PXXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P P PP P GG + PPPP P PP Sbjct: 219 PQGPPPPPGKPQGPPPQGGNKS---QGPPPPGKPQGPP 253 Score = 36.3 bits (80), Expect = 0.14 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 243 PPPPGKPQGPPPQGG-SKSRSSRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 301 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 302 PQGPPPPGKPQGPPPQGGSKSRSARSPPGKPQGPP 336 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 38 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 97 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 98 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 128 Score = 33.9 bits (74), Expect = 0.75 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 8/97 (8%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP----PPPXXXXXP 739 G PPP PPP G P P P PPP P Sbjct: 36 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 95 Query: 740 --PXXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P PP P GG PPPP P PP Sbjct: 96 QGPPPPPGKPQGPPPQGGN---KPQGPPPPGKPQGPP 129 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 283 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGGSKSRSARSPPGKPQGPPQQEGNN 342 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 343 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 372 Score = 33.5 bits (73), Expect = 1.00 Identities = 25/95 (26%), Positives = 25/95 (26%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXX----PXPXXXXXXXXXXXXKXP--PPPPXXXX 733 G PP PPP G P P P P PPP Sbjct: 15 GPPSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKS 74 Query: 734 XPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P GG PP P PP Sbjct: 75 RSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPP 109 Score = 32.3 bits (70), Expect = 2.3 Identities = 25/94 (26%), Positives = 25/94 (26%), Gaps = 8/94 (8%) Frame = +3 Query: 582 PPPPSXXXXPPXXX------PSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXX 743 PPPP PP P P PP K PPP Sbjct: 99 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSRSSRSPPGKPQGPPPQGGNQPQ 158 Query: 744 XXPPXXXKPXXXX--GGGXXXXXPPPPPPXXXXP 839 PP KP GG PPP P P Sbjct: 159 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPP 192 Score = 32.3 bits (70), Expect = 2.3 Identities = 25/94 (26%), Positives = 25/94 (26%), Gaps = 8/94 (8%) Frame = +3 Query: 582 PPPPSXXXXPPXXX------PSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXX 743 PPPP PP P P PP K PPP Sbjct: 161 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQPQ 220 Query: 744 XXPPXXXKPXXXX--GGGXXXXXPPPPPPXXXXP 839 PP KP GG PPP P P Sbjct: 221 GPPPPPGKPQGPPPQGGNKSQGPPPPGKPQGPPP 254 Score = 31.5 bits (68), Expect = 4.0 Identities = 23/87 (26%), Positives = 23/87 (26%), Gaps = 2/87 (2%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP P P P PPP K PPP P Sbjct: 26 PPPQGGNQPQGPPPPPGKPQG--PPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGK 83 Query: 765 KPXXXXGGGXXXXXPPPPP--PXXXXP 839 GG PPPPP P P Sbjct: 84 PQGPPPQGGNQPQGPPPPPGKPQGPPP 110 >AK096970-1|BAC04915.1| 485|Homo sapiens protein ( Homo sapiens cDNA FLJ39651 fis, clone SMINT2005161, highly similar to Mus musculus ES18 mRNA. ). Length = 485 Score = 39.9 bits (89), Expect = 0.011 Identities = 26/94 (27%), Positives = 26/94 (27%) Frame = +3 Query: 558 FFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXX 737 FF PPPP P P P PPPL P PP Sbjct: 6 FFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPP------ 59 Query: 738 XXXXPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 P GGG P PPPP P Sbjct: 60 -LALQPRASAEASRGGGGAGAFYPVPPPPLPPPP 92 Score = 33.5 bits (73), Expect = 1.00 Identities = 25/97 (25%), Positives = 25/97 (25%) Frame = +2 Query: 560 FXXXGXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXP 739 F G PPP PP G P P P PP Sbjct: 6 FFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQ-- 63 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG GA PPP P PP P Sbjct: 64 ---PRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRP 97 Score = 32.3 bits (70), Expect = 2.3 Identities = 29/128 (22%), Positives = 32/128 (25%) Frame = +2 Query: 335 GXXKXGXXXPKXXXPPXFXXPPFSXFFXPXPXPXFFPPKXXXPPPXGPXPXKXGXGAXXX 514 G + G P+ P F PP P P P F PP P P P Sbjct: 8 GQGRPGPPPPQPPPPAPFGCPP-----PPLPSPAFPPPLPQRPGPF-PGASAPFLQPPLA 61 Query: 515 XXXXXXXXXXXGXXXFXXXGXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXX 694 G PPPP PP P P Sbjct: 62 LQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPGTDAGERPRPPPPGPGPPWSPR 121 Query: 695 XXKXPPPP 718 + PPPP Sbjct: 122 WPEAPPPP 129 Score = 28.3 bits (60), Expect(2) = 1.8 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 2/87 (2%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXX--PXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPX 757 PPP P P G + P P P PP PP PP Sbjct: 38 PPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPP-----PPLPPPP 92 Query: 758 XXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P G A PPPP PP Sbjct: 93 PQCRPFP--GTDAGERPRPPPPGPGPP 117 Score = 23.0 bits (47), Expect(2) = 1.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = +2 Query: 395 PPFSXFFXPXPXPXFFPP--KXXXPPPXGPXP 484 PPF P P P PP PPP P P Sbjct: 4 PPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSP 35 >AL646016-1|CAI17009.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1084 GIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1143 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 1144 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1178 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1128 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1187 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 1188 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1222 Score = 39.1 bits (87), Expect = 0.020 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1260 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPP 1319 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1320 PPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1354 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1172 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1231 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1232 PPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1266 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1216 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPP 1275 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1276 PPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPP 1310 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP- 755 PPPP P P P PP P P PPPP P PP Sbjct: 1054 PPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPL 1113 Query: 756 ---XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 1114 PGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1145 Score = 36.3 bits (80), Expect = 0.14 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPP P P P PPPL P PPP P P Sbjct: 1304 GIPPPPPLPGAGIPPPPPLP-GVGIPPPPPLPGVGIPPPPPLPGAGIPPP-PPLPGMGIP 1361 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P G G PPPP P P Sbjct: 1362 PAPAPPLPPPGTG----IPPPPLLPVSGPPLLP 1390 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 1/88 (1%) Frame = +3 Query: 591 PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKP 770 P PP P P P P PPPP P PP Sbjct: 1014 PGLGMVPPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAG 1073 Query: 771 XXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PPPPP P P P Sbjct: 1074 ILPLPPLPGAGIPPPPPLPGAAIPPPPP 1101 Score = 31.9 bits (69), Expect = 3.0 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKX-XPPPPXPXXXXXXXPPX 758 PP PP P P PP P PPPP P PP Sbjct: 1043 PPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPL 1102 Query: 759 XXK----PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 1103 PGAGIPLPPPLPGAG---IPPPPPLPGAGIPPPPP 1134 >AL590490-1|CAH70931.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1084 GIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1143 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 1144 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1178 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1128 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1187 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 1188 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1222 Score = 39.1 bits (87), Expect = 0.020 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1260 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPP 1319 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1320 PPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1354 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1172 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1231 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1232 PPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1266 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1216 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPP 1275 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1276 PPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPP 1310 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP- 755 PPPP P P P PP P P PPPP P PP Sbjct: 1054 PPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPL 1113 Query: 756 ---XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 1114 PGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1145 Score = 36.3 bits (80), Expect = 0.14 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPP P P P PPPL P PPP P P Sbjct: 1304 GIPPPPPLPGAGIPPPPPLP-GVGIPPPPPLPGVGIPPPPPLPGAGIPPP-PPLPGMGIP 1361 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P G G PPPP P P Sbjct: 1362 PAPAPPLPPPGTG----IPPPPLLPVSGPPLLP 1390 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 1/88 (1%) Frame = +3 Query: 591 PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKP 770 P PP P P P P PPPP P PP Sbjct: 1014 PGLGMVPPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAG 1073 Query: 771 XXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PPPPP P P P Sbjct: 1074 ILPLPPLPGAGIPPPPPLPGAAIPPPPP 1101 Score = 31.9 bits (69), Expect = 3.0 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKX-XPPPPXPXXXXXXXPPX 758 PP PP P P PP P PPPP P PP Sbjct: 1043 PPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPL 1102 Query: 759 XXK----PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 1103 PGAGIPLPPPLPGAG---IPPPPPLPGAGIPPPPP 1134 >AL513342-1|CAI17121.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1084 GIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1143 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 1144 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1178 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1128 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1187 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 1188 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1222 Score = 39.1 bits (87), Expect = 0.020 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1260 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPP 1319 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1320 PPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1354 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1172 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1231 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1232 PPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1266 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1216 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPP 1275 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1276 PPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPP 1310 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP- 755 PPPP P P P PP P P PPPP P PP Sbjct: 1054 PPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPL 1113 Query: 756 ---XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 1114 PGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1145 Score = 36.3 bits (80), Expect = 0.14 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPP P P P PPPL P PPP P P Sbjct: 1304 GIPPPPPLPGAGIPPPPPLP-GVGIPPPPPLPGVGIPPPPPLPGAGIPPP-PPLPGMGIP 1361 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P G G PPPP P P Sbjct: 1362 PAPAPPLPPPGTG----IPPPPLLPVSGPPLLP 1390 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 1/88 (1%) Frame = +3 Query: 591 PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKP 770 P PP P P P P PPPP P PP Sbjct: 1014 PGLGMVPPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAG 1073 Query: 771 XXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PPPPP P P P Sbjct: 1074 ILPLPPLPGAGIPPPPPLPGAAIPPPPP 1101 Score = 31.9 bits (69), Expect = 3.0 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKX-XPPPPXPXXXXXXXPPX 758 PP PP P P PP P PPPP P PP Sbjct: 1043 PPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPL 1102 Query: 759 XXK----PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 1103 PGAGIPLPPPLPGAG---IPPPPPLPGAGIPPPPP 1134 >AL359918-1|CAI15795.1| 1865|Homo sapiens formin 2 protein. Length = 1865 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1084 GIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1143 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 1144 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1178 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1128 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1187 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 1188 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1222 Score = 39.1 bits (87), Expect = 0.020 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1260 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPP 1319 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1320 PPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1354 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1172 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 1231 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1232 PPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 1266 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 1216 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPP 1275 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 1276 PPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPP 1310 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP- 755 PPPP P P P PP P P PPPP P PP Sbjct: 1054 PPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPL 1113 Query: 756 ---XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 1114 PGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 1145 Score = 36.3 bits (80), Expect = 0.14 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPP P P P PPPL P PPP P P Sbjct: 1304 GIPPPPPLPGAGIPPPPPLP-GVGIPPPPPLPGVGIPPPPPLPGAGIPPP-PPLPGMGIP 1361 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P G G PPPP P P Sbjct: 1362 PAPAPPLPPPGTG----IPPPPLLPVSGPPLLP 1390 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 1/88 (1%) Frame = +3 Query: 591 PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKP 770 P PP P P P P PPPP P PP Sbjct: 1014 PGLGMVPPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAG 1073 Query: 771 XXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PPPPP P P P Sbjct: 1074 ILPLPPLPGAGIPPPPPLPGAAIPPPPP 1101 Score = 31.9 bits (69), Expect = 3.0 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKX-XPPPPXPXXXXXXXPPX 758 PP PP P P PP P PPPP P PP Sbjct: 1043 PPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPL 1102 Query: 759 XXK----PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 1103 PGAGIPLPPPLPGAG---IPPPPPLPGAGIPPPPP 1134 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 39.1 bits (87), Expect = 0.020 Identities = 24/87 (27%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP + P P PPPP PP PP Sbjct: 316 PPPPSRGGNQLPRPPIAGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPAT 375 Query: 761 XXT-PXXXGGGGAXXXXXPPPPPXXPP 838 + P GA PPPPP PP Sbjct: 376 GRSGPLPPPPPGAGGPPMPPPPPPPPP 402 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPPP PPP P P P PPPP PP P Sbjct: 348 GIAPPPPTPRGPPP---------PGRGGPPPPPPPATGRSGPL---PPPPPGAGGPPMPP 395 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P P G G P PP PP P Sbjct: 396 PPPPPPPPPSSGNG-------PAPPPLPPALVP 421 Score = 33.9 bits (74), Expect = 0.75 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPP-PXXXXXPPXXPPX 757 PPPP PPP + P P PPPP PP PP Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPA 418 Query: 758 XXXTPXXXGGGG 793 GGG Sbjct: 419 LVPAGGLAPGGG 430 >AB209153-1|BAD92390.1| 1332|Homo sapiens formin 2 variant protein. Length = 1332 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 551 GIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 610 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 611 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 645 Score = 39.1 bits (87), Expect = 0.020 Identities = 29/98 (29%), Positives = 29/98 (29%), Gaps = 5/98 (5%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 595 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 654 Query: 750 PP----XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 PP P G G PPPP P P P Sbjct: 655 PPLPGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 689 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 639 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPP 698 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 699 PPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 733 Score = 38.7 bits (86), Expect = 0.026 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 683 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPP 742 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 743 PPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 777 Score = 38.3 bits (85), Expect = 0.035 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 2/95 (2%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXX 749 G PPPP P P P PP P P PPPP P Sbjct: 727 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPP 786 Query: 750 PPXXXKPXXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PP PPPPP P P P Sbjct: 787 PPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPP 821 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPP-PLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP- 755 PPPP P P P PP P P PPPP P PP Sbjct: 521 PPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPL 580 Query: 756 ---XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 581 PGAGIPPPPPLPGAG---IPPPPPLPGAGIPPPPP 612 Score = 36.3 bits (80), Expect = 0.14 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPP P P P PPPL P PPP P P Sbjct: 771 GIPPPPPLPGAGIPPPPPLP-GVGIPPPPPLPGVGIPPPPPLPGAGIPPP-PPLPGMGIP 828 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P G G PPPP P P Sbjct: 829 PAPAPPLPPPGTG----IPPPPLLPVSGPPLLP 857 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 1/88 (1%) Frame = +3 Query: 591 PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKP 770 P PP P P P P PPPP P PP Sbjct: 481 PGLGMVPPPPPPLPGMTVPTLPSTAIPQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAG 540 Query: 771 XXXXGGGXXXXXPPPPP-PXXXXPXXXP 851 PPPPP P P P Sbjct: 541 ILPLPPLPGAGIPPPPPLPGAAIPPPPP 568 Score = 31.9 bits (69), Expect = 3.0 Identities = 26/95 (27%), Positives = 26/95 (27%), Gaps = 5/95 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKX-XPPPPXPXXXXXXXPPX 758 PP PP P P PP P PPPP P PP Sbjct: 510 PPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPL 569 Query: 759 XXK----PXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G G PPPP P P P Sbjct: 570 PGAGIPLPPPLPGAG---IPPPPPLPGAGIPPPPP 601 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 38.7 bits (86), Expect = 0.026 Identities = 28/93 (30%), Positives = 29/93 (31%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXX-------PXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 PPP PPP G P P P PPPP PP Sbjct: 314 PPP----PPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPP 369 Query: 743 XXPPXXXXT-PXXXGGGGAXXXXXPPPPPXXPP 838 PP + P GA PPPPP PP Sbjct: 370 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPP 402 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPPP PPP P P P PPPP PP P Sbjct: 348 GIAPPPPTPRGPPP---------PGRGGPPPPPPPATGRSGPL---PPPPPGAGGPPMPP 395 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P P G G P PP PP P Sbjct: 396 PPPPPPPPPSSGNG-------PAPPPLPPALVP 421 Score = 37.5 bits (83), Expect = 0.061 Identities = 24/81 (29%), Positives = 25/81 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PPP P + PPPP P P Sbjct: 327 PRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP---PPGRGGPPPPPPPATGRSGP--- 380 Query: 762 XKPXXXXGGGXXXXXPPPPPP 824 P GG PPPPPP Sbjct: 381 LPPPPPGAGGPPMPPPPPPPP 401 Score = 33.9 bits (74), Expect = 0.75 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPP-PXXXXXPPXXPPX 757 PPPP PPP + P P PPPP PP PP Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPA 418 Query: 758 XXXTPXXXGGGG 793 GGG Sbjct: 419 LVPAGGLAPGGG 430 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 38.7 bits (86), Expect = 0.026 Identities = 28/93 (30%), Positives = 29/93 (31%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXX-------PXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 PPP PPP G P P P PPPP PP Sbjct: 314 PPP----PPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPP 369 Query: 743 XXPPXXXXT-PXXXGGGGAXXXXXPPPPPXXPP 838 PP + P GA PPPPP PP Sbjct: 370 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPP 402 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPPP PPP P P P PPPP PP P Sbjct: 348 GIAPPPPTPRGPPP---------PGRGGPPPPPPPATGRSGPL---PPPPPGAGGPPMPP 395 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P P G G P PP PP P Sbjct: 396 PPPPPPPPPSSGNG-------PAPPPLPPALVP 421 Score = 37.5 bits (83), Expect = 0.061 Identities = 24/81 (29%), Positives = 25/81 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PPP P + PPPP P P Sbjct: 327 PRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP---PPGRGGPPPPPPPATGRSGP--- 380 Query: 762 XKPXXXXGGGXXXXXPPPPPP 824 P GG PPPPPP Sbjct: 381 LPPPPPGAGGPPMPPPPPPPP 401 Score = 33.9 bits (74), Expect = 0.75 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPP-PXXXXXPPXXPPX 757 PPPP PPP + P P PPPP PP PP Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPA 418 Query: 758 XXXTPXXXGGGG 793 GGG Sbjct: 419 LVPAGGLAPGGG 430 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 38.7 bits (86), Expect = 0.026 Identities = 28/93 (30%), Positives = 29/93 (31%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXX-------PXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 PPP PPP G P P P PPPP PP Sbjct: 314 PPP----PPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPP 369 Query: 743 XXPPXXXXT-PXXXGGGGAXXXXXPPPPPXXPP 838 PP + P GA PPPPP PP Sbjct: 370 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPP 402 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPPP PPP P P P PPPP PP P Sbjct: 348 GIAPPPPTPRGPPP---------PGRGGPPPPPPPATGRSGPL---PPPPPGAGGPPMPP 395 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P P G G P PP PP P Sbjct: 396 PPPPPPPPPSSGNG-------PAPPPLPPALVP 421 Score = 37.5 bits (83), Expect = 0.061 Identities = 24/81 (29%), Positives = 25/81 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PPP P + PPPP P P Sbjct: 327 PRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP---PPGRGGPPPPPPPATGRSGP--- 380 Query: 762 XKPXXXXGGGXXXXXPPPPPP 824 P GG PPPPPP Sbjct: 381 LPPPPPGAGGPPMPPPPPPPP 401 Score = 33.9 bits (74), Expect = 0.75 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPP-PXXXXXPPXXPPX 757 PPPP PPP + P P PPPP PP PP Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPA 418 Query: 758 XXXTPXXXGGGG 793 GGG Sbjct: 419 LVPAGGLAPGGG 430 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 38.7 bits (86), Expect = 0.026 Identities = 28/93 (30%), Positives = 29/93 (31%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXX-------PXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 PPP PPP G P P P PPPP PP Sbjct: 326 PPP----PPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPP 381 Query: 743 XXPPXXXXT-PXXXGGGGAXXXXXPPPPPXXPP 838 PP + P GA PPPPP PP Sbjct: 382 PPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPP 414 Score = 37.9 bits (84), Expect = 0.046 Identities = 28/93 (30%), Positives = 28/93 (30%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPPP PPP P P P PPPP PP P Sbjct: 360 GIAPPPPTPRGPPP---------PGRGGPPPPPPPATGRSGPL---PPPPPGAGGPPMPP 407 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P P G G P PP PP P Sbjct: 408 PPPPPPPPPSSGNG-------PAPPPLPPALVP 433 Score = 37.5 bits (83), Expect = 0.061 Identities = 24/81 (29%), Positives = 25/81 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PPP P + PPPP P P Sbjct: 339 PRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPP---PPGRGGPPPPPPPATGRSGP--- 392 Query: 762 XKPXXXXGGGXXXXXPPPPPP 824 P GG PPPPPP Sbjct: 393 LPPPPPGAGGPPMPPPPPPPP 413 Score = 33.9 bits (74), Expect = 0.75 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPP-PXXXXXPPXXPPX 757 PPPP PPP + P P PPPP PP PP Sbjct: 371 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPA 430 Query: 758 XXXTPXXXGGGG 793 GGG Sbjct: 431 LVPAGGLAPGGG 442 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 38.3 bits (85), Expect = 0.035 Identities = 22/80 (27%), Positives = 24/80 (30%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP+ P P PPP+ PPPP P P Sbjct: 32 PPPAPGPGAGLLAPGPPP-----PPPVGSMGALTAAFPFAALPPPPPPPPPPPPQQPPPP 86 Query: 765 KPXXXXGGGXXXXXPPPPPP 824 P G PPPPPP Sbjct: 87 PPPPSPGASYPPPQPPPPPP 106 Score = 37.1 bits (82), Expect = 0.081 Identities = 22/78 (28%), Positives = 23/78 (29%) Frame = +2 Query: 560 FXXXGXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXP 739 F PPPP PPP P P + PP P P Sbjct: 63 FPFAALPPPPPPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQP-----P 117 Query: 740 PXXPPXXXXTPXXXGGGG 793 P PP P GGGG Sbjct: 118 PPQPPRKDQQPGPAGGGG 135 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 560 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 613 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 614 PPPPPSGPLPPWQQQQQQPPPPPPP 638 Score = 35.9 bits (79), Expect = 0.19 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP P P P PPP P PPPP P P Sbjct: 73 PPPPPPPPQQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPPQPPPPQP-------PRKD 125 Query: 762 XKPXXXXGGG 791 +P GGG Sbjct: 126 QQPGPAGGGG 135 Score = 32.7 bits (71), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPP 825 PPPP PP PP P G PPPPP Sbjct: 71 PPPPPPPPPPQQPPPPP--PPPSPGASYPPPQPPPPPP 106 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 545 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 604 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 605 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 637 Score = 31.5 bits (68), Expect = 4.0 Identities = 23/87 (26%), Positives = 24/87 (27%), Gaps = 1/87 (1%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP P PPP P + PPPP P PP Sbjct: 48 PPPPPVGSMGALTAAFPFAALPPPPPP------PPPPPPQQPPPPPPPPSPGASYPPPQP 101 Query: 762 XKPXXXXGGGXXXXXPPPPPP-XXXXP 839 P PPP PP P Sbjct: 102 PPPPPLYQRVSPPQPPPPQPPRKDQQP 128 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 546 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 601 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 602 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 637 Score = 30.7 bits (66), Expect = 7.0 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP P G + P P P PPPPP P PP Sbjct: 47 PPPPP---PVGSMGALTAAFPFAALPPPPPPPPPPPPQQPPPPPPPPSPGASYP--PPQP 101 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P PPP PP Sbjct: 102 PPPPPLY-----QRVSPPQPPPPQPP 122 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 545 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 604 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 605 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 637 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 38.3 bits (85), Expect = 0.035 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP+ PP P P P P PPPP P PP Sbjct: 294 PPPPASIPPPP---PLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPP 350 Query: 762 XKPXXXXGGG--XXXXXPPPPPPXXXXPXXXP 851 P PP PPP P P Sbjct: 351 PPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPP 382 Score = 31.9 bits (69), Expect = 3.0 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP-XXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 K PPPP PP P +P + PPPPP PP P Sbjct: 291 KALPPPPASIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPP 341 Score = 30.7 bits (66), Expect = 7.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 350 GXXXPKXXXPPXFXXPPFSXFFXPXPXPXFFPPKXXXPPPXGPXP 484 G P PP PP S P P P P P P GP P Sbjct: 325 GPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPP 369 >BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 37.1 bits (82), Expect = 0.081 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P G G+ PPPPP P P Sbjct: 569 PPPPPDFMEPPPDFVP--PPPPSYAGIAGSELPPPPPPPPAPAPAPVP 614 Score = 35.1 bits (77), Expect = 0.33 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 655 PXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 P P P P P PP PP P G PPPPP P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPP 606 Query: 835 XP 840 P Sbjct: 607 AP 608 Score = 33.9 bits (74), Expect = 0.75 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGG--AXXXXXPPPPPXXPPXXXP 850 PPPPP P GGGG A PPPP PP P Sbjct: 517 PPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPPPPLDDP 566 Score = 29.1 bits (62), Expect(2) = 0.045 Identities = 19/71 (26%), Positives = 21/71 (29%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPP PPP + P P + PPP PP PP Sbjct: 578 PPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSAR---PPPAVAKRPPV-PPKR 633 Query: 761 XXTPXXXGGGG 793 P GG G Sbjct: 634 QENPGHPGGAG 644 Score = 27.9 bits (59), Expect(2) = 0.045 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 362 PKXXXPPXFXXPPFSXFFXPXPXPXFF-PPKXXXPPP 469 P PP PP P P P F PP PPP Sbjct: 550 PDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPP 586 >AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 37.1 bits (82), Expect = 0.081 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P G G+ PPPPP P P Sbjct: 569 PPPPPDFMEPPPDFVP--PPPPSYAGIAGSELPPPPPPPPAPAPAPVP 614 Score = 35.1 bits (77), Expect = 0.33 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 655 PXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 P P P P P PP PP P G PPPPP P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPP 606 Query: 835 XP 840 P Sbjct: 607 AP 608 Score = 33.9 bits (74), Expect = 0.75 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGG--AXXXXXPPPPPXXPPXXXP 850 PPPPP P GGGG A PPPP PP P Sbjct: 517 PPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPPPPLDDP 566 Score = 29.1 bits (62), Expect(2) = 0.045 Identities = 19/71 (26%), Positives = 21/71 (29%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPP PPP + P P + PPP PP PP Sbjct: 578 PPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSAR---PPPAVAKRPPV-PPKR 633 Query: 761 XXTPXXXGGGG 793 P GG G Sbjct: 634 QENPGHPGGAG 644 Score = 27.9 bits (59), Expect(2) = 0.045 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 362 PKXXXPPXFXXPPFSXFFXPXPXPXFF-PPKXXXPPP 469 P PP PP P P P F PP PPP Sbjct: 550 PDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPP 586 >AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73 protein. Length = 666 Score = 37.1 bits (82), Expect = 0.081 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P G G+ PPPPP P P Sbjct: 569 PPPPPDFMEPPPDFVP--PPPPSYAGIAGSELPPPPPPPPAPAPAPVP 614 Score = 35.1 bits (77), Expect = 0.33 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 655 PXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 P P P P P PP PP P G PPPPP P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPP 606 Query: 835 XP 840 P Sbjct: 607 AP 608 Score = 33.9 bits (74), Expect = 0.75 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGG--AXXXXXPPPPPXXPPXXXP 850 PPPPP P GGGG A PPPP PP P Sbjct: 517 PPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPPPPLDDP 566 Score = 29.1 bits (62), Expect(2) = 0.045 Identities = 19/71 (26%), Positives = 21/71 (29%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPP PPP + P P + PPP PP PP Sbjct: 578 PPPDFVPPPPPSYAGIAGSELPPPPPPPPAPAPAPVPDSAR---PPPAVAKRPPV-PPKR 633 Query: 761 XXTPXXXGGGG 793 P GG G Sbjct: 634 QENPGHPGGAG 644 Score = 27.9 bits (59), Expect(2) = 0.045 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 362 PKXXXPPXFXXPPFSXFFXPXPXPXFF-PPKXXXPPP 469 P PP PP P P P F PP PPP Sbjct: 550 PDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPP 586 >X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage factor I 68 kDa subunit protein. Length = 551 Score = 37.9 bits (84), Expect = 0.046 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 3/93 (3%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXX-PXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPX 757 PPPP PPP G + P P PPPP PP PP Sbjct: 252 PPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPP 311 Query: 758 XXXTPXXXGGGGAXXXXXP--PPPPXXPPXXXP 850 P G P PP PP P Sbjct: 312 PQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLP 344 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/86 (26%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPP----XPXXXX 740 G PPPP P P PPP+ P + PPPP P Sbjct: 270 GDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPG 329 Query: 741 XXXPPXXXKPXXXXGGGXXXXXPPPP 818 PP P G PP P Sbjct: 330 PLGPPLTLAPPPHLPGPPPGAPPPAP 355 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/93 (25%), Positives = 24/93 (25%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PP P P P P PPPL PPP P Sbjct: 233 GQTPPRPPLGPPGPPGPPGPPPPGQVLPPPL-----AGPPNRGDRPPPPVLFPGQPFGQP 287 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P PP PPP P P Sbjct: 288 PLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPP 320 Score = 31.5 bits (68), Expect = 4.0 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP PP P P PPL P PPP PP Sbjct: 309 PPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNS 368 Query: 765 KPXXXXGGGXXXXXPPPPPPXXXXP 839 G PPP P P Sbjct: 369 GMPTSDSRG-----PPPTDPYGRPP 388 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 350 GXXXPKXXXPPXFXXPPFSXFFXPXPXPXFFPPKXXXPPPXGPXP 484 G P PP PP F P P PP PPP P P Sbjct: 302 GYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP 346 >X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. Length = 551 Score = 37.9 bits (84), Expect = 0.046 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 3/93 (3%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXX-PXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPX 757 PPPP PPP G + P P PPPP PP PP Sbjct: 252 PPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPP 311 Query: 758 XXXTPXXXGGGGAXXXXXP--PPPPXXPPXXXP 850 P G P PP PP P Sbjct: 312 PQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLP 344 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/86 (26%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPP----XPXXXX 740 G PPPP P P PPP+ P + PPPP P Sbjct: 270 GDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPG 329 Query: 741 XXXPPXXXKPXXXXGGGXXXXXPPPP 818 PP P G PP P Sbjct: 330 PLGPPLTLAPPPHLPGPPPGAPPPAP 355 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/93 (25%), Positives = 24/93 (25%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PP P P P P PPPL PPP P Sbjct: 233 GQTPPRPPLGPPGPPGPPGPPPPGQVLPPPL-----AGPPNRGDRPPPPVLFPGQPFGQP 287 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P PP PPP P P Sbjct: 288 PLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPP 320 Score = 31.5 bits (68), Expect = 4.0 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP PP P P PPL P PPP PP Sbjct: 309 PPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNS 368 Query: 765 KPXXXXGGGXXXXXPPPPPPXXXXP 839 G PPP P P Sbjct: 369 GMPTSDSRG-----PPPTDPYGRPP 388 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 350 GXXXPKXXXPPXFXXPPFSXFFXPXPXPXFFPPKXXXPPPXGPXP 484 G P PP PP F P P PP PPP P P Sbjct: 302 GYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP 346 >K02575-1|AAA36502.1| 173|Homo sapiens protein ( Human salivary proline-rich protein 1 gene, segment 1. ). Length = 173 Score = 37.9 bits (84), Expect = 0.046 Identities = 26/95 (27%), Positives = 27/95 (28%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP----PPPXXXXXP 739 G PPP PPP G P P + PP PP Sbjct: 32 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGGKRSRSPRSPPGKPQGPPPQGGNQ 91 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P PP P G PPPP P PP Sbjct: 92 PQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 126 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 7/86 (8%) Frame = +3 Query: 582 PPPPSXXXXPPXXX------PSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXX 743 PPPP PP P P PP K PPP Sbjct: 34 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGGKRSRSPRSPPGKPQGPPPQGGNQPQ 93 Query: 744 XXPPXXXKPXXXXG-GGXXXXXPPPP 818 PP KP GG PPPP Sbjct: 94 GPPPPPGKPQGPPPQGGNKPQGPPPP 119 Score = 31.1 bits (67), Expect = 5.3 Identities = 20/78 (25%), Positives = 21/78 (26%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP P P P PPP K PPP P Sbjct: 84 PPPQGGNQPQGPPPPPGKPQG--PPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPRKP 141 Query: 765 KPXXXXGGGXXXXXPPPP 818 + GG PPPP Sbjct: 142 QGPPPQGGNQPQGPPPPP 159 >BC000714-1|AAH00714.1| 588|Homo sapiens CPSF6 protein protein. Length = 588 Score = 37.9 bits (84), Expect = 0.046 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 3/93 (3%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXX-PXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPX 757 PPPP PPP G + P P PPPP PP PP Sbjct: 289 PPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPP 348 Query: 758 XXXTPXXXGGGGAXXXXXP--PPPPXXPPXXXP 850 P G P PP PP P Sbjct: 349 PQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLP 381 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/86 (26%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPP----XPXXXX 740 G PPPP P P PPP+ P + PPPP P Sbjct: 307 GDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPG 366 Query: 741 XXXPPXXXKPXXXXGGGXXXXXPPPP 818 PP P G PP P Sbjct: 367 PLGPPLTLAPPPHLPGPPPGAPPPAP 392 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/93 (25%), Positives = 24/93 (25%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PP P P P P PPPL PPP P Sbjct: 270 GQTPPRPPLGPPGPPGPPGPPPPGQVLPPPL-----AGPPNRGDRPPPPVLFPGQPFGQP 324 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P PP PPP P P Sbjct: 325 PLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPP 357 Score = 31.5 bits (68), Expect = 4.0 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP PP P P PPL P PPP PP Sbjct: 346 PPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNS 405 Query: 765 KPXXXXGGGXXXXXPPPPPPXXXXP 839 G PPP P P Sbjct: 406 GMPTSDSRG-----PPPTDPYGRPP 425 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 350 GXXXPKXXXPPXFXXPPFSXFFXPXPXPXFFPPKXXXPPPXGPXP 484 G P PP PP F P P PP PPP P P Sbjct: 339 GYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP 383 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 37.9 bits (84), Expect = 0.046 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP PP P G PPPP PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP P G PPP P P P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDP 970 Score = 33.5 bits (73), Expect = 1.00 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPP 722 PPPP PP P P PPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 37.9 bits (84), Expect = 0.046 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP PP P G PPPP PP Sbjct: 922 PPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 Score = 36.7 bits (81), Expect = 0.11 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP P G PPP P P P Sbjct: 923 PPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPPYSCDP 970 Score = 33.5 bits (73), Expect = 1.00 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPP 722 PPPP PP P P PPP PPPP Sbjct: 919 PPPPPPPPPPPPPPPPPPPPPPPPPPPALDVGETSNLQPPPPLPPPP 965 >AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenylation specific factor 6, 68 kD subunit variant protein. Length = 551 Score = 37.9 bits (84), Expect = 0.046 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 3/93 (3%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXX-PXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPX 757 PPPP PPP G + P P PPPP PP PP Sbjct: 252 PPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPP 311 Query: 758 XXXTPXXXGGGGAXXXXXP--PPPPXXPPXXXP 850 P G P PP PP P Sbjct: 312 PQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLP 344 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/86 (26%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPP----XPXXXX 740 G PPPP P P PPP+ P + PPPP P Sbjct: 270 GDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPG 329 Query: 741 XXXPPXXXKPXXXXGGGXXXXXPPPP 818 PP P G PP P Sbjct: 330 PLGPPLTLAPPPHLPGPPPGAPPPAP 355 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/93 (25%), Positives = 24/93 (25%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PP P P P P PPPL PPP P Sbjct: 233 GQTPPRPPLGPPGPPGPPGPPPPGQVLPPPL-----AGPPNRGDRPPPPVLFPGQPFGQP 287 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P P PP PPP P P Sbjct: 288 PLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPP 320 Score = 31.5 bits (68), Expect = 4.0 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP PP P P PPL P PPP PP Sbjct: 309 PPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNS 368 Query: 765 KPXXXXGGGXXXXXPPPPPPXXXXP 839 G PPP P P Sbjct: 369 GMPTSDSRG-----PPPTDPYGRPP 388 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 350 GXXXPKXXXPPXFXXPPFSXFFXPXPXPXFFPPKXXXPPPXGPXP 484 G P PP PP F P P PP PPP P P Sbjct: 302 GYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP 346 >X07517-1|CAA30395.2| 236|Homo sapiens salivary proline-rich protein protein. Length = 236 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 15 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 74 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 75 QGPPPPPGKPQGPPPQGGNRPQGPPPPGKPQGPP 108 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 98 PPPPGKPQGPPPQGDKSRSP--RSPPRKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 155 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 156 PQGPPPPGKPQGPPAQGGSKSQSARSPPGKPQGPP 190 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 17 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 76 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 77 PPPPPGKPQGPPPQGGNRPQGPPPPGKPQGP 107 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 78 PPPPGKPQGPPPQGGNRPQGPPPPGKPQGPPPQGDKSRSPRSPPRKPQGPPPQGGNQPQG 137 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 138 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 168 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 137 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARSPPGKPQGPPQQEGNN 196 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 197 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 226 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P PPP P P Sbjct: 76 GPPPPPGKPQGPPPQGGNRPQGPPPPGKPQG---------------PPPQGDKSRSPRSP 120 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P GG PP P PP Sbjct: 121 PRKPQGPPPQGGNQPQGPPPPPGKPQGPP 149 Score = 31.5 bits (68), Expect = 4.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PS P P PPP K PPP P Sbjct: 2 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPG 61 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 GG PPPPP P Sbjct: 62 KPQGPPPQGGNQPQGPPPPPGKPQGP 87 Score = 31.5 bits (68), Expect = 4.0 Identities = 23/87 (26%), Positives = 23/87 (26%), Gaps = 2/87 (2%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP P P P PPP K PPP P Sbjct: 66 PPPQGGNQPQGPPPPPGKPQG--PPPQGGNRPQGPPPPGKPQGPPPQGDKSRSPRSPPRK 123 Query: 765 KPXXXXGGGXXXXXPPPPP--PXXXXP 839 GG PPPPP P P Sbjct: 124 PQGPPPQGGNQPQGPPPPPGKPQGPPP 150 >X07516-1|CAA30394.2| 297|Homo sapiens salivary proline-rich protein protein. Length = 297 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 15 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 74 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 75 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 108 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 159 PPPPGKPQGPPPQGDKSRSPQSP--PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 216 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 217 PQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPP 251 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 17 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 76 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 77 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 107 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 78 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG 137 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 138 PPPPPGKPQGPPQQGGNRPQGPPPPGKPQGP 168 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 139 PPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQPQG 198 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 199 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 229 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 198 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNN 257 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 258 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 287 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P PPP P P Sbjct: 76 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG---------------PPPQGDKSQSPRSP 120 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P GG PP P PP Sbjct: 121 PGKPQGPPPQGGNQPQGPPPPPGKPQGPP 149 Score = 32.3 bits (70), Expect = 2.3 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P P PPP P PP Sbjct: 139 PPPPGKPQGPPQQGGNRPQGP----PPPGKPQG----------PPPQGDKSRSPQSPPGK 184 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG PPPPP P P Sbjct: 185 PQGPPPQGGN---QPQGPPPPPGKPQGPPP 211 Score = 31.5 bits (68), Expect = 4.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PS P P PPP K PPP P Sbjct: 2 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPG 61 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 GG PPPPP P Sbjct: 62 KPQGPPPQGGNQPQGPPPPPGKPQGP 87 >S62941-1|AAB27289.1| 358|Homo sapiens Ps 2 protein. Length = 358 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 15 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 74 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 75 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 108 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 137 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQP 196 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 197 QGPPPPPGKPQGPPQQGGNRPQGPPPPGKPQGPP 230 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 220 PPPPGKPQGPPPQGDKSRSPQSP--PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 277 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 278 PQGPPPPGKPQGPPPQGGSKSQSARAPPGKPQGPP 312 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 17 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 76 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 77 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 107 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 78 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG 137 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 138 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 168 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 139 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG 198 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 199 PPPPPGKPQGPPQQGGNRPQGPPPPGKPQGP 229 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 200 PPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQPQG 259 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 260 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 290 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 259 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGGSKSQSARAPPGKPQGPPQQEGNN 318 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 319 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 348 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P PPP P P Sbjct: 76 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG---------------PPPQGDKSQSPRSP 120 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P GG PP P PP Sbjct: 121 PGKPQGPPPQGGNQPQGPPPPPGKPQGPP 149 Score = 32.3 bits (70), Expect = 2.3 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P P PPP P PP Sbjct: 200 PPPPGKPQGPPQQGGNRPQGP----PPPGKPQG----------PPPQGDKSRSPQSPPGK 245 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG PPPPP P P Sbjct: 246 PQGPPPQGGN---QPQGPPPPPGKPQGPPP 272 Score = 31.5 bits (68), Expect = 4.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PS P P PPP K PPP P Sbjct: 2 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPG 61 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 GG PPPPP P Sbjct: 62 KPQGPPPQGGNQPQGPPPPPGKPQGP 87 Score = 31.5 bits (68), Expect = 4.0 Identities = 23/87 (26%), Positives = 23/87 (26%), Gaps = 2/87 (2%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP P P P PPP K PPP P Sbjct: 66 PPPQGGNQPQGPPPPPGKPQG--PPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGK 123 Query: 765 KPXXXXGGGXXXXXPPPPP--PXXXXP 839 GG PPPPP P P Sbjct: 124 PQGPPPQGGNQPQGPPPPPGKPQGPPP 150 >S62928-1|AAB27288.2| 297|Homo sapiens PRB1M protein precursor protein. Length = 297 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 15 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 74 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 75 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 108 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 159 PPPPGKPQGPPPQGDKSQSPQSP--PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 216 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 217 PQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPP 251 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 17 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 76 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 77 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 107 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 78 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG 137 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 138 PPPPPGKPQGPPQQGGNRPQGPPPPGKPQGP 168 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 139 PPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSQSPQSPPGKPQGPPPQGGNQPQG 198 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 199 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 229 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 198 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNN 257 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 258 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 287 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P PPP P P Sbjct: 76 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG---------------PPPQGDKSQSPRSP 120 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P GG PP P PP Sbjct: 121 PGKPQGPPPQGGNQPQGPPPPPGKPQGPP 149 Score = 32.3 bits (70), Expect = 2.3 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P P PPP P PP Sbjct: 139 PPPPGKPQGPPQQGGNRPQGP----PPPGKPQG----------PPPQGDKSQSPQSPPGK 184 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG PPPPP P P Sbjct: 185 PQGPPPQGGN---QPQGPPPPPGKPQGPPP 211 Score = 31.5 bits (68), Expect = 4.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PS P P PPP K PPP P Sbjct: 2 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPG 61 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 GG PPPPP P Sbjct: 62 KPQGPPPQGGNQPQGPPPPPGKPQGP 87 >S52986-1|AAA13341.2| 331|Homo sapiens basic salivary proline-rich protein protein. Length = 331 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 49 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 108 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 109 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 142 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 193 PPPPGKPQGPPPQGDKSRSPQSP--PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 250 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 251 PQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPP 285 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 51 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 110 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 111 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 141 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 112 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG 171 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 172 PPPPPGKPQGPPQQGGNRPQGPPPPGKPQGP 202 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 173 PPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQPQG 232 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 233 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 263 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 232 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNN 291 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 292 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 321 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P PPP P P Sbjct: 110 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG---------------PPPQGDKSQSPRSP 154 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P GG PP P PP Sbjct: 155 PGKPQGPPPQGGNQPQGPPPPPGKPQGPP 183 Score = 32.3 bits (70), Expect = 2.3 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P P PPP P PP Sbjct: 173 PPPPGKPQGPPQQGGNRPQGP----PPPGKPQG----------PPPQGDKSRSPQSPPGK 218 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG PPPPP P P Sbjct: 219 PQGPPPQGGN---QPQGPPPPPGKPQGPPP 245 Score = 31.5 bits (68), Expect = 4.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PS P P PPP K PPP P Sbjct: 36 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPG 95 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 GG PPPPP P Sbjct: 96 KPQGPPPQGGNQPQGPPPPPGKPQGP 121 >M97220-1|AAB05816.1| 331|Homo sapiens salivary proline-rich protein protein. Length = 331 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 49 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 108 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 109 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 142 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 193 PPPPGKPQGPPPQGDKSRSPQSP--PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 250 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 251 PQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPP 285 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 51 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 110 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 111 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 141 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 112 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG 171 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 172 PPPPPGKPQGPPQQGGNRPQGPPPPGKPQGP 202 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 173 PPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQPQG 232 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 233 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 263 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 232 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNN 291 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 292 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 321 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P PPP P P Sbjct: 110 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG---------------PPPQGDKSQSPRSP 154 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P GG PP P PP Sbjct: 155 PGKPQGPPPQGGNQPQGPPPPPGKPQGPP 183 Score = 32.3 bits (70), Expect = 2.3 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P P PPP P PP Sbjct: 173 PPPPGKPQGPPQQGGNRPQGP----PPPGKPQG----------PPPQGDKSRSPQSPPGK 218 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG PPPPP P P Sbjct: 219 PQGPPPQGGN---QPQGPPPPPGKPQGPPP 245 Score = 31.5 bits (68), Expect = 4.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PS P P PPP K PPP P Sbjct: 36 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPG 95 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 GG PPPPP P Sbjct: 96 KPQGPPPQGGNQPQGPPPPPGKPQGP 121 >K03204-1|AAA60185.1| 331|Homo sapiens PRB1 protein. Length = 331 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 49 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 108 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 109 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 142 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 193 PPPPGKPQGPPPQGDKSRSPQSP--PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 250 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 251 PQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPP 285 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 51 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 110 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 111 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 141 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 112 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG 171 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 172 PPPPPGKPQGPPQQGGNRPQGPPPPGKPQGP 202 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 173 PPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQPQG 232 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 233 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 263 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 232 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNN 291 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 292 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 321 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P PPP P P Sbjct: 110 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG---------------PPPQGDKSQSPRSP 154 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P GG PP P PP Sbjct: 155 PGKPQGPPPQGGNQPQGPPPPPGKPQGPP 183 Score = 32.3 bits (70), Expect = 2.3 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P P PPP P PP Sbjct: 173 PPPPGKPQGPPQQGGNRPQGP----PPPGKPQG----------PPPQGDKSRSPQSPPGK 218 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG PPPPP P P Sbjct: 219 PQGPPPQGGN---QPQGPPPPPGKPQGPPP 245 Score = 31.5 bits (68), Expect = 4.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PS P P PPP K PPP P Sbjct: 36 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPG 95 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 GG PPPPP P Sbjct: 96 KPQGPPPQGGNQPQGPPPPPGKPQGP 121 >BC044827-1|AAH44827.1| 338|Homo sapiens PRB2 protein protein. Length = 338 Score = 37.5 bits (83), Expect = 0.061 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 5/94 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXP---XXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 G PPP PPP G P P P P PP P Sbjct: 56 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQP 115 Query: 743 XXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 PP P G PPPP P PP Sbjct: 116 QGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 149 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 200 PPPPGKPQGPPPQGDKSRSPQSP--PGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 257 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 258 PQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPP 292 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 58 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQG 117 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 118 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 148 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 119 PPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPPGKPQGPPPQGGNQPQG 178 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 179 PPPPPGKPQGPPQQGGNRPQGPPPPGKPQGP 209 Score = 35.1 bits (77), Expect = 0.33 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPS-----PXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXX 746 PPPP PP + P PPP K PPP Sbjct: 180 PPPPGKPQGPPQQGGNRPQGPPPPGKPQGPPPQGDKSRSPQSPPGKPQGPPPQGGNQPQG 239 Query: 747 XPPXXXKPXXXXGGGXXXXXPPPPPPXXXXP 839 PP KP G PPPP P Sbjct: 240 PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGP 270 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 239 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPAQGGSKSQSARAPPGKPQGPPQQEGNN 298 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 299 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 328 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/89 (26%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P PPP P P Sbjct: 117 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQG---------------PPPQGDKSQSPRSP 161 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P GG PP P PP Sbjct: 162 PGKPQGPPPQGGNQPQGPPPPPGKPQGPP 190 Score = 32.3 bits (70), Expect = 2.3 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P P PPP P PP Sbjct: 180 PPPPGKPQGPPQQGGNRPQGP----PPPGKPQG----------PPPQGDKSRSPQSPPGK 225 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG PPPPP P P Sbjct: 226 PQGPPPQGGN---QPQGPPPPPGKPQGPPP 252 Score = 31.5 bits (68), Expect = 4.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PS P P PPP K PPP P Sbjct: 43 PQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPG 102 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXP 839 GG PPPPP P Sbjct: 103 KPQGPPPQGGNQPQGPPPPPGKPQGP 128 >K03208-1|AAA60189.1| 251|Homo sapiens PRB2 protein. Length = 251 Score = 37.1 bits (82), Expect = 0.081 Identities = 26/95 (27%), Positives = 27/95 (28%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP----PPPXXXXXP 739 G PPP PPP G P P + PP PP Sbjct: 28 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQ 87 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P PP P G PPPP P PP Sbjct: 88 PQGPPPPPGKPQGPPPQGDNKSQGPPPPGKPQGPP 122 Score = 37.1 bits (82), Expect = 0.081 Identities = 26/95 (27%), Positives = 27/95 (28%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP----PPPXXXXXP 739 G PPP PPP S P P + PP PP Sbjct: 90 GPPPPPGKPQGPPPQGDNKSQGPPPPGKPQGPPPQGGSKSRSSRSPPGKPQGPPPQGGNQ 149 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P PP P G PPPP P PP Sbjct: 150 PQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPP 184 Score = 36.3 bits (80), Expect = 0.14 Identities = 26/95 (27%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G S P + PPPPP PP Sbjct: 112 PPPPGKPQGPPPQGG-SKSRSSRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNK 170 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 171 PQGPPPPGKPQGPPPQGGSKSRSARSPPGKPQGPP 205 Score = 35.1 bits (77), Expect = 0.33 Identities = 25/95 (26%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP PP G + P + PPPPP PP Sbjct: 50 PPPPGKPQGPPPQGD-NKSQSARSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGDNK 108 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 109 SQGPPPPGKPQGPPPQGGSKSRSSRSPPGKPQGPP 143 Score = 33.9 bits (74), Expect = 0.75 Identities = 23/90 (25%), Positives = 24/90 (26%), Gaps = 5/90 (5%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPP-----PPPXXXXX 736 G PPP PPP G P P + PP PP Sbjct: 152 GPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGGSKSRSARSPPGKPQGPPQQEGNN 211 Query: 737 PPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 P PP P A PP PP Sbjct: 212 PQGPPPPAGGNPQQPQAPPAGQPQGPPRPP 241 Score = 30.7 bits (66), Expect = 7.0 Identities = 26/98 (26%), Positives = 27/98 (27%), Gaps = 9/98 (9%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX----- 748 PP PPP G P P + PPPP PP Sbjct: 73 PPGKPQGPPPQGGNQPQGPPPP--PGKPQGPPPQGDNKSQGPPPPGKPQGPPPQGGSKSR 130 Query: 749 ----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P GG PPPPP P P Sbjct: 131 SSRSPPGKPQGPPPQGGN---QPQGPPPPPGKPQGPPP 165 >DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. Length = 1262 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/80 (28%), Positives = 23/80 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P PPP P PPPP P PP Sbjct: 669 PPLPGSARIPPPPPPLPGSAGIPPPPP------PLPGEAGMPPPPPPLPGGPGIPPPPPF 722 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 PPPPP Sbjct: 723 PGGPGIPPPPPGMGMPPPPP 742 Score = 35.9 bits (79), Expect = 0.19 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PS PPP P PPPP P PP Sbjct: 642 PPPPPLPEGVGIPSPSSLPGSTAIPPP-----PPLPGSARIPPPPPPLPGSAGIPPPPP- 695 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 696 --PLPGEAG-----MPPPPPPLPGGPGIPP 718 Score = 32.3 bits (70), Expect = 2.3 Identities = 35/142 (24%), Positives = 35/142 (24%), Gaps = 6/142 (4%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXX 598 P P PP PPP P P G PPPP Sbjct: 591 PAPGDSTTPPPPPPPPPPPPLP---GGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPL 647 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXXXT--- 769 P G S P PPP P PP PP Sbjct: 648 ---PEGVGIPSPSSLPGSTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMP 704 Query: 770 ---PXXXGGGGAXXXXXPPPPP 826 P GG G PPPPP Sbjct: 705 PPPPPLPGGPG-----IPPPPP 721 Score = 31.1 bits (67), Expect = 5.3 Identities = 21/85 (24%), Positives = 24/85 (28%), Gaps = 4/85 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP+ P P P + P PPPP PP Sbjct: 588 PPPPAPGDSTTPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPL 647 Query: 762 XK----PXXXXGGGXXXXXPPPPPP 824 + P G PPPP P Sbjct: 648 PEGVGIPSPSSLPGSTAIPPPPPLP 672 Score = 30.7 bits (66), Expect = 7.0 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP-PXXXXT--PXXXGGGGAXXXXXPPPPPXXPP 838 PP P PP P P T P G + PPPPP PP Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPP 610 >DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. Length = 229 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/80 (28%), Positives = 23/80 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P PPP P PPPP P PP Sbjct: 63 PPLPGSARIPPPPPPLPGSAGIPPPPP------PLPGEAGMPPPPPPLPGGPGIPPPPPF 116 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 PPPPP Sbjct: 117 PGGPGIPPPPPGMGMPPPPP 136 Score = 35.9 bits (79), Expect = 0.19 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PS PPP P PPPP P PP Sbjct: 36 PPPPPLPEGVGIPSPSSLPGGTAIPPP-----PPLPGSARIPPPPPPLPGSAGIPPPPP- 89 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 90 --PLPGEAG-----MPPPPPPLPGGPGIPP 112 >BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (Drosophila) protein. Length = 1262 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/80 (28%), Positives = 23/80 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P PPP P PPPP P PP Sbjct: 669 PPLPGSARIPPPPPPLPGSAGIPPPPP------PLPGEAGMPPPPPPLPGGPGIPPPPPF 722 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 PPPPP Sbjct: 723 PGGPGIPPPPPGMGMPPPPP 742 Score = 35.9 bits (79), Expect = 0.19 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PS PPP P PPPP P PP Sbjct: 642 PPPPPLPEGVGIPSPSSLPGGTAIPPP-----PPLPGSARIPPPPPPLPGSAGIPPPPP- 695 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 696 --PLPGEAG-----MPPPPPPLPGGPGIPP 718 Score = 32.3 bits (70), Expect = 2.3 Identities = 35/142 (24%), Positives = 35/142 (24%), Gaps = 6/142 (4%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXX 598 P P PP PPP P P G PPPP Sbjct: 591 PAPGDSTTPPPPPPPPPPPPLP---GGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPL 647 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXXXT--- 769 P G S P PPP P PP PP Sbjct: 648 ---PEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMP 704 Query: 770 ---PXXXGGGGAXXXXXPPPPP 826 P GG G PPPPP Sbjct: 705 PPPPPLPGGPG-----IPPPPP 721 Score = 31.1 bits (67), Expect = 5.3 Identities = 21/85 (24%), Positives = 24/85 (28%), Gaps = 4/85 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP+ P P P + P PPPP PP Sbjct: 588 PPPPAPGDSTTPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPL 647 Query: 762 XK----PXXXXGGGXXXXXPPPPPP 824 + P G PPPP P Sbjct: 648 PEGVGIPSPSSLPGGTAIPPPPPLP 672 Score = 30.7 bits (66), Expect = 7.0 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP-PXXXXT--PXXXGGGGAXXXXXPPPPPXXPP 838 PP P PP P P T P G + PPPPP PP Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPP 610 >BC005000-1|AAH05000.1| 478|Homo sapiens CPSF6 protein protein. Length = 478 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/86 (26%), Positives = 25/86 (29%), Gaps = 4/86 (4%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPP----XPXXXX 740 G PPPP P P PPP+ P + PPPP P Sbjct: 197 GDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPG 256 Query: 741 XXXPPXXXKPXXXXGGGXXXXXPPPP 818 PP P G PP P Sbjct: 257 PLGPPLTLAPPPHLPGPPPGAPPPAP 282 Score = 31.5 bits (68), Expect = 4.0 Identities = 23/90 (25%), Positives = 23/90 (25%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP PPP P P PPPP PP P Sbjct: 193 PPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGP--- 249 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P G G PPP PP P Sbjct: 250 -FPPRPPGPLGPPLTLAPPPHLPGPPPGAP 278 Score = 31.5 bits (68), Expect = 4.0 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP PP P P PPL P PPP PP Sbjct: 236 PPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPAFFPPPTNS 295 Query: 765 KPXXXXGGGXXXXXPPPPPPXXXXP 839 G PPP P P Sbjct: 296 GMPTSDSRG-----PPPTDPYGRPP 315 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 350 GXXXPKXXXPPXFXXPPFSXFFXPXPXPXFFPPKXXXPPPXGPXP 484 G P PP PP F P P PP PPP P P Sbjct: 229 GYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP 273 >AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. Length = 1272 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/80 (28%), Positives = 23/80 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P PPP P PPPP P PP Sbjct: 679 PPLPGSARIPPPPPPLPGSAGIPPPPP------PLPGEAGMPPPPPPLPGGPGIPPPPPF 732 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 PPPPP Sbjct: 733 PGGPGIPPPPPGMGMPPPPP 752 Score = 35.9 bits (79), Expect = 0.19 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PS PPP P PPPP P PP Sbjct: 652 PPPPPLPEGVGIPSPSSLPGGTAIPPP-----PPLPGSARIPPPPPPLPGSAGIPPPPP- 705 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 706 --PLPGEAG-----MPPPPPPLPGGPGIPP 728 Score = 32.7 bits (71), Expect = 1.7 Identities = 35/142 (24%), Positives = 35/142 (24%), Gaps = 6/142 (4%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXX 598 P P PP PPP P P G PPPP Sbjct: 600 PAPGDSTTPPPPPPPPP--PPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPL 657 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXXXT--- 769 P G S P PPP P PP PP Sbjct: 658 ---PEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMP 714 Query: 770 ---PXXXGGGGAXXXXXPPPPP 826 P GG G PPPPP Sbjct: 715 PPPPPLPGGPG-----IPPPPP 731 Score = 31.5 bits (68), Expect = 4.0 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPP--PLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP PP P P PP P P PPP P P Sbjct: 608 PPPP--PPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPS 665 Query: 756 XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P GG PPP P P P Sbjct: 666 PSSLP-----GGTAIPPPPPLPGSARIPPPPP 692 Score = 30.7 bits (66), Expect = 7.0 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP-PXXXXT--PXXXGGGGAXXXXXPPPPPXXPP 838 PP P PP P P T P G + PPPPP PP Sbjct: 573 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPP 619 Score = 30.3 bits (65), Expect = 9.3 Identities = 21/85 (24%), Positives = 23/85 (27%), Gaps = 4/85 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP P P P P + P PPPP PP Sbjct: 598 PPPAPGDSTTPPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPL 657 Query: 762 XK----PXXXXGGGXXXXXPPPPPP 824 + P G PPPP P Sbjct: 658 PEGVGIPSPSSLPGGTAIPPPPPLP 682 >AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. Length = 179 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/80 (28%), Positives = 23/80 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P PPP P PPPP P PP Sbjct: 63 PPLPGSARIPPPPPPLPGSAGIPPPPP------PLPGEAGMPPPPPPLPGGPGIPPPPPF 116 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 PPPPP Sbjct: 117 PGGPGIPPPPPGMGMPPPPP 136 Score = 35.9 bits (79), Expect = 0.19 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PS PPP P PPPP P PP Sbjct: 36 PPPPPLPEGVGIPSPSSLPGGTAIPPP-----PPLPGSARIPPPPPPLPGSAGIPPPPP- 89 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 90 --PLPGEAG-----MPPPPPPLPGGPGIPP 112 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/80 (28%), Positives = 23/80 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P PPP P PPPP P PP Sbjct: 658 PPLPGSARIPPPPPPLPGSAGIPPPPP------PLPGEAGMPPPPPPLPGGPGIPPPPPF 711 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 PPPPP Sbjct: 712 PGGPGIPPPPPGMGMPPPPP 731 Score = 35.9 bits (79), Expect = 0.19 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PS PPP P PPPP P PP Sbjct: 631 PPPPPLPEGVGIPSPSSLPGGTAIPPP-----PPLPGSARIPPPPPPLPGSAGIPPPPP- 684 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 685 --PLPGEAG-----MPPPPPPLPGGPGIPP 707 Score = 32.7 bits (71), Expect = 1.7 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPP 826 PPPPP PP P +P G A PPPPP Sbjct: 599 PPPPPPPPPPPPPLPGGTAISPPPPLSGDA---TIPPPPP 635 Score = 31.5 bits (68), Expect = 4.0 Identities = 22/85 (25%), Positives = 24/85 (28%), Gaps = 4/85 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P P+P PPP P PPPP PP Sbjct: 577 PPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPL 636 Query: 762 XK----PXXXXGGGXXXXXPPPPPP 824 + P G PPPP P Sbjct: 637 PEGVGIPSPSSLPGGTAIPPPPPLP 661 Score = 31.1 bits (67), Expect = 5.3 Identities = 36/144 (25%), Positives = 36/144 (25%), Gaps = 8/144 (5%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPP-- 592 P P P PPP P P G A P P Sbjct: 589 PPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSL 648 Query: 593 --XXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXK----XPPPPPXXXXXPPXXPP 754 PPP S P P P PPPPP P PP Sbjct: 649 PGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPP 708 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPP 826 P GG G PPPPP Sbjct: 709 -----PPFPGGPG-----IPPPPP 722 Score = 31.1 bits (67), Expect = 5.3 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXX--PXXXXXXKXXPPPPXPXXXXXXXPP 755 PP P PP P P PPPL P PPP P P Sbjct: 590 PPAPGDSTTPPPPPPPPPP-----PPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPS 644 Query: 756 XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P GG PPP P P P Sbjct: 645 PSSLP-----GGTAIPPPPPLPGSARIPPPPP 671 Score = 30.7 bits (66), Expect = 7.0 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP-PXXXXT--PXXXGGGGAXXXXXPPPPPXXPP 838 PP P PP P P T P G + PPPPP PP Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPP 610 Score = 30.3 bits (65), Expect = 9.3 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 4/84 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PP P P PPPL PPPP P P Sbjct: 599 PPPP--PPPPPPPPPLPGGTAISPPPPL--------SGDATIPPPPPLPEGVGIPSPSSL 648 Query: 762 XK----PXXXXGGGXXXXXPPPPP 821 P G PPPPP Sbjct: 649 PGGTAIPPPPPLPGSARIPPPPPP 672 >AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant protein. Length = 1299 Score = 37.1 bits (82), Expect = 0.081 Identities = 23/80 (28%), Positives = 23/80 (28%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P PPP P PPPP P PP Sbjct: 706 PPLPGSARIPPPPPPLPGSAGIPPPPP------PLPGEAGMPPPPPPLPGGPGIPPPPPF 759 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 PPPPP Sbjct: 760 PGGPGIPPPPPGMGMPPPPP 779 Score = 35.9 bits (79), Expect = 0.19 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PS PPP P PPPP P PP Sbjct: 679 PPPPPLPEGVGIPSPSSLPGGTAIPPP-----PPLPGSARIPPPPPPLPGSAGIPPPPP- 732 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P G PPPPPP P P Sbjct: 733 --PLPGEAG-----MPPPPPPLPGGPGIPP 755 Score = 32.7 bits (71), Expect = 1.7 Identities = 35/142 (24%), Positives = 35/142 (24%), Gaps = 6/142 (4%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXX 598 P P PP PPP P P G PPPP Sbjct: 627 PAPGDSTTPPPPPPPPP--PPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPL 684 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXXXT--- 769 P G S P PPP P PP PP Sbjct: 685 ---PEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMP 741 Query: 770 ---PXXXGGGGAXXXXXPPPPP 826 P GG G PPPPP Sbjct: 742 PPPPPLPGGPG-----IPPPPP 758 Score = 31.5 bits (68), Expect = 4.0 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 2/92 (2%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPP--PLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP PP P P PP P P PPP P P Sbjct: 635 PPPP--PPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPS 692 Query: 756 XXXKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 P GG PPP P P P Sbjct: 693 PSSLP-----GGTAIPPPPPLPGSARIPPPPP 719 Score = 30.7 bits (66), Expect = 7.0 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 707 PPPPPXXXXXPPXXP-PXXXXT--PXXXGGGGAXXXXXPPPPPXXPP 838 PP P PP P P T P G + PPPPP PP Sbjct: 600 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPP 646 Score = 30.3 bits (65), Expect = 9.3 Identities = 21/85 (24%), Positives = 23/85 (27%), Gaps = 4/85 (4%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP P P P P + P PPPP PP Sbjct: 625 PPPAPGDSTTPPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPPPPL 684 Query: 762 XK----PXXXXGGGXXXXXPPPPPP 824 + P G PPPP P Sbjct: 685 PEGVGIPSPSSLPGGTAIPPPPPLP 709 >AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adaptor molecule protein. Length = 665 Score = 33.9 bits (74), Expect = 0.75 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGG--AXXXXXPPPPPXXPPXXXP 850 PPPPP P GGGG A PPPP PP P Sbjct: 517 PPPPPVRRSSDTSGSPATPLKAKGTGGGGLPAPPDDFLPPPPPPPPLDDP 566 Score = 33.9 bits (74), Expect = 0.75 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 718 PPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXP 840 PP PP PP P G PPPPP P P Sbjct: 569 PPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPPAPAP 609 Score = 31.1 bits (67), Expect = 5.3 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 655 PXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 P P P P P PP PP P G PPPPP P Sbjct: 547 PAPPDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPP-PP 605 Query: 835 XP 840 P Sbjct: 606 AP 607 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/76 (27%), Positives = 23/76 (30%) Frame = +3 Query: 624 PSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGGXXXX 803 P+P PPP P + PPPP P P G Sbjct: 547 PAPPDDFLPPPPP------PPPLDDPELPPPPPD---FMEPPPDFVPPPPPSYAGIAGSE 597 Query: 804 XPPPPPPXXXXPXXXP 851 PPPPPP P P Sbjct: 598 LPPPPPPPAPAPAPVP 613 Score = 27.9 bits (59), Expect(2) = 0.100 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +2 Query: 362 PKXXXPPXFXXPPFSXFFXPXPXPXFF-PPKXXXPPP 469 P PP PP P P P F PP PPP Sbjct: 550 PDDFLPPPPPPPPLDDPELPPPPPDFMEPPPDFVPPP 586 Score = 27.9 bits (59), Expect(2) = 0.100 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P + PPP PP PP Sbjct: 578 PPPDFVPPPPPSYAGIAGSELPPPPPPPAPAPAPVPDSAR---PPPAVAKRPP-VPPKRQ 633 Query: 764 XTPXXXGGGG 793 P GG G Sbjct: 634 ENPGHPGGAG 643 >X07704-1|CAA30542.1| 234|Homo sapiens Po protein protein. Length = 234 Score = 36.7 bits (81), Expect = 0.11 Identities = 27/100 (27%), Positives = 28/100 (28%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 36 GPPPHPGKPERPPPQGGNQSQGPPPH--PGKPERPPPQGGNQSQGPPPTPGKPEGPPPQG 93 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPPPP P P Sbjct: 94 GNQSQGPPPHPGKPERPPPQGGNQSHRPPPPPGKPERPPP 133 Score = 33.9 bits (74), Expect = 0.75 Identities = 27/98 (27%), Positives = 28/98 (28%), Gaps = 8/98 (8%) Frame = +2 Query: 581 PPPPXX-XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP----- 742 PPPP PPP G S P P + PPP P PP Sbjct: 17 PPPPGKPQGPPPQGGNQSQGPP--PHPGKPERPPPQGGNQSQGPPPHPGKPERPPPQGGN 74 Query: 743 --XXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 75 QSQGPPPTPGKPEGPPPQGGNQSQGPPPHPGKPERPPP 112 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P P PP PP NP + PPPPP P P Sbjct: 181 PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPPPPQGGRPPRP 226 Score = 31.5 bits (68), Expect = 4.0 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 7/88 (7%) Frame = +3 Query: 582 PPPPSXXXXPPXXX------PSPXXXXXXXPPPLXXXXXPXXXXXX-KXXPPPPXPXXXX 740 PP P PP P P PPP K PPP Sbjct: 38 PPHPGKPERPPPQGGNQSQGPPPHPGKPERPPPQGGNQSQGPPPTPGKPEGPPPQGGNQS 97 Query: 741 XXXPPXXXKPXXXXGGGXXXXXPPPPPP 824 PP KP G PPPPP Sbjct: 98 QGPPPHPGKPERPPPQGGNQSHRPPPPP 125 Score = 30.3 bits (65), Expect = 9.3 Identities = 26/93 (27%), Positives = 28/93 (30%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G P P PPP G S P P P + PPP P P Sbjct: 78 GPPPTPGKPEGPPPQGGNQSQGPP----PHPGKP---------ERPPPQGGNQSHRPPPP 124 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P P GG + PPP P P P Sbjct: 125 PGKPERPPPQGGNQS---QGPPPHPGKPEGPPP 154 >Y14385-1|CAA74743.1| 1258|Homo sapiens inositol polyphosphate 5-phosphatase protein. Length = 1258 Score = 36.3 bits (80), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNP-XXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP P PP P RG G PPPP P P P Sbjct: 1054 PPPPLPDSAIFLPPSLDPLPGPVVRGRGGAEARGPPPPKAHPRPPLP 1100 >Y08766-1|CAA70019.1| 638|Homo sapiens SF1-Bo isoform protein. Length = 638 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 435 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 488 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 489 PPPPPSGPLPPWQQQQQQPPPPPPP 513 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 421 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 476 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 477 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 512 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 >Y08765-1|CAA70018.1| 639|Homo sapiens SF1-Hl1 isoform protein. Length = 639 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 435 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 488 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 489 PPPPPSGPLPPWQQQQQQPPPPPPP 513 Score = 33.1 bits (72), Expect = 1.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP P T G G PP PP PP Sbjct: 599 PPPPP-----PPPMDPSNFVTMMGMGVAGMPPFGMPPAPPPPPP 637 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 421 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 476 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 477 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 512 Score = 30.7 bits (66), Expect = 7.0 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXP 835 P PP PP PP P G A PPPPP P Sbjct: 568 PLPPGVQPPLPPGAPPPPPPPPP----GSAGMMYAPPPPPPPP 606 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 >M98776-1|AAB47721.1| 644|Homo sapiens keratin 1 protein. Length = 644 Score = 36.3 bits (80), Expect = 0.14 Identities = 25/86 (29%), Positives = 26/86 (30%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGGGG G GG G GG + G G Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSY----GSGGGSYGSG 569 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G G GG GGGG Sbjct: 570 GGGGGHGSYGSGSSSGGYRGGSGGGG 595 Score = 30.3 bits (65), Expect = 9.3 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -2 Query: 754 GGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXXXXXGXGXXXGGXXXXXG-GGGX 578 GG G GGGG G GGG G G GG G GGG Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGGGY 143 Query: 577 XP 572 P Sbjct: 144 GP 145 >L49380-1|AAB04033.1| 639|Homo sapiens transcription factor ZFM1 protein. Length = 639 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 435 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 488 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 489 PPPPPSGPLPPWQQQQQQPPPPPPP 513 Score = 33.1 bits (72), Expect = 1.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP P T G G PP PP PP Sbjct: 599 PPPPP-----PPPMDPSNFVTMMGMGVAGIPPFGMPPAPPPPPP 637 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 421 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 476 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 477 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 512 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 >L36818-1|AAA96658.1| 1149|Homo sapiens 51C protein protein. Length = 1149 Score = 36.3 bits (80), Expect = 0.14 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNP-XXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP P PP P RG G PPPP P P P Sbjct: 990 PPPPLPDSAIFLPPSLDPLPGPVVRGRGGAEARGPPPPKAHPRPPLP 1036 >D26120-2|BAA05117.1| 623|Homo sapiens ZFM1 protein protein. Length = 623 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 435 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 488 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 489 PPPPPSGPLPPWQQQQQQPPPPPPP 513 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 421 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 476 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 477 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 512 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 >D26120-1|BAA05116.1| 548|Homo sapiens ZFM1 protein alternatively spliced product protein. Length = 548 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 435 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 488 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 489 PPPPPSGPLPPWQQQQQQPPPPPPP 513 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 421 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 476 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 477 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 512 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 >BC063697-1|AAH63697.1| 644|Homo sapiens keratin 1 (epidermolytic hyperkeratosis) protein. Length = 644 Score = 36.3 bits (80), Expect = 0.14 Identities = 25/86 (29%), Positives = 26/86 (30%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGGGG G GG G GG + G G Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSY----GSGGGSYGSG 569 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G G GG GGGG Sbjct: 570 GGGGGHGSYGSGSSSGGYRGGSGGGG 595 Score = 30.3 bits (65), Expect = 9.3 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -2 Query: 754 GGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXXXXXGXGXXXGGXXXXXG-GGGX 578 GG G GGGG G GGG G G GG G GGG Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGGGY 143 Query: 577 XP 572 P Sbjct: 144 GP 145 >BC020217-1|AAH20217.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 435 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 488 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 489 PPPPPSGPLPPWQQQQQQPPPPPPP 513 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 421 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 476 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 477 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 512 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 >BC008724-1|AAH08724.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 435 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 488 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 489 PPPPPSGPLPPWQQQQQQPPPPPPP 513 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 421 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 476 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 477 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 512 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 >BC008080-1|AAH08080.1| 548|Homo sapiens splicing factor 1 protein. Length = 548 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 435 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 488 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 489 PPPPPSGPLPPWQQQQQQPPPPPPP 513 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 421 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 476 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 477 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 512 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 420 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 479 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 480 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 512 >BC000773-1|AAH00773.1| 265|Homo sapiens Similar to zinc finger protein 162 protein. Length = 265 Score = 36.3 bits (80), Expect = 0.14 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 474 GPXPXXXXGAPXXXXXXXXXXXXXXAXXFFXXXGXXPPPPSXXXXPPXXXPSPXXXXXXX 653 GP P G P G PPPP PP PS Sbjct: 61 GPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPS------GQ 114 Query: 654 PPPLXXXXXPXXXXXXKXXPPPPXP 728 PPP P + PPPP P Sbjct: 115 PPPPPSGPLPPWQQQQQQPPPPPPP 139 Score = 33.1 bits (72), Expect = 1.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP P T G G PP PP PP Sbjct: 225 PPPPP-----PPPMDPSNFVTMMGMGVAGMPPFGMPPAPPPPPP 263 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 12/93 (12%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPL--XXXXXPXXXXXXK------XXPPPPXPXXX 737 PPPP PP P PPP+ P + PPPP Sbjct: 46 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 105 Query: 738 XXXXPPXXXKPXXXXG----GGXXXXXPPPPPP 824 PP P G PPPPPP Sbjct: 106 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 138 Score = 31.1 bits (67), Expect = 5.3 Identities = 27/101 (26%), Positives = 28/101 (27%), Gaps = 2/101 (1%) Frame = +2 Query: 425 PXPXFFPPKXXXPPPXGPXPXKXGX-GAXXXXXXXXXXXXXXGXXXFXXX-GXXPPPPXX 598 P P PP PPP P G G G G PPPP Sbjct: 47 PPPWMQPP----PPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMG 102 Query: 599 XXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPP 721 PPP P P P + PPPPP Sbjct: 103 MMPPPPPPPSGQPPPPPSGPLP-----PWQQQQQQPPPPPP 138 Score = 30.7 bits (66), Expect = 7.0 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXP 835 P PP PP PP P G A PPPPP P Sbjct: 194 PLPPGVQPPLPPGAPPPPPPPPP----GSAGMMYAPPPPPPPP 232 Score = 30.3 bits (65), Expect = 9.3 Identities = 23/93 (24%), Positives = 23/93 (24%), Gaps = 8/93 (8%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXX--------KXPPPPPXXXXXP 739 PPP PPP P P P K PPP P Sbjct: 46 PPPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMP 105 Query: 740 PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P PP P G PP PP Sbjct: 106 PPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPP 138 >AF304164-1|AAG41947.1| 644|Homo sapiens keratin 1 protein. Length = 644 Score = 36.3 bits (80), Expect = 0.14 Identities = 25/86 (29%), Positives = 26/86 (30%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGGGG G GG G GG + G G Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSY----GSGGGSYGSG 569 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G G GG GGGG Sbjct: 570 GGGGGHGSYGSGSSSGGYRGGSGGGG 595 Score = 30.3 bits (65), Expect = 9.3 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -2 Query: 754 GGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXXXXXGXGXXXGGXXXXXG-GGGX 578 GG G GGGG G GGG G G GG G GGG Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGGGY 143 Query: 577 XP 572 P Sbjct: 144 GP 145 >AF237621-1|AAF60327.1| 644|Homo sapiens keratin 1 protein. Length = 644 Score = 36.3 bits (80), Expect = 0.14 Identities = 25/86 (29%), Positives = 26/86 (30%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGGGG G GG G GG + G G Sbjct: 514 GGGSRGGGGGGYGSGGSSYGSGGGSYGSGGGGGGGRGSYGSGGSSY----GSGGGSYGSG 569 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G G GG GGGG Sbjct: 570 GGGGGHGSYGSGSSSGGYRGGSGGGG 595 Score = 30.3 bits (65), Expect = 9.3 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = -2 Query: 754 GGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXXXXXGXGXXXGGXXXXXG-GGGX 578 GG G GGGG G GGG G G GG G GGG Sbjct: 84 GGRGSGFGGGYGGGGFGGGGFGGGGFGGGGIGGGGFGGFGSGGGGFGGGGFGGGGYGGGY 143 Query: 577 XP 572 P Sbjct: 144 GP 145 >M74027-1|AAA59875.1| 573|Homo sapiens mucin protein. Length = 573 Score = 35.9 bits (79), Expect = 0.19 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP S PP PSP PPP P P P PP Sbjct: 66 PPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPT 125 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 P P PP Sbjct: 126 TTPSPPTTTPSPPTTTPSPP 145 >BC050072-1|AAH50072.1| 489|Homo sapiens forkhead box G1 protein. Length = 489 Score = 35.9 bits (79), Expect = 0.19 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +2 Query: 710 PPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXP-----PPPPXXPP 838 PPPP PP PP P G A P PPPP PP Sbjct: 65 PPPPPQQQQPPPPPPPAPQPPQTRGAPAADDDKGPQQLLLPPPPPPPP 112 Score = 33.1 bits (72), Expect = 1.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 PPPP PP PP P G PPPPP P Sbjct: 74 PPPPPPPAPQ--PPQTRGAPAADDDKGPQQLLLPPPPPPPP 112 Score = 31.5 bits (68), Expect = 4.0 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPP 722 PPPP PP P+P P P PPPP Sbjct: 66 PPPPQQQQPPPPPPPAPQPPQTRGAPAADDDKGPQQLLLPPPPPPPP 112 >BC023532-1|AAH23532.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 7/93 (7%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPP-LXXXXXPXXXXXXKXXPP---PPXPXXXXXXX 749 PPP PP P P PPP P + P PP P Sbjct: 410 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPG 469 Query: 750 PPXXXKPXXXXG---GGXXXXXPPPPPPXXXXP 839 PP P G G PPP PP P Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 502 Score = 33.5 bits (73), Expect = 1.00 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 2/88 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXX--PXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PP P P P G P P P PPP PP PP Sbjct: 416 PPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPP 475 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P G PP PP PP Sbjct: 476 PGL--PPGPPPRGPPPRLPPPAPPGIPP 501 >BC016441-1|AAH16441.2| 400|Homo sapiens WBP11 protein protein. Length = 400 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 7/93 (7%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPP-LXXXXXPXXXXXXKXXPP---PPXPXXXXXXX 749 PPP PP P P PPP P + P PP P Sbjct: 169 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPG 228 Query: 750 PPXXXKPXXXXG---GGXXXXXPPPPPPXXXXP 839 PP P G G PPP PP P Sbjct: 229 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 261 Score = 33.5 bits (73), Expect = 1.00 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 2/88 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXX--PXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PP P P P G P P P PPP PP PP Sbjct: 175 PPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPP 234 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P G PP PP PP Sbjct: 235 PGL--PPGPPPRGPPPRLPPPAPPGIPP 260 >BC001621-1|AAH01621.1| 641|Homo sapiens WW domain binding protein 11 protein. Length = 641 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 7/93 (7%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPP-LXXXXXPXXXXXXKXXPP---PPXPXXXXXXX 749 PPP PP P P PPP P + P PP P Sbjct: 410 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPG 469 Query: 750 PPXXXKPXXXXG---GGXXXXXPPPPPPXXXXP 839 PP P G G PPP PP P Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 502 Score = 33.5 bits (73), Expect = 1.00 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 2/88 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXX--PXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PP P P P G P P P PPP PP PP Sbjct: 416 PPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPP 475 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P G PP PP PP Sbjct: 476 PGL--PPGPPPRGPPPRLPPPAPPGIPP 501 >AF118023-1|AAD30425.1| 641|Homo sapiens SH3 domain-binding protein SNP70 protein. Length = 641 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 7/93 (7%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPP-LXXXXXPXXXXXXKXXPP---PPXPXXXXXXX 749 PPP PP P P PPP P + P PP P Sbjct: 410 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPG 469 Query: 750 PPXXXKPXXXXG---GGXXXXXPPPPPPXXXXP 839 PP P G G PPP PP P Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 502 Score = 33.5 bits (73), Expect = 1.00 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 2/88 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXX--PXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PP P P P G P P P PPP PP PP Sbjct: 416 PPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPP 475 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P G PP PP PP Sbjct: 476 PGL--PPGPPPRGPPPRLPPPAPPGIPP 501 >AB029309-1|BAA88410.1| 641|Homo sapiens Npw38-binding protein NpwBP protein. Length = 641 Score = 35.9 bits (79), Expect = 0.19 Identities = 26/93 (27%), Positives = 27/93 (29%), Gaps = 7/93 (7%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPP-LXXXXXPXXXXXXKXXPP---PPXPXXXXXXX 749 PPP PP P P PPP P + P PP P Sbjct: 410 PPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPG 469 Query: 750 PPXXXKPXXXXG---GGXXXXXPPPPPPXXXXP 839 PP P G G PPP PP P Sbjct: 470 PPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPP 502 Score = 33.5 bits (73), Expect = 1.00 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 2/88 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXX--PXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PP P P P G P P P PPP PP PP Sbjct: 416 PPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPP 475 Query: 755 XXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P G PP PP PP Sbjct: 476 PGL--PPGPPPRGPPPRLPPPAPPGIPP 501 >BC085004-1|AAH85004.1| 710|Homo sapiens KHSRP protein protein. Length = 710 Score = 35.5 bits (78), Expect = 0.25 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 825 GGGGGXXXXXAPPPPXXXGVXXXXGGXXGGXXXXXGGGGG 706 GGGGG PPP G GG GG G GG Sbjct: 18 GGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGG 57 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 35.5 bits (78), Expect = 0.25 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP P P + PPP P PP P Sbjct: 1958 PPPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPP 2005 Score = 32.7 bits (71), Expect = 1.7 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP S P P PPPPP PP PP Sbjct: 1959 PPPPPPPPLPPAPPQPSSMGPVKI---PNTVSTPLQAPPPTPPPPPPPPPPPPPPPPPPP 2015 Query: 761 XXTP 772 P Sbjct: 2016 PSAP 2019 Score = 30.3 bits (65), Expect = 9.3 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXN-----PXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 1959 PPPPPPPPLPPAPPQPSSMGPVKIPNTVSTPLQAPPPTPPPPPPPPPPPPP 2009 >AB028987-1|BAA83016.2| 1315|Homo sapiens KIAA1064 protein protein. Length = 1315 Score = 35.5 bits (78), Expect = 0.25 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P PPP P P P G PPPPP PP P Sbjct: 520 PKPPPGVGLLPTPPRPPGPQAPTSPNGRPMQGGPPPPPPPPPPPPGPP 567 >K03207-1|AAA60188.1| 247|Homo sapiens salivary proline-rich protein precursor protein. Length = 247 Score = 35.1 bits (77), Expect = 0.33 Identities = 26/96 (27%), Positives = 28/96 (29%), Gaps = 10/96 (10%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPP PPP G S P P + PPP P PP Sbjct: 52 PPPGKPQGPPPQGGNQSQGPPPP--PGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQ 109 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP P GG + PP P PP Sbjct: 110 SQGTPPPPGKPERPPPQGGNQSHRPPPPPGKPERPP 145 Score = 34.3 bits (75), Expect = 0.57 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 8/94 (8%) Frame = +3 Query: 582 PPPPSXXXXPPXXX-------PSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXX 740 PPPP PP P P PP K PPP Sbjct: 51 PPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQS 110 Query: 741 XXXPPXXXKPXXXXG-GGXXXXXPPPPPPXXXXP 839 PP KP GG PPPPP P Sbjct: 111 QGTPPPPGKPERPPPQGGNQSHRPPPPPGKPERP 144 Score = 33.1 bits (72), Expect = 1.3 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP--- 742 G PPP PP G S P P + PPPP PP Sbjct: 70 GPPPPPGKPEGRPPQGGNQSQGPP--PHPGKPERPPPQGGNQSQGTPPPPGKPERPPPQG 127 Query: 743 ----XXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 128 GNQSHRPPPPPGKPERPPPQGGNQSQGPPPHPGKPEGPPP 167 Score = 32.7 bits (71), Expect = 1.7 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P P PP PP NP + PPPPP P P Sbjct: 194 PQGPPPPGKPQGPPPAGGNPQQPQDPPAGKPQGPPPPPQGGRPPRP 239 Score = 30.7 bits (66), Expect = 7.0 Identities = 26/99 (26%), Positives = 28/99 (28%), Gaps = 6/99 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G S P P + PPP P PP Sbjct: 112 GTPPPPGKPERPPPQGGNQSHRPP--PPPGKPERPPPQGGNQSQGPPPHPGKPEGPPPQE 169 Query: 752 PXXXXT----PXXXGGGGAXXXXXP--PPPPXXPPXXXP 850 + P G P PPPP P P Sbjct: 170 GNKSRSARSPPGKPQGPPQQEGNKPQGPPPPGKPQGPPP 208 >BC087835-1|AAH87835.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 35.1 bits (77), Expect = 0.33 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPP 817 PPPPP PP PP P G GGA P Sbjct: 15 PPPPPQPQPQPPPPPPGPGAGPGAGGAGGAGAGAGDP 51 >BC065546-1|AAH65546.1| 338|Homo sapiens FAM44A protein protein. Length = 338 Score = 35.1 bits (77), Expect = 0.33 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPP 817 PPPPP PP PP P G GGA P Sbjct: 15 PPPPPQPQPQPPPPPPGPGAGPGAGGAGGAGAGAGDP 51 >AF528529-1|AAM94279.1| 502|Homo sapiens hypothetical protein protein. Length = 502 Score = 35.1 bits (77), Expect = 0.33 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPP 817 PPPPP PP PP P G GGA P Sbjct: 15 PPPPPQPQPQPPPPPPGPGAGPGAGGAGGAGAGAGDP 51 >M94131-1|AAA59163.1| 1270|Homo sapiens mucin protein. Length = 1270 Score = 34.7 bits (76), Expect = 0.43 Identities = 20/80 (25%), Positives = 21/80 (26%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP + PP PSP PPP P P P PP Sbjct: 783 PPPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTTTTPPPT 842 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 P P PP Sbjct: 843 TTPSPPTTTPSPPTTTPSPP 862 >L21998-1|AAB95295.1| 5179|Homo sapiens mucin protein. Length = 5179 Score = 34.7 bits (76), Expect = 0.43 Identities = 20/80 (25%), Positives = 21/80 (26%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP + PP PSP PPP P P P PP Sbjct: 1408 PPPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTTTTPPPT 1467 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 P P PP Sbjct: 1468 TTPSPPTTTPSPPTTTPSPP 1487 >BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 protein. Length = 1542 Score = 34.7 bits (76), Expect = 0.43 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP GG P PP P P Sbjct: 1471 PPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPPQQP 1518 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPP--PPPXXPP 838 PPPPP PP P P GG P PP PP Sbjct: 1470 PPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPP 1515 >BC012062-1|AAH12062.1| 407|Homo sapiens DAZ associated protein 1 protein. Length = 407 Score = 34.7 bits (76), Expect = 0.43 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXX---PXXXXPX---PXXXXXXXXXXXXKXPPPPPXXXX 733 G PPP PPP S P P P PPPPP Sbjct: 245 GYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQF 304 Query: 734 XPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP PP TP GA PPPP P Sbjct: 305 APPGVPP-PPATP------GAAPLAFPPPPSQAAP 332 >AY675556-1|AAV91783.1| 474|Homo sapiens myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusion p protein. Length = 474 Score = 34.7 bits (76), Expect = 0.43 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXX---PXXXXPX---PXXXXXXXXXXXXKXPPPPPXXXX 733 G PPP PPP S P P P PPPPP Sbjct: 312 GYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQF 371 Query: 734 XPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP PP TP GA PPPP P Sbjct: 372 APPGVPP-PPATP------GAAPLAFPPPPSQAAP 399 >AK056850-1|BAB71295.1| 289|Homo sapiens protein ( Homo sapiens cDNA FLJ32288 fis, clone PROST2000325, highly similar to Homo sapiens DAZ associated protein 1 (DAZAP1) mRNA. ). Length = 289 Score = 34.7 bits (76), Expect = 0.43 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXX---PXXXXPX---PXXXXXXXXXXXXKXPPPPPXXXX 733 G PPP PPP S P P P PPPPP Sbjct: 156 GYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQF 215 Query: 734 XPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP PP TP GA PPPP P Sbjct: 216 APPGVPP-PPATP------GAAPLAFPPPPSQAAP 243 >AF181719-1|AAF78364.1| 407|Homo sapiens DAZ associated protein 1 protein. Length = 407 Score = 34.7 bits (76), Expect = 0.43 Identities = 29/95 (30%), Positives = 29/95 (30%), Gaps = 6/95 (6%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXX---PXXXXPX---PXXXXXXXXXXXXKXPPPPPXXXX 733 G PPP PPP S P P P PPPPP Sbjct: 245 GYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQF 304 Query: 734 XPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PP PP TP GA PPPP P Sbjct: 305 APPGVPP-PPATP------GAAPLAFPPPPSQAAP 332 >AB058759-1|BAB47485.1| 1134|Homo sapiens KIAA1856 protein protein. Length = 1134 Score = 34.7 bits (76), Expect = 0.43 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPPXXXXTPXXXG----GGGAXXXXXPPPPPXXPPXXXP 850 + PPPPP PP PP P PPPPP PP P Sbjct: 953 RAPPPPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLPP 1006 Score = 33.1 bits (72), Expect = 1.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P R P P P P P P Sbjct: 957 PPPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPP 1002 Score = 31.5 bits (68), Expect = 4.0 Identities = 24/80 (30%), Positives = 25/80 (31%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPPP PP P P PPL P + PPPP P PP Sbjct: 959 PPPPPHPPLPPPPLPPPPLPLRL--PPLPPPPLP------RPHPPPPPP------LPPLL 1004 Query: 762 XKPXXXXGGGXXXXXPPPPP 821 P PPPP Sbjct: 1005 PPPQTRTLPAARTMRQPPPP 1024 Score = 30.3 bits (65), Expect = 9.3 Identities = 21/78 (26%), Positives = 22/78 (28%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP PP P P PPP P P PP P PP Sbjct: 955 PPP-----PPPPPPHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPPLLPPPQT 1009 Query: 765 KPXXXXGGGXXXXXPPPP 818 + PPPP Sbjct: 1010 RTLP---AARTMRQPPPP 1024 Score = 28.7 bits (61), Expect(2) = 3.8 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 1/82 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPP-PXXXXXPPXXPPX 757 PPPP PPP P P P PPPP P PP P Sbjct: 955 PPPPP---PPP---------PHPPLPPPPLPPPPLPLRLPPLPPPPLPRPHPPPPPPLPP 1002 Query: 758 XXXTPXXXGGGGAXXXXXPPPP 823 P A PPPP Sbjct: 1003 LLPPPQTRTLPAARTMRQPPPP 1024 Score = 21.4 bits (43), Expect(2) = 3.8 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXGPXP 484 P P P + PPP P P Sbjct: 941 PPPRAPALPSEARAPPPPPPPP 962 >AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SEB) protein. Length = 1542 Score = 34.7 bits (76), Expect = 0.43 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP GG P PP P P Sbjct: 1471 PPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPPQQP 1518 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPP--PPPXXPP 838 PPPPP PP P P GG P PP PP Sbjct: 1470 PPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPP 1515 >AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. Length = 1605 Score = 34.7 bits (76), Expect = 0.43 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PPPPP PP PP GG P PP P P Sbjct: 1534 PPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPPQQP 1581 Score = 30.3 bits (65), Expect = 9.3 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPP--PPPXXPP 838 PPPPP PP P P GG P PP PP Sbjct: 1533 PPPPPPLPPPPPPPLPPPPPLPKTPRGGKRKHKPQAPAQPPQQSPP 1578 >Z46389-1|CAA86523.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein (VASP) protein. Length = 380 Score = 34.3 bits (75), Expect = 0.57 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPP P P P Sbjct: 171 PPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGP 216 >X98534-1|CAA67147.2| 378|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 378 Score = 34.3 bits (75), Expect = 0.57 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPP P P P Sbjct: 169 PPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGP 214 >BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosophila) protein. Length = 591 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 309 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 363 Query: 753 P 755 P Sbjct: 364 P 364 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 331 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 313 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 >BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. Length = 527 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 266 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 320 Query: 753 P 755 P Sbjct: 321 P 321 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 288 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 330 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 270 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 325 >BC038224-1|AAH38224.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 34.3 bits (75), Expect = 0.57 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPP P P P Sbjct: 171 PPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGP 216 >BC029566-1|AAH29566.1| 189|Homo sapiens DMRTB1 protein protein. Length = 189 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP P P G + PPPPP PP Sbjct: 112 PPPPPPLPPLPPLPPQPQFLPP----GYLSALHFLPPPPPPPPP 151 >BC026019-1|AAH26019.1| 380|Homo sapiens vasodilator-stimulated phosphoprotein protein. Length = 380 Score = 34.3 bits (75), Expect = 0.57 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPP P P P Sbjct: 172 PPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGP 217 >AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. Length = 570 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 309 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 363 Query: 753 P 755 P Sbjct: 364 P 364 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 331 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 313 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P PPP PP PP TP G PPPPP PP P Sbjct: 441 PLPPP-----PPPLPPSSD-TPETVQNGPVTPPMPPPPPPPPPPPPPP 482 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPP--PP-PXXPP 838 P PPP PP PP P G A PP PP P PP Sbjct: 467 PMPPPPPPPPPPPPPPPPPPPPPPLPGPAAETVPAPPLAPPLPSAPP 513 Score = 30.7 bits (66), Expect = 7.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 715 PPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPP PP PP G PPPPP P P P Sbjct: 443 PPPPPPL----PPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPP 483 Score = 30.7 bits (66), Expect = 7.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P G P PP P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPLP---GPAAETVPAPPLAPPLPSAP 512 >AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 309 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 363 Query: 753 P 755 P Sbjct: 364 P 364 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 331 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 313 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 >AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 556 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 610 Query: 753 P 755 P Sbjct: 611 P 611 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 578 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 560 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 615 >AL365445-2|CAI22836.1| 342|Homo sapiens DMRT-like family B with proline-rich C-terminal, 1 protein. Length = 342 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP P P G + PPPPP PP Sbjct: 265 PPPPPPLPPLPPLPPQPQFLPP----GYLSALHFLPPPPPPPPP 304 >AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 309 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 363 Query: 753 P 755 P Sbjct: 364 P 364 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 331 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 313 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 >AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 556 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 610 Query: 753 P 755 P Sbjct: 611 P 611 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 578 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 620 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 560 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 615 >AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens cDNA FLJ38927 fis, clone NT2NE2012505, highly similar to Gallus gallus mRNA for avena. ). Length = 467 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 206 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 260 Query: 753 P 755 P Sbjct: 261 P 261 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 228 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 270 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 210 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 265 >AK057273-1|BAB71407.1| 342|Homo sapiens protein ( Homo sapiens cDNA FLJ32711 fis, clone TESTI2000707, weakly similar to DOUBLESEX PROTEIN, MALE-SPECIFIC. ). Length = 342 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP P P G + PPPPP PP Sbjct: 265 PPPPPPLPPLPPLPPQPQFLPP----GYLSALHFLPPPPPPPPP 304 >AJ291671-1|CAC40654.1| 336|Homo sapiens doublesex-mab-3 (DM) domain protein. Length = 336 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP PP P P G + PPPPP PP Sbjct: 259 PPPPPPLPPLPPLPPQPQFLPP----GYLSALHFLPPPPPPPPP 298 >AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. Length = 591 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPP PP P P PPP P PPPP P P Sbjct: 309 GPLAPPP-----PPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPP 363 Query: 753 P 755 P Sbjct: 364 P 364 Score = 34.3 bits (75), Expect = 0.57 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P PPPPP P P P Sbjct: 331 PPPPGPPPP---PPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLP 373 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP PP S P P P PPP P PP PP Sbjct: 313 PPPPPPL--PPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 34.3 bits (75), Expect = 0.57 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P PPP PP PP TP G PPPPP PP P Sbjct: 544 PLPPP-----PPPLPPSSD-TPETVQNGPVTPPMPPPPPPPPPPPPPP 585 Score = 31.1 bits (67), Expect = 5.3 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPP--PP-PXXPP 838 P PPP PP PP P G + PP PP P PP Sbjct: 570 PMPPPPPPPPPPPPPPPPPPPPPPLPGPASETVPAPPLAPPLPSAPP 616 Score = 30.7 bits (66), Expect = 7.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 715 PPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPP PP PP G PPPPP P P P Sbjct: 546 PPPPPPL----PPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPP 586 Score = 30.7 bits (66), Expect = 7.0 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 PPPP PP PP P G P PP P P P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPLP---GPASETVPAPPLAPPLPSAP 615 Score = 26.6 bits (56), Expect(2) = 5.0 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXP 664 PPPP PPP G S P P Sbjct: 583 PPPPPPPPPPPLPGPASETVPAPPLAPP 610 Score = 23.0 bits (47), Expect(2) = 5.0 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +2 Query: 335 GXXKXGXXXPKXXXPPXFXXPPFSXFFXPXPXPXFFPPKXXXPPPXGPXP 484 G G P P P + P P PP PPP P P Sbjct: 538 GAASSGPLPPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPPPPP 587 >BC108290-1|AAI08291.1| 316|Homo sapiens LOR protein protein. Length = 316 Score = 33.9 bits (74), Expect = 0.75 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = -2 Query: 850 GXXXGXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXX 671 G G GGGG G G GG G GGGG G Sbjct: 29 GGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSV 88 Query: 670 XXRGGGXXXXXXXGXGXXXGGXXXXXGGGG 581 GGG G GG GG Sbjct: 89 KYSGGGGSSGGGSGCFSSGGGGSGCFSSGG 118 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -2 Query: 820 GGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXX 641 GGGGG G GG G GGG G GGG Sbjct: 21 GGGGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG---- 76 Query: 640 XXXGXGXXXGGXXXXXGGGG 581 G G GG GGGG Sbjct: 77 -IGGCGGGSGGSVKYSGGGG 95 Score = 30.7 bits (66), Expect = 7.0 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = -3 Query: 789 PPPXXXGVXXXXGGXXGGXXXXXGGGGGXXXXXXXXXXXXXXGXGXXXXGXXKEXXPXXG 610 P P V GG GG GGGGG G G G G Sbjct: 10 PQPPVDCVKTSGGGGGGGG----GGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCG 65 Query: 609 GGXXXXGGGG 580 GG GGGG Sbjct: 66 GGSSGGGGGG 75 >BC034690-1|AAH34690.1| 316|Homo sapiens LOR protein protein. Length = 316 Score = 33.9 bits (74), Expect = 0.75 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = -2 Query: 850 GXXXGXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXX 671 G G GGGG G G GG G GGGG G Sbjct: 29 GGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSV 88 Query: 670 XXRGGGXXXXXXXGXGXXXGGXXXXXGGGG 581 GGG G GG GG Sbjct: 89 KYSGGGGSSGGGSGCFSSGGGGSGCFSSGG 118 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -2 Query: 820 GGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXX 641 GGGGG G GG G GGG G GGG Sbjct: 21 GGGGGGGGGGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG---- 76 Query: 640 XXXGXGXXXGGXXXXXGGGG 581 G G GG GGGG Sbjct: 77 -IGGCGGGSGGSVKYSGGGG 95 Score = 30.7 bits (66), Expect = 7.0 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = -3 Query: 789 PPPXXXGVXXXXGGXXGGXXXXXGGGGGXXXXXXXXXXXXXXGXGXXXXGXXKEXXPXXG 610 P P V GG GG GGGGG G G G G Sbjct: 10 PQPPVDCVKTSGGGGGGGG----GGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCG 65 Query: 609 GGXXXXGGGG 580 GG GGGG Sbjct: 66 GGSSGGGGGG 75 >AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activated, cyclic nucleotide-gated channel 2 protein. Length = 889 Score = 27.9 bits (59), Expect(2) = 0.81 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 395 PPFSXFFXPXPXPXFFPPKXXXPPPXGPXP 484 P S P P P PPK PPP P P Sbjct: 14 PGASPTTGPPPPPPPRPPKQQPPPPPPPAP 43 Score = 24.6 bits (51), Expect(2) = 0.81 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXP 664 PPPP PPP G P P Sbjct: 35 PPPPPPPAPPPGPGPAPPQHPPRAEALP 62 >X07881-1|CAA30728.1| 309|Homo sapiens proline-rich protein G1 protein. Length = 309 Score = 33.5 bits (73), Expect = 1.00 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 154 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQG 211 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 212 GNQSQGPPPRPGKPEGSPSQGGNKPRGPPPHPGKPQGPPP 251 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 49 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQG 106 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 107 GNQSQGPPPRPGEPEGPPPQGGNQSQGPPPHPGKPEGPPP 146 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 91 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGEPEGPPPQGGNQSQGPPPHPGKPEGPPPQG 148 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 149 GNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPP 188 Score = 31.5 bits (68), Expect = 4.0 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +1 Query: 655 PXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 P P P PPPP P PP NP PPPPP Sbjct: 241 PHPGKPQGPPPQEGNKPQRPPPPRRP---QGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 297 Query: 835 XPXXP 849 P P Sbjct: 298 RPHRP 302 Score = 30.7 bits (66), Expect = 7.0 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP P P P PPP P K PPP P PP Sbjct: 249 PPPQEGNKPQR--PPPPRRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGGRPHRPPQGQ 306 Query: 765 KP 770 P Sbjct: 307 PP 308 >Y13440-1|CAA73851.1| 582|Homo sapiens Rox protein. Length = 582 Score = 33.1 bits (72), Expect = 1.3 Identities = 23/90 (25%), Positives = 25/90 (27%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P P PL P + PPPP P Sbjct: 63 PPLPLSPPAPPPAPPPPLAT----PAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAP 118 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P G P P P P P Sbjct: 119 RQPALVGAPGLSIKEPAPLPSRPQVPTPAP 148 >X96401-1|CAA65265.1| 582|Homo sapiens ROX protein protein. Length = 582 Score = 33.1 bits (72), Expect = 1.3 Identities = 23/90 (25%), Positives = 25/90 (27%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P P PL P + PPPP P Sbjct: 63 PPLPLSPPAPPPAPPPPLAT----PAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAP 118 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P G P P P P P Sbjct: 119 RQPALVGAPGLSIKEPAPLPSRPQVPTPAP 148 >X07882-1|CAA30729.1| 226|Homo sapiens Po protein protein. Length = 226 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P P PP PP NP + PPPPP P P Sbjct: 173 PQGPPPPGKPQGPPPAGGNPQQPQAPPAGKPQGPPPPPQGGRPPRP 218 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/94 (25%), Positives = 24/94 (25%), Gaps = 1/94 (1%) Frame = +3 Query: 561 FXXXGXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXX 740 F G PP P P PP K PPP Sbjct: 30 FLISGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQS 89 Query: 741 XXXPPXXXKPXXXXG-GGXXXXXPPPPPPXXXXP 839 PP KP GG PPPPP P Sbjct: 90 QGTPPPPGKPERPPPQGGNQSHRPPPPPGKPERP 123 Score = 30.3 bits (65), Expect = 9.3 Identities = 25/99 (25%), Positives = 26/99 (26%), Gaps = 9/99 (9%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX---- 748 PPPP P G P P PPPP PP Sbjct: 51 PPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQSQGTPPPPGKPERPPPQGGNQS 110 Query: 749 -----PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P GG + PPP P P P Sbjct: 111 HRPPPPPGKPERPPPQGGNQS---QGPPPHPGKPEGPPP 146 >S80916-1|AAB50687.2| 238|Homo sapiens parotid 'o' protein protein. Length = 238 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P P PP PP NP + PPPPP P P Sbjct: 185 PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPPPPQGGRPPRP 230 Score = 31.5 bits (68), Expect = 4.0 Identities = 24/96 (25%), Positives = 24/96 (25%), Gaps = 6/96 (6%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P PP P PP Sbjct: 21 PPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQS 80 Query: 761 XXTPXXXG------GGGAXXXXXPPPPPXXPPXXXP 850 TP G G PPP P P P Sbjct: 81 QGTPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPP 116 Score = 30.3 bits (65), Expect = 9.3 Identities = 34/147 (23%), Positives = 39/147 (26%), Gaps = 12/147 (8%) Frame = +2 Query: 446 PKXXXPPPXGPX--PXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXXXXPPPXX 619 P+ PPP P P + G + G P P PPP Sbjct: 17 PQRPPPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQG 76 Query: 620 GXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX----------PPXXXXT 769 G S P P + PPP P PP PP Sbjct: 77 GNQSQGTPPP--PGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQSHRPPPPPGKPER 134 Query: 770 PXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG + PPP P P P Sbjct: 135 PPPQGGNQS---QGPPPHPGKPEGPPP 158 >D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. Length = 567 Score = 33.1 bits (72), Expect = 1.3 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 6/96 (6%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPP--PPXXXXXPPXX-- 748 PPPP PPP + P P PPP PP PP Sbjct: 356 PPPPVPPPPPPP----ATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARA 411 Query: 749 PPXXXXTPXXX--GGGGAXXXXXPPPPPXXPPXXXP 850 P P G PPPPP PP P Sbjct: 412 APVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRP 447 >BC130531-1|AAI30532.1| 491|Homo sapiens Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1 protein. Length = 491 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP P PP TP PPP PP Sbjct: 344 PPPPPPPISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPP 387 >BC130529-1|AAI30530.1| 491|Homo sapiens Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1 protein. Length = 491 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP P PP TP PPP PP Sbjct: 344 PPPPPPPISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPP 387 >BC130386-1|AAI30387.1| 268|Homo sapiens PRB4 protein protein. Length = 268 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P P PP PP NP + PPPPP P P Sbjct: 215 PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPPPPQGGRPPRP 260 Score = 31.5 bits (68), Expect = 4.0 Identities = 24/96 (25%), Positives = 24/96 (25%), Gaps = 6/96 (6%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P PP P PP Sbjct: 51 PPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQS 110 Query: 761 XXTPXXXG------GGGAXXXXXPPPPPXXPPXXXP 850 TP G G PPP P P P Sbjct: 111 QGTPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPP 146 Score = 30.3 bits (65), Expect = 9.3 Identities = 34/147 (23%), Positives = 39/147 (26%), Gaps = 12/147 (8%) Frame = +2 Query: 446 PKXXXPPPXGPX--PXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXXXXPPPXX 619 P+ PPP P P + G + G P P PPP Sbjct: 47 PQRPPPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQG 106 Query: 620 GXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX----------PPXXXXT 769 G S P P + PPP P PP PP Sbjct: 107 GNQSQGTPPP--PGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQSHRPPPPPGKPER 164 Query: 770 PXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P GG + PPP P P P Sbjct: 165 PPPQGGNQS---QGPPPHPGKPEGPPP 188 >BC128191-1|AAI28192.1| 183|Homo sapiens PRB4 protein protein. Length = 183 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +1 Query: 712 PPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXPXPXXP 849 P P PP PP NP + PPPPP P P Sbjct: 125 PQGPPPPGKPQGPPPPGGNPQQPQAPPAGKPQGPPPPPQGGRPPRP 170 Score = 31.1 bits (67), Expect = 5.3 Identities = 22/88 (25%), Positives = 22/88 (25%), Gaps = 2/88 (2%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G P P PP P PP Sbjct: 51 PPPPGKPQGPPPQGGNQSQGPPPPPGKPEGRPPQGGNQSQGPPPHPGKPERPPPQGGNQS 110 Query: 761 XXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P PPPP P PP Sbjct: 111 QGKPQGPPQQEGNKPQGPPPPGKPQGPP 138 >BC117563-1|AAI17564.1| 582|Homo sapiens MAX binding protein protein. Length = 582 Score = 33.1 bits (72), Expect = 1.3 Identities = 23/90 (25%), Positives = 25/90 (27%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PP P PP P P P PL P + PPPP P Sbjct: 63 PPLPLSPPAPPPAPPPPLAT----PAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAP 118 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P G P P P P P Sbjct: 119 RQPALVGAPGLSIKEPAPLPSRPQVPTPAP 148 >BC044636-1|AAH44636.1| 520|Homo sapiens YLPM1 protein protein. Length = 520 Score = 33.1 bits (72), Expect = 1.3 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 6/92 (6%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP PP P P PP + P PPP P PP Sbjct: 362 PPPVLPPSLPPPVMP-PALPATVPPPGMPPPVMPPSLPTS--VPPPGMPPSLSSAGPPPV 418 Query: 762 XKPXXXXGGGXXXXXPPP------PPPXXXXP 839 P G PPP PPP P Sbjct: 419 LPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLP 450 Score = 32.3 bits (70), Expect = 2.3 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 7/93 (7%) Frame = +3 Query: 582 PPP--PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPP P PP P PPP+ P PPP P PP Sbjct: 345 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALP-ATVPPPGMPPPVMPPSLPTSVPP 403 Query: 756 XXXKPXXXXGGGXXXXXPPP-----PPPXXXXP 839 P G PP PPP P Sbjct: 404 PGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPP 436 >BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 33.1 bits (72), Expect = 1.3 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 6/96 (6%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPP--PPXXXXXPPXX-- 748 PPPP PPP + P P PPP PP PP Sbjct: 348 PPPPVPPPPPPP----ATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARA 403 Query: 749 PPXXXXTPXXX--GGGGAXXXXXPPPPPXXPPXXXP 850 P P G PPPPP PP P Sbjct: 404 APVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRP 439 >BC027460-1|AAH27460.2| 488|Homo sapiens CBLL1 protein protein. Length = 488 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP P PP TP PPP PP Sbjct: 341 PPPPPPPISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPP 384 >AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 33.1 bits (72), Expect = 1.3 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 6/96 (6%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPP--PPXXXXXPPXX-- 748 PPPP PPP + P P PPP PP PP Sbjct: 348 PPPPVPPPPPPP----ATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARA 403 Query: 749 PPXXXXTPXXX--GGGGAXXXXXPPPPPXXPPXXXP 850 P P G PPPPP PP P Sbjct: 404 APVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRP 439 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 33.1 bits (72), Expect = 1.3 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 3/88 (3%) Frame = +2 Query: 581 PPPPXXXXPP---PXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 PPPP PP P S P P P + PP PP PP P Sbjct: 113 PPPPTTRPPPIRPPFSHPLSAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPP----PPPPP 168 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXP 835 P P PPPPP P Sbjct: 169 PSPLPPP-------------PPPPPPTP 183 Score = 33.1 bits (72), Expect = 1.3 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P PP PP PP PP Sbjct: 113 PPPPTTRPPPIR-------PPFSHPLSAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPP 165 Query: 764 XTPXXXGGGGAXXXXXPPPPPXXPP 838 P PPPPP PP Sbjct: 166 PPPPSP---------LPPPPPPPPP 181 >AK091050-1|BAC03574.1| 723|Homo sapiens protein ( Homo sapiens cDNA FLJ33731 fis, clone BRAWH2017685, moderately similar to Mus musculus mRNA for nuclear protein ZAP. ). Length = 723 Score = 33.1 bits (72), Expect = 1.3 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 6/92 (6%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP PP P P PP + P PPP P PP Sbjct: 103 PPPVLPPSLPPPVMP-PALPATVPPPGMPPPVMPPSLPTS--VPPPGMPPSLSSAGPPPV 159 Query: 762 XKPXXXXGGGXXXXXPPP------PPPXXXXP 839 P G PPP PPP P Sbjct: 160 LPPPSLFSAGPPPVLPPPSLSSTAPPPVMPLP 191 Score = 32.3 bits (70), Expect = 2.3 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 7/93 (7%) Frame = +3 Query: 582 PPP--PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPP P PP P PPP+ P PPP P PP Sbjct: 86 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALP-ATVPPPGMPPPVMPPSLPTSVPP 144 Query: 756 XXXKPXXXXGGGXXXXXPPP-----PPPXXXXP 839 P G PP PPP P Sbjct: 145 PGMPPSLSSAGPPPVLPPPSLFSAGPPPVLPPP 177 >AK090435-1|BAC03416.1| 1766|Homo sapiens FLJ00353 protein protein. Length = 1766 Score = 33.1 bits (72), Expect = 1.3 Identities = 25/92 (27%), Positives = 26/92 (28%), Gaps = 6/92 (6%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 PPP PP P P PP + P PPP P PP Sbjct: 160 PPPVLPPSLPPPVMP-PALPATVPPPGMPPPVMPPSLPTS--VPPPGMPPSLSSAGPPPV 216 Query: 762 XKPXXXXGGGXXXXXPPP------PPPXXXXP 839 P G PPP PPP P Sbjct: 217 LPPPSLSSAGPPPVLPPPSLSSTAPPPVMPLP 248 Score = 32.3 bits (70), Expect = 2.3 Identities = 25/93 (26%), Positives = 26/93 (27%), Gaps = 7/93 (7%) Frame = +3 Query: 582 PPP--PSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPP P PP P PPP+ P PPP P PP Sbjct: 143 PPPFVPYSQMPPPLPTMPPPVLPPSLPPPVMPPALPATVPPP-GMPPPVMPPSLPTSVPP 201 Query: 756 XXXKPXXXXGGGXXXXXPPP-----PPPXXXXP 839 P G PP PPP P Sbjct: 202 PGMPPSLSSAGPPPVLPPPSLSSAGPPPVLPPP 234 >AK026762-1|BAB15544.1| 491|Homo sapiens protein ( Homo sapiens cDNA: FLJ23109 fis, clone LNG07754. ). Length = 491 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP P PP TP PPP PP Sbjct: 344 PPPPPPPISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPP 387 >AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. Length = 559 Score = 33.1 bits (72), Expect = 1.3 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 6/96 (6%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPP--PPXXXXXPPXX-- 748 PPPP PPP + P P PPP PP PP Sbjct: 348 PPPPVPPPPPPP----ATALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARA 403 Query: 749 PPXXXXTPXXX--GGGGAXXXXXPPPPPXXPPXXXP 850 P P G PPPPP PP P Sbjct: 404 APVCETVPVHPLPQGEVQGLPPPPPPPPLPPPGIRP 439 >AC002467-2|AAS07390.1| 491|Homo sapiens unknown protein. Length = 491 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP P PP TP PPP PP Sbjct: 344 PPPPPPPISHPMPHPPQAAGTPHLVYSQAPPPPMTSAPPPITPP 387 >Z96050-3|CAB09424.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >X89102-1|CAA61474.1| 281|Homo sapiens Fasligand protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >U11821-1|AAC50124.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >U08137-1|AAC50071.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >EF064739-1|ABK41922.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >D38122-1|BAA07320.1| 281|Homo sapiens Fas ligand protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >BC017502-1|AAH17502.1| 281|Homo sapiens Fas ligand (TNF superfamily, member 6) protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >AY858799-1|AAX49569.1| 281|Homo sapiens CD95 ligand protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >AY225406-1|AAO43991.1| 281|Homo sapiens FAS ligand protein. Length = 281 Score = 27.1 bits (57), Expect(2) = 1.5 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >AF288573-1|AAG60017.1| 127|Homo sapiens FasL isoform protein. Length = 127 Score = 27.1 bits (57), Expect(2) = 1.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 Query: 701 KXPPPPPXXXXXPPXXPP 754 + PPPPP PP PP Sbjct: 43 RRPPPPPPPPPLPPPPPP 60 Score = 24.6 bits (51), Expect(2) = 1.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 57 PPPPPPLPPLPLP 69 >Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for acrosin (EC 3.4.21.10). ). Length = 421 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P PP PP PP PP Sbjct: 302 PPPPTTRPPPIR-------PPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPP 354 Query: 764 XTPXXXGGGGAXXXXXPPPPPXXPP 838 P A PPPPP P Sbjct: 355 PPP-------ASPLPPPPPPPPPTP 372 >X99720-1|CAA68060.1| 491|Homo sapiens TPRC protein. Length = 491 Score = 32.7 bits (71), Expect = 1.7 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +3 Query: 609 PPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGG 788 P P P PPPL P + PPPP P PP P G Sbjct: 48 PALLPPPPQMLAPAFPPPLLL---PPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGV 104 Query: 789 GXXXXXPPPPP 821 G P P Sbjct: 105 GEGLGLGLPSP 115 >X97124-1|CAA65791.1| 491|Homo sapiens prcc protein. Length = 491 Score = 32.7 bits (71), Expect = 1.7 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +3 Query: 609 PPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGG 788 P P P PPPL P + PPPP P PP P G Sbjct: 48 PALLPPPPQMLAPAFPPPLLL---PPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGV 104 Query: 789 GXXXXXPPPPP 821 G P P Sbjct: 105 GEGLGLGLPSP 115 >X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. Length = 421 Score = 32.7 bits (71), Expect = 1.7 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P PP PP PP PP Sbjct: 302 PPPPTTRPPPIR-------PPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPP 354 Query: 764 XTPXXXGGGGAXXXXXPPPPPXXP 835 P + PPPPP P Sbjct: 355 PPP------ASPLPPPPPPPPPTP 372 >X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. Length = 421 Score = 32.7 bits (71), Expect = 1.7 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P PP PP PP PP Sbjct: 302 PPPPTTRPPPIR-------PPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPP 354 Query: 764 XTPXXXGGGGAXXXXXPPPPPXXP 835 P + PPPPP P Sbjct: 355 PPP------ASPLPPPPPPPPPTP 372 >M94077-1|AAA36181.1| 316|Homo sapiens loricrin protein. Length = 316 Score = 32.7 bits (71), Expect = 1.7 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGG G G GG G GGGG G G Sbjct: 33 GCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSG 92 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G GG GG Sbjct: 93 GGGSSGGGSGCFSSGGGGSGCFSSGG 118 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -2 Query: 820 GGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXX 641 GGGGG G GG G GGG G GGG Sbjct: 21 GGGGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG---- 76 Query: 640 XXXGXGXXXGGXXXXXGGGG 581 G G GG GGGG Sbjct: 77 -IGGCGGGSGGSVKYSGGGG 95 >M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. Length = 184 Score = 32.7 bits (71), Expect = 1.7 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P PP PP PP PP Sbjct: 65 PPPPTTRPPPIR-------PPFSHPISAHLPWYFQPPPRPLPPRPPAAQPPPPPSPPPPP 117 Query: 764 XTPXXXGGGGAXXXXXPPPPPXXP 835 P + PPPPP P Sbjct: 118 PPP------ASPLPPPPPPPPPTP 135 >M61120-1|AAA36180.1| 316|Homo sapiens loricrin protein. Length = 316 Score = 32.7 bits (71), Expect = 1.7 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGG G G GG G GGGG G G Sbjct: 33 GCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSG 92 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G GG GG Sbjct: 93 GGGSSGGGSGCFSSGGGGSGCFSSGG 118 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -2 Query: 820 GGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXX 641 GGGGG G GG G GGG G GGG Sbjct: 21 GGGGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG---- 76 Query: 640 XXXGXGXXXGGXXXXXGGGG 581 G G GG GGGG Sbjct: 77 -IGGCGGGSGGSVKYSGGGG 95 >K03205-1|AAA60186.1| 198|Homo sapiens PRB1 protein. Length = 198 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 1/87 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP G S P K PPP P PP Sbjct: 71 PPPPGKPQGPPPQGDKSRSPRS-----PPGKPQGPPPQGGKPQGPPPQGGNKPQGPPPPG 125 Query: 761 XXT-PXXXGGGGAXXXXXPPPPPXXPP 838 P GG + PP P PP Sbjct: 126 KPQGPPAQGGSKSQSARAPPGKPQGPP 152 Score = 31.5 bits (68), Expect = 4.0 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 2/91 (2%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P + P PP P P Sbjct: 49 GPPPPPGKPQGPPPQGGNKPQGPPPPGKP----QGPPPQGDKSRSPRSPP----GKPQGP 100 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPP--PXXPP 838 P P G PPPP P PP Sbjct: 101 PPQGGKPQGPPPQGGNKPQGPPPPGKPQGPP 131 >CR536555-1|CAG38792.1| 316|Homo sapiens LOR protein. Length = 316 Score = 32.7 bits (71), Expect = 1.7 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGG G G GG G GGGG G G Sbjct: 33 GCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSG 92 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G GG GG Sbjct: 93 GGGSSGGGSGCFSSGGGGSGCFSSGG 118 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -2 Query: 820 GGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXX 641 GGGGG G GG G GGG G GGG Sbjct: 21 GGGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG---- 76 Query: 640 XXXGXGXXXGGXXXXXGGGG 581 G G GG GGGG Sbjct: 77 -IGGCGGGSGGSVKYSGGGG 95 >CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. Length = 421 Score = 32.7 bits (71), Expect = 1.7 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P PP PP PP PP Sbjct: 302 PPPPTTRPPPIR-------PPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSPPPPP 354 Query: 764 XTPXXXGGGGAXXXXXPPPPPXXPP 838 P A PPPPP P Sbjct: 355 PPP-------ASPLPPPPPPPPPTP 372 >BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein protein. Length = 510 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPPS PP P PPP+ P P Sbjct: 355 GPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGP 414 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPP 824 P G PPPPPP Sbjct: 415 RPPLPPDRPSAGA-----PPPPPP 433 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP P P P PPPPP PP PP Sbjct: 266 PPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPP 323 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/80 (26%), Positives = 23/80 (28%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P P+P PPP + PPPP PP P Sbjct: 250 PPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNK----PPVPSTPRPSASS- 304 Query: 792 XXXXXPPPPPPXXXXPXXXP 851 PPPPPP P P Sbjct: 305 --QAPPPPPPPSRPGPPPLP 322 >BC111727-1|AAI11728.1| 1077|Homo sapiens transcription elongation regulator 1 protein. Length = 1077 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 5/98 (5%) Frame = +2 Query: 572 GXXPPP-PXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX 748 G PPP PPP P P PP PP PP Sbjct: 31 GPAPPPNAVMRGPPPLMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMG 90 Query: 749 PPXXXXTPXXXGGGGAXXXXXPPP----PPXXPPXXXP 850 PP P PPP PP PP P Sbjct: 91 PPHLQRPPFMP---PPMSSMPPPPGMMFPPGMPPVTAP 125 >BC096211-1|AAH96211.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 70 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQG 127 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 128 GNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPP 167 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 112 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQG 169 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 170 GNQSQGPPPRPGKPEGQPPQGGNQSQGPPPRPGKPEGPPP 209 Score = 31.5 bits (68), Expect = 4.0 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +1 Query: 655 PXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 P P P PPPP P PP NP PPPPP Sbjct: 241 PHPGKPQGPPPQEGNKPQRPPPPGRP---QGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 297 Query: 835 XPXXP 849 P P Sbjct: 298 RPHRP 302 Score = 30.7 bits (66), Expect = 7.0 Identities = 32/140 (22%), Positives = 34/140 (24%), Gaps = 10/140 (7%) Frame = +2 Query: 461 PPPXGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXXXXP---PPXXGXXS 631 PPP G + G G PPP P PP G S Sbjct: 51 PPPPGKPEGRPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGQPPQGGNQS 110 Query: 632 XXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX-------PPXXXXTPXXXGGG 790 P P + PPP P PP PP P Sbjct: 111 QGPPPR--PGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQ 168 Query: 791 GAXXXXXPPPPPXXPPXXXP 850 G PPP P P P Sbjct: 169 GGNQSQGPPPRPGKPEGQPP 188 Score = 30.7 bits (66), Expect = 7.0 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP P P P PPP P K PPP P PP Sbjct: 249 PPPQEGNKPQR--PPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGGRPHRPPQGQ 306 Query: 765 KP 770 P Sbjct: 307 PP 308 >BC096210-1|AAH96210.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 70 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQG 127 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 128 GNQSQGPPPRPGKPEGPPPQGGNQSQGPPPHPGKPEGPPP 167 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 112 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGKPEGPPPQGGNQSQGPPPHPGKPEGPPPQG 169 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 170 GNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPP 209 Score = 31.5 bits (68), Expect = 4.0 Identities = 25/95 (26%), Positives = 26/95 (27%), Gaps = 7/95 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 133 GPPPRPGKPEGPPPQGGNQSQGPPPH--PGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQG 190 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXP 835 PP P G PPP P P Sbjct: 191 GNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKP 225 Score = 31.5 bits (68), Expect = 4.0 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +1 Query: 655 PXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 P P P PPPP P PP NP PPPPP Sbjct: 241 PHPGKPQGPPPQEGNKPQRPPPPGRP---QGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 297 Query: 835 XPXXP 849 P P Sbjct: 298 RPHRP 302 Score = 30.7 bits (66), Expect = 7.0 Identities = 32/140 (22%), Positives = 34/140 (24%), Gaps = 10/140 (7%) Frame = +2 Query: 461 PPPXGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXXXXP---PPXXGXXS 631 PPP G + G G PPP P PP G S Sbjct: 51 PPPPGKPEGRPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGQPPQGGNQS 110 Query: 632 XXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX-------PPXXXXTPXXXGGG 790 P P + PPP P PP PP P Sbjct: 111 QGPPPR--PGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPHPGKPEGPPPQ 168 Query: 791 GAXXXXXPPPPPXXPPXXXP 850 G PPP P P P Sbjct: 169 GGNQSQGPPPRPGKPEGPPP 188 Score = 30.7 bits (66), Expect = 7.0 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP P P P PPP P K PPP P PP Sbjct: 249 PPPQEGNKPQR--PPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGGRPHRPPQGQ 306 Query: 765 KP 770 P Sbjct: 307 PP 308 >BC096209-1|AAH96209.1| 309|Homo sapiens PRB3 protein protein. Length = 309 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 70 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGKPEGQPPQGGNQSQGPPPRPGKPEGPPPQG 127 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 128 GNQSQGPPPRPGKPEGPPPQGGNQSQGPPPHPGKPEGPPP 167 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/100 (26%), Positives = 27/100 (27%), Gaps = 7/100 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 112 GPPPRPGKPEGPPPQGGNQSQGPPPR--PGKPEGPPPQGGNQSQGPPPHPGKPEGPPPQG 169 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 PP P G PPP P P P Sbjct: 170 GNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGPPP 209 Score = 31.5 bits (68), Expect = 4.0 Identities = 25/95 (26%), Positives = 26/95 (27%), Gaps = 7/95 (7%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX- 748 G P P PPP G S P P + PPP P PP Sbjct: 133 GPPPRPGKPEGPPPQGGNQSQGPPPH--PGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQG 190 Query: 749 ------PPXXXXTPXXXGGGGAXXXXXPPPPPXXP 835 PP P G PPP P P Sbjct: 191 GNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKP 225 Score = 31.5 bits (68), Expect = 4.0 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +1 Query: 655 PXPXXXXXXXPXXXXXXXXPPPPXPPXXXXXPPXXXXNPXXXRGGGXXXXXXPPPPPXXP 834 P P P PPPP P PP NP PPPPP Sbjct: 241 PHPGKPQGPPPQEGNKPQRPPPPGRP---QGPPPPGGNPQQPLPPPAGKPQGPPPPPQGG 297 Query: 835 XPXXP 849 P P Sbjct: 298 RPHRP 302 Score = 30.7 bits (66), Expect = 7.0 Identities = 32/140 (22%), Positives = 34/140 (24%), Gaps = 10/140 (7%) Frame = +2 Query: 461 PPPXGPXPXKXGXGAXXXXXXXXXXXXXXGXXXFXXXGXXPPPPXXXXP---PPXXGXXS 631 PPP G + G G PPP P PP G S Sbjct: 51 PPPPGKPEGRPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPRPGKPEGQPPQGGNQS 110 Query: 632 XXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX-------PPXXXXTPXXXGGG 790 P P + PPP P PP PP P Sbjct: 111 QGPPPR--PGKPEGPPPQGGNQSQGPPPRPGKPEGPPPQGGNQSQGPPPHPGKPEGPPPQ 168 Query: 791 GAXXXXXPPPPPXXPPXXXP 850 G PPP P P P Sbjct: 169 GGNQSQGPPPRPGKPEGPPP 188 Score = 30.7 bits (66), Expect = 7.0 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXX 764 PPP P P P PPP P K PPP P PP Sbjct: 249 PPPQEGNKPQR--PPPPGRPQGPPPPGGNPQQPLPPPAGKPQGPPPPPQGGRPHRPPQGQ 306 Query: 765 KP 770 P Sbjct: 307 PP 308 >BC010450-1|AAH10450.1| 491|Homo sapiens papillary renal cell carcinoma (translocation-associated) protein. Length = 491 Score = 32.7 bits (71), Expect = 1.7 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +3 Query: 609 PPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGG 788 P P P PPPL P + PPPP P PP P G Sbjct: 48 PALLPPPPQMLAPAFPPPLLL---PPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGV 104 Query: 789 GXXXXXPPPPP 821 G P P Sbjct: 105 GEGLGLGLPSP 115 >BC004913-1|AAH04913.1| 491|Homo sapiens papillary renal cell carcinoma (translocation-associated) protein. Length = 491 Score = 32.7 bits (71), Expect = 1.7 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +3 Query: 609 PPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGG 788 P P P PPPL P + PPPP P PP P G Sbjct: 48 PALLPPPPQMLAPAFPPPLLL---PPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGV 104 Query: 789 GXXXXXPPPPP 821 G P P Sbjct: 105 GEGLGLGLPSP 115 >AL590666-16|CAI16350.1| 491|Homo sapiens papillary renal cell carcinoma (translocation-associated) protein. Length = 491 Score = 32.7 bits (71), Expect = 1.7 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +3 Query: 609 PPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGG 788 P P P PPPL P + PPPP P PP P G Sbjct: 48 PALLPPPPQMLAPAFPPPLLL---PPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGV 104 Query: 789 GXXXXXPPPPP 821 G P P Sbjct: 105 GEGLGLGLPSP 115 >AL161636-5|CAI19560.1| 312|Homo sapiens loricrin protein. Length = 312 Score = 32.7 bits (71), Expect = 1.7 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGG G G GG G GGGG G G Sbjct: 33 GCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSG 92 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G GG GG Sbjct: 93 GGGSSGGGSGCFSSGGGGSGCFSSGG 118 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -2 Query: 820 GGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXX 641 GGGGG G GG G GGG G GGG Sbjct: 21 GGGGGGGGSGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG---- 76 Query: 640 XXXGXGXXXGGXXXXXGGGG 581 G G GG GGGG Sbjct: 77 -IGGCGGGSGGSVKYSGGGG 95 >AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 protein. Length = 2715 Score = 32.7 bits (71), Expect = 1.7 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXP 728 PPPS PP P P PPPL P + PPP P Sbjct: 418 PPPSTSPPPPLCPPPPPPVS---PPPLPSPPPPPAQEEQEESPPPVVP 462 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP P P P PPPL P PPPP PP Sbjct: 402 PPPPLTPPAPSPPPPLP-PPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPP 458 Score = 24.6 bits (51), Expect(2) = 6.0 Identities = 12/43 (27%), Positives = 12/43 (27%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXP 835 PP PP P PP P P PP P Sbjct: 551 PPKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTP 593 Score = 24.6 bits (51), Expect(2) = 6.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 619 PPPPPAPPPPPAP 631 >AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. Length = 2605 Score = 32.7 bits (71), Expect = 1.7 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXP 728 PPPS PP P P PPPL P + PPP P Sbjct: 308 PPPSTSPPPPLCPPPPPPVS---PPPLPSPPPPPAQEEQEESPPPVVP 352 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP P P P PPPL P PPPP PP Sbjct: 292 PPPPLTPPAPSPPPPLP-PPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPP 348 Score = 24.6 bits (51), Expect(2) = 6.0 Identities = 12/43 (27%), Positives = 12/43 (27%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXP 835 PP PP P PP P P PP P Sbjct: 441 PPKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTP 483 Score = 24.6 bits (51), Expect(2) = 6.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 509 PPPPPAPPPPPAP 521 >AF106062-1|AAD45972.1| 312|Homo sapiens Wiskott-Aldrich syndrome protein interacting protein protein. Length = 312 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPPS PP P PPP+ P P Sbjct: 164 GPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGP 223 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPP 824 P G PPPPPP Sbjct: 224 RPPLPPDRPSAGA-----PPPPPP 242 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP P P P PPPPP PP PP Sbjct: 75 PPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPP 132 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/80 (26%), Positives = 23/80 (28%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P P+P PPP + PPPP PP P Sbjct: 59 PPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNK----PPVPSTPRPSASS- 113 Query: 792 XXXXXPPPPPPXXXXPXXXP 851 PPPPPP P P Sbjct: 114 --QAPPPPPPPSRPGPPPLP 131 >AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protein protein. Length = 503 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPPS PP P PPP+ P P Sbjct: 355 GPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGP 414 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPP 824 P G PPPPPP Sbjct: 415 RPPLPPDRPSAGA-----PPPPPP 433 >AF017789-1|AAB80727.1| 1098|Homo sapiens putative transcription factor CA150 protein. Length = 1098 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 5/98 (5%) Frame = +2 Query: 572 GXXPPP-PXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX 748 G PPP PPP P P PP PP PP Sbjct: 31 GPAPPPNAVMRGPPPLMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMG 90 Query: 749 PPXXXXTPXXXGGGGAXXXXXPPP----PPXXPPXXXP 850 PP P PPP PP PP P Sbjct: 91 PPHLQRPPFMP---PPMSSMPPPPGMMFPPGMPPVTAP 125 >AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. Length = 503 Score = 32.7 bits (71), Expect = 1.7 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = +3 Query: 573 GXXPPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXP 752 G PPPPS PP P PPP+ P P Sbjct: 355 GPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGP 414 Query: 753 PXXXKPXXXXGGGXXXXXPPPPPP 824 P G PPPPPP Sbjct: 415 RPPLPPDRPSAGA-----PPPPPP 433 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/58 (27%), Positives = 16/58 (27%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPP 754 PPPP P P P PPPPP PP PP Sbjct: 266 PPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPP 323 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/80 (26%), Positives = 23/80 (28%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P P+P PPP + PPPP PP P Sbjct: 250 PPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNK----PPVPSTPRPSASS- 304 Query: 792 XXXXXPPPPPPXXXXPXXXP 851 PPPPPP P P Sbjct: 305 --QAPPPPPPPSRPGPPPLP 322 >AB209910-1|BAD93147.1| 1081|Homo sapiens transcription elongation regulator 1 variant protein. Length = 1081 Score = 32.7 bits (71), Expect = 1.7 Identities = 26/98 (26%), Positives = 26/98 (26%), Gaps = 5/98 (5%) Frame = +2 Query: 572 GXXPPP-PXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX 748 G PPP PPP P P PP PP PP Sbjct: 35 GPAPPPNAVMRGPPPLMRPPPPFGMMRGPPPPPRPPFGRPPFDPNMPPMPPPGGIPPPMG 94 Query: 749 PPXXXXTPXXXGGGGAXXXXXPPP----PPXXPPXXXP 850 PP P PPP PP PP P Sbjct: 95 PPHLQRPPFMP---PPMSSMPPPPGMMFPPGMPPVTAP 129 >AB013076-1|BAA25794.1| 338|Homo sapiens loricrin protein. Length = 338 Score = 32.7 bits (71), Expect = 1.7 Identities = 23/86 (26%), Positives = 23/86 (26%) Frame = -2 Query: 838 GXXXXGGGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRG 659 G GGGG G G GG G GGGG G G Sbjct: 33 GCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSG 92 Query: 658 GGXXXXXXXGXGXXXGGXXXXXGGGG 581 GG G GG GG Sbjct: 93 GGGSSGGGSGCFSSGGGGSGCFSSGG 118 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = -2 Query: 820 GGGGGXXXXXPPPXXXXGXXXXGGXXXXXXXGXGGGGXXFXXXXXXGXXXXXRGGGXXXX 641 GGGGG G GG G GGG G GGG Sbjct: 21 GGGGGGGGTGGGGCGFFGGGGSGGGSSGSGCGYSGGGGYSGGGCGGGSSGGGGGGG---- 76 Query: 640 XXXGXGXXXGGXXXXXGGGG 581 G G GG GGGG Sbjct: 77 -IGGCGGGSGGSVKYSGGGG 95 >AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. Length = 2415 Score = 32.7 bits (71), Expect = 1.7 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 585 PPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXP 728 PPPS PP P P PPPL P + PPP P Sbjct: 118 PPPSTSPPPPLCPPPPPPVS---PPPLPSPPPPPAQEEQEESPPPVVP 162 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPP 755 PPPP P P P PPPL P PPPP PP Sbjct: 102 PPPPLTPPAPSPPPPLP-PPSTSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPP 158 Score = 24.6 bits (51), Expect(2) = 6.1 Identities = 12/43 (27%), Positives = 12/43 (27%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXP 835 PP PP P PP P P PP P Sbjct: 251 PPKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTP 293 Score = 24.6 bits (51), Expect(2) = 6.1 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 319 PPPPPAPPPPPAP 331 >AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. Length = 830 Score = 26.6 bits (56), Expect(2) = 1.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPP 754 PPPPP PP PP Sbjct: 660 PPPPPPPPPPPPPPPP 675 Score = 24.6 bits (51), Expect(2) = 1.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 667 PPPPPPPPPPPPP 679 >AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens cDNA FLJ40628 fis, clone THYMU2014204, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN. ). Length = 209 Score = 26.6 bits (56), Expect(2) = 2.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPP 754 PPPPP PP PP Sbjct: 65 PPPPPPPPPPPPPPPP 80 Score = 24.6 bits (51), Expect(2) = 2.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 812 PPPPPXXPPXXXP 850 PPPPP PP P Sbjct: 72 PPPPPPPPPPPPP 84 >Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. Length = 1096 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >X63522-1|CAA45087.1| 533|Homo sapiens retinoic acid X receptor b protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc finger protein protein. Length = 2004 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPP 742 PPPP PPP P P P + PPPPP PP Sbjct: 1653 PPPPQQPQPPPPQ-----PQPAPQPPPPQQQPQQQPQPQPQQPPPPPPPQQQPP 1701 Score = 31.1 bits (67), Expect = 5.3 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXP 728 PPPP PP P P PPP + PPPP P Sbjct: 1652 PPPPPQQPQPPPPQPQP----APQPPPPQQQPQQQPQPQPQQPPPPPPP 1696 >M84820-1|AAA60293.1| 533|Homo sapiens retinoid X receptor beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPTLGGSGAPPPPPMPPPPLGSP 132 >BT007280-1|AAP35944.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >BC141917-1|AAI41918.1| 198|Homo sapiens PRB1 protein protein. Length = 198 Score = 32.3 bits (70), Expect = 2.3 Identities = 24/87 (27%), Positives = 25/87 (28%), Gaps = 1/87 (1%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXX-PPX 757 PPPP PP G S P K PPP P PP Sbjct: 71 PPPPGKPQGPPPQGDKSRSPRS-----PPGKPQGPPPQGGKPQGPPPQGGNKPQGPLPPG 125 Query: 758 XXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P GG + PP P PP Sbjct: 126 KPQGPPAQGGSKSQSARAPPGKPQGPP 152 Score = 30.7 bits (66), Expect = 7.0 Identities = 23/89 (25%), Positives = 24/89 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PPP PPP G P P + P PP PP P Sbjct: 49 GPPPPPGKPQGPPPQGGNKPQGPPPPGKP----QGPPPQGDKSRSPRSPPGKPQGPP--P 102 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 GG PP P PP Sbjct: 103 QGGKPQGPPPQGGNKPQGPLPPGKPQGPP 131 >BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. Length = 1103 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 556 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 609 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 610 -----PPPPPPLGGVP 620 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 562 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 617 Query: 761 XXTP 772 P Sbjct: 618 GVPP 621 >BC064990-1|AAH64990.1| 1147|Homo sapiens splicing factor, arginine/serine-rich 15 protein. Length = 1147 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 627 SPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXX 806 SP P P P + P P P PP P G Sbjct: 656 SPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGV 715 Query: 807 PPPPPP 824 PPPPPP Sbjct: 716 PPPPPP 721 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PP + P PP P PP Sbjct: 665 PVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGVPPPPPPPPF 724 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PP PPP P P Sbjct: 725 LRPGFNPMHLPPGFLPPGPPPPITPPVSIP 754 >BC052286-1|AAH52286.1| 1147|Homo sapiens splicing factor, arginine/serine-rich 15 protein. Length = 1147 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 627 SPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXX 806 SP P P P + P P P PP P G Sbjct: 656 SPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGV 715 Query: 807 PPPPPP 824 PPPPPP Sbjct: 716 PPPPPP 721 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PP + P PP P PP Sbjct: 665 PVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGVPPPPPPPPF 724 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PP PPP P P Sbjct: 725 LRPGFNPMHLPPGFLPPGPPPPITPPVSIP 754 >BC043353-1|AAH43353.1| 1146|Homo sapiens splicing factor, arginine/serine-rich 15 protein. Length = 1146 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 627 SPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXX 806 SP P P P + P P P PP P G Sbjct: 656 SPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGV 715 Query: 807 PPPPPP 824 PPPPPP Sbjct: 716 PPPPPP 721 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PP + P PP P PP Sbjct: 665 PVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGVPPPPPPPPF 724 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PP PPP P P Sbjct: 725 LRPGFNPMHLPPGFLPPGPPPPITPPVSIP 754 >BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. Length = 600 Score = 32.3 bits (70), Expect = 2.3 Identities = 23/90 (25%), Positives = 24/90 (26%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 P PP P + P P PPPPP P PP Sbjct: 67 PGPPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPAL-PSPPPLV 125 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 TP PPPPP P P Sbjct: 126 APTP----SSPPPPPLPPPPPPAMPSPPPP 151 Score = 32.3 bits (70), Expect = 2.3 Identities = 25/93 (26%), Positives = 25/93 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PP PPP P P P P PPP P P Sbjct: 82 GTPEPPLLEEKPPPTPPPAPTPQPQPPPPPP--------PPQPALPSPPPLVAPTPSSPP 133 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P P A PPPPP P P Sbjct: 134 PPPLPPPPPP----AMPSPPPPPPPAAAPLAAP 162 Score = 30.7 bits (66), Expect = 7.0 Identities = 23/89 (25%), Positives = 24/89 (26%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P P PPPP P PP Sbjct: 93 PPPT---PPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPL----PPPPPPAM 145 Query: 764 XTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 +P A PP P P P Sbjct: 146 PSPPPPPPPAAAPLAAPPEEPAAPSPEDP 174 >BC014921-1|AAH14921.1| 1147|Homo sapiens splicing factor, arginine/serine-rich 15 protein. Length = 1147 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 627 SPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXX 806 SP P P P + P P P PP P G Sbjct: 656 SPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGV 715 Query: 807 PPPPPP 824 PPPPPP Sbjct: 716 PPPPPP 721 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PP + P PP P PP Sbjct: 665 PVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGVPPPPPPPPF 724 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PP PPP P P Sbjct: 725 LRPGFNPMHLPPGFLPPGPPPPITPPVSIP 754 >BC001167-1|AAH01167.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 32.3 bits (70), Expect = 2.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPP PP PP TP G G P PP Sbjct: 929 PPPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPP 972 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 719 PXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P PP P TP PPPPP PP P Sbjct: 601 PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPP 644 >AL844527-9|CAI41836.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AL844527-8|CAI41837.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL662824-21|CAI17612.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AL662824-20|CAI17614.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AL645940-7|CAI18064.2| 537|Homo sapiens retinoid X receptor, beta protein. Length = 537 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AL645940-6|CAI18066.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL117417-1|CAB55911.1| 667|Homo sapiens hypothetical protein protein. Length = 667 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 627 SPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXX 806 SP P P P + P P P PP P G Sbjct: 467 SPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGV 526 Query: 807 PPPPPP 824 PPPPPP Sbjct: 527 PPPPPP 532 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PP + P PP P PP Sbjct: 476 PVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGVPPPPPPPPF 535 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PP PPP P P Sbjct: 536 LRPGFNPMHLPPGFLPPGPPPPITPPVSIP 565 >AL031228-14|CAI95622.1| 482|Homo sapiens retinoid X receptor, beta protein. Length = 482 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 37 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 81 >AL031228-13|CAA20239.1| 533|Homo sapiens retinoid X receptor, beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 32.3 bits (70), Expect = 2.3 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +3 Query: 612 PXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGG 791 P +P PPP P PPPP P PP P G Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPL----PPPPPPLPGMMGIPPPPPPPLLFGG-- 602 Query: 792 XXXXXPPPPPPXXXXP 839 PPPPPP P Sbjct: 603 -----PPPPPPLGGVP 613 Score = 30.7 bits (66), Expect = 7.0 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PP P PPP + P P P PPPPP PP PP Sbjct: 555 PPLPGVGPPPPPP---APPLPGGA-PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 761 XXTP 772 P Sbjct: 611 GVPP 614 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 32.3 bits (70), Expect = 2.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPP PP PP TP G G P PP Sbjct: 929 PPPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPP 972 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 719 PXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P PP P TP PPPPP PP P Sbjct: 601 PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPP 644 >AF120161-1|AAD13794.1| 533|Homo sapiens retinoic X receptor beta protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AF065396-1|AAC18599.1| 533|Homo sapiens retinoic X receptor B protein. Length = 533 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 88 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 132 >AF023142-1|AAD09327.1| 1157|Homo sapiens pre-mRNA splicing SR protein rA4 protein. Length = 1157 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 627 SPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXX 806 SP P P P + P P P PP P G Sbjct: 666 SPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGV 725 Query: 807 PPPPPP 824 PPPPPP Sbjct: 726 PPPPPP 731 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PP + P PP P PP Sbjct: 675 PVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGVPPPPPPPPF 734 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PP PPP P P Sbjct: 735 LRPGFNPMHLPPGFLPPGPPPPITPPVSIP 764 >AB209244-1|BAD92481.1| 577|Homo sapiens retinoid X receptor, beta variant protein. Length = 577 Score = 32.3 bits (70), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 707 PPPPPXXXXXP-PXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 P P P P P PP T GG GA PPPP P Sbjct: 128 PNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSP 172 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 32.3 bits (70), Expect = 2.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPP PP PP TP G G P PP Sbjct: 915 PPPPSPVPAPPPPPPPTASPTPDKSGSPGKKTSKTSSPGGKKPP 958 Score = 30.7 bits (66), Expect = 7.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 719 PXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P PP P TP PPPPP PP P Sbjct: 587 PYTSLVPPLSPQPKIVTPYTASQPSPPLPPPPPPPPPPPPPPPP 630 >AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. Length = 1217 Score = 32.3 bits (70), Expect = 2.3 Identities = 23/90 (25%), Positives = 24/90 (26%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 P PP P + P P PPPPP P PP Sbjct: 612 PGPPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPAL-PSPPPLV 670 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 TP PPPPP P P Sbjct: 671 APTP----SSPPPPPLPPPPPPAMPSPPPP 696 Score = 32.3 bits (70), Expect = 2.3 Identities = 25/93 (26%), Positives = 25/93 (26%) Frame = +2 Query: 572 GXXPPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXP 751 G PP PPP P P P P PPP P P Sbjct: 627 GTPEPPLLEEKPPPTPPPAPTPQPQPPPPPP--------PPQPALPSPPPLVAPTPSSPP 678 Query: 752 PXXXXTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 P P A PPPPP P P Sbjct: 679 PPPLPPPPPP----AMPSPPPPPPPAAAPLAAP 707 Score = 30.7 bits (66), Expect = 7.0 Identities = 23/89 (25%), Positives = 24/89 (26%) Frame = +2 Query: 584 PPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXXX 763 PPP PPP P P P PPPP P PP Sbjct: 638 PPPT---PPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPL----PPPPPPAM 690 Query: 764 XTPXXXGGGGAXXXXXPPPPPXXPPXXXP 850 +P A PP P P P Sbjct: 691 PSPPPPPPPAAAPLAAPPEEPAAPSPEDP 719 >AB032998-1|BAA86486.1| 929|Homo sapiens KIAA1172 protein protein. Length = 929 Score = 32.3 bits (70), Expect = 2.3 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 627 SPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXX 806 SP P P P + P P P PP P G Sbjct: 460 SPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGV 519 Query: 807 PPPPPP 824 PPPPPP Sbjct: 520 PPPPPP 525 Score = 30.7 bits (66), Expect = 7.0 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPPPPXPXXXXXXXPPXX 761 P PP P P PP + P PP P PP Sbjct: 469 PVPPIPVPAPITVPPPQVPPHQPGPPVVGALQPPAFTPPLGIPPPGFGPGVPPPPPPPPF 528 Query: 762 XKPXXXXGGGXXXXXPPPPPPXXXXPXXXP 851 +P PP PPP P P Sbjct: 529 LRPGFNPMHLPPGFLPPGPPPPITPPVSIP 558 >AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 protein. Length = 889 Score = 26.2 bits (55), Expect(2) = 2.3 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXGPXP 484 P P P PP+ PPP P P Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAP 43 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXP 664 PPPP PPP G P P Sbjct: 35 PPPPPPPAPPPGPGPAPPQHPPRAEALP 62 >AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activated cation channel HCN2 protein. Length = 889 Score = 26.2 bits (55), Expect(2) = 2.3 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 419 PXPXPXFFPPKXXXPPPXGPXP 484 P P P PP+ PPP P P Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAP 43 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXP 664 PPPP PPP G P P Sbjct: 35 PPPPPPPAPPPGPGPAPPQHPPRAEALP 62 >Z29074-1|CAA82315.1| 623|Homo sapiens cytokeratin 9 protein. Length = 623 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = -3 Query: 849 GXXXGGXXGGGGGXXXXXAPPPPXXXGVXXXXGGXXGGXXXXXGGGGGXXXXXXXXXXXX 670 G GG GGG G G GG GG GG GG Sbjct: 523 GSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGS 582 Query: 669 XXGXGXXXXGXXKEXXPXXGGGXXXXGGGG 580 G G E GGG G GG Sbjct: 583 GGSHGGGS-GFGGESGGSYGGGEEASGSGG 611 >X75015-1|CAA52924.1| 622|Homo sapiens keratin 9 protein. Length = 622 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = -3 Query: 849 GXXXGGXXGGGGGXXXXXAPPPPXXXGVXXXXGGXXGGXXXXXGGGGGXXXXXXXXXXXX 670 G GG GGG G G GG GG GG GG Sbjct: 522 GSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGS 581 Query: 669 XXGXGXXXXGXXKEXXPXXGGGXXXXGGGG 580 G G E GGG G GG Sbjct: 582 GGSHGGGS-GFGGESGGSYGGGEEASGSGG 610 >U94832-1|AAB53222.1| 711|Homo sapiens KSRP protein. Length = 711 Score = 31.9 bits (69), Expect = 3.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 825 GGGGGXXXXXAPPPPXXXGVXXXXGGXXGGXXXXXGGGGG 706 GGGGG PPP G GG G G GG Sbjct: 18 GGGGGAGGAGGGPPPGPPGAGDRGGGGPCGGGPGGGSAGG 57 >S69510-1|AAC60619.1| 622|Homo sapiens cytokeratin 9 protein. Length = 622 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = -3 Query: 849 GXXXGGXXGGGGGXXXXXAPPPPXXXGVXXXXGGXXGGXXXXXGGGGGXXXXXXXXXXXX 670 G GG GGG G G GG GG GG GG Sbjct: 522 GSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGS 581 Query: 669 XXGXGXXXXGXXKEXXPXXGGGXXXXGGGG 580 G G E GGG G GG Sbjct: 582 GGSHGGGS-GFGGESGGSYGGGEEASGSGG 610 >L21990-1|AAA60301.1| 464|Homo sapiens spiceosomal protein protein. Length = 464 Score = 31.9 bits (69), Expect = 3.0 Identities = 21/86 (24%), Positives = 21/86 (24%) Frame = +2 Query: 581 PPPPXXXXPPPXXGXXSXXXPXXXXPXPXXXXXXXXXXXXKXPPPPPXXXXXPPXXPPXX 760 PPPP PP P P P PP P PP Sbjct: 233 PPPPLMNGLPPRPPLPESLPPPPPGGLPLPPMPPTGPAPSGPPGPPQLPPPAPGVHPPAP 292 Query: 761 XXTPXXXGGGGAXXXXXPPPPPXXPP 838 P G PP P PP Sbjct: 293 VVHPPASGVHPPAPGVHPPAPGVHPP 318 >BX649186-1|CAE46204.1| 669|Homo sapiens hypothetical protein protein. Length = 669 Score = 31.9 bits (69), Expect = 3.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXXPPPPPP 824 PPPP P PP P G P PPPP Sbjct: 577 PPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPP 614 >BX284695-2|CAI17373.1| 1461|Homo sapiens KIAA0460 protein. Length = 1461 Score = 31.9 bits (69), Expect = 3.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP P P P G PPP PP Sbjct: 1255 PPPPPGEHSGIPFPTPPPPPPPGEHSSSGGSGVPFSTPPPPPPP 1298 >BX284695-1|CAI17374.1| 1435|Homo sapiens KIAA0460 protein. Length = 1435 Score = 31.9 bits (69), Expect = 3.0 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 707 PPPPPXXXXXPPXXPPXXXXTPXXXGGGGAXXXXXPPPPPXXPP 838 PPPPP P P P G PPP PP Sbjct: 1229 PPPPPGEHSGIPFPTPPPPPPPGEHSSSGGSGVPFSTPPPPPPP 1272 >BC121170-1|AAI21171.1| 467|Homo sapiens KRT9 protein protein. Length = 467 Score = 31.9 bits (69), Expect = 3.0 Identities = 25/90 (27%), Positives = 25/90 (27%) Frame = -3 Query: 849 GXXXGGXXGGGGGXXXXXAPPPPXXXGVXXXXGGXXGGXXXXXGGGGGXXXXXXXXXXXX 670 G GG GGG G G GG GG GG GG Sbjct: 367 GSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGS 426 Query: 669 XXGXGXXXXGXXKEXXPXXGGGXXXXGGGG 580 G G E GGG G GG Sbjct: 427 GGSHGGGS-GFGGESGGSYGGGEEASGSGG 455 >BC111697-1|AAI11698.1| 983|Homo sapiens RBM26 protein protein. Length = 983 Score = 31.9 bits (69), Expect = 3.0 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Frame = +3 Query: 582 PPPPSXXXXPPXXXPSPXXXXXXXPPPLXXXXXPXXXXXXKXXPP-PPXPXXXXXXXPPX 758 PPPP PP P P PPP P PP PP P Sbjct: 341 PPPPGLPPPPPILTPPPVNLRPPVPPP--GPLPPSLPPVTGPPPPLPPLQPSGMDAPPNS 398 Query: 759 XXKPXXXXGGGXXXXXPPPPPP 824 PPP PP Sbjct: 399 ATSSVPTVVTTGIHHQPPPAPP 420 >BC068504-1|AAH68504.1| 849|Homo sapiens diaphanous homolog 3 (Drosophila) protein. Length = 849 Score = 31.9 bits (69), Expect = 3.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 711 PPPPXPXXXXXXXPPXXXKPXXXXGGGXXXXXPPPPPP 824 PPPP P PP P G P PPPP Sbjct: 314 PPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPP 351 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,269,499 Number of Sequences: 237096 Number of extensions: 3774996 Number of successful extensions: 46333 Number of sequences better than 10.0: 386 Number of HSP's better than 10.0 without gapping: 6043 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23833 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10816958492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -