BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F18 (964 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 39 0.007 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.037 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 36 0.037 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 36 0.037 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.049 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.065 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.065 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 33 0.46 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 33 0.46 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 33 0.46 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 33 0.46 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 32 0.60 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 32 0.60 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 32 0.80 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 31 1.1 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 31 1.1 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 31 1.1 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.1 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 31 1.8 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 31 1.8 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 31 1.8 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 31 1.8 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 31 1.8 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 30 2.4 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 30 2.4 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 30 3.2 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 30 3.2 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 4.2 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 29 4.2 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 4.2 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 29 4.2 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 29 4.2 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 29 5.6 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 29 5.6 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 29 5.6 SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 7.4 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 29 7.4 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 28 9.8 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 28 9.8 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 28 9.8 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 28 9.8 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 28 9.8 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 9.8 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 SPP P P + A P P PP PPP PP P PP Sbjct: 49 SPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPA 108 Query: 650 P 652 P Sbjct: 109 P 109 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P A A P PG PP PPP PP G P PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P P PPTP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PPP PP P P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 569 GXXPPXPPPXTXXPPNPGHQPXXXPP 646 G PP PPP PP P P PP Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPP 486 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P +P PP PPP PP P P PP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 35.9 bits (79), Expect = 0.049 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P + P S P P PP PPP PP P P PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P PP P +P P P PP PPP PP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Query: 638 XPPTP 652 PP P Sbjct: 427 PPPPP 431 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPTP 652 PP PPP PP+P P PP+P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSP 389 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 563 TPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 +P PP PPP PP P P PP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P PP P P P P PP PPP PP P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 638 XPP 646 PP Sbjct: 430 PPP 432 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP P P P PP P Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PP PP P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP P P PP P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP + PP P P PP P Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 512 GXRNPXTSXAQARXHPXTPGXXPPXPPPXTX-XPPNPGHQPXXXPPTP 652 G +P TS +Q P P PP PPP P+P P PP+P Sbjct: 191 GTSHP-TSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 500 TXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 T G G NP P P P PPP T PP P PP P Sbjct: 338 TSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/65 (29%), Positives = 21/65 (32%) Frame = +2 Query: 455 DPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPX 634 +P PP P P P P PP PPP T PP P P Sbjct: 353 NPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP-PPPPPT 411 Query: 635 XXPPT 649 PP+ Sbjct: 412 NGPPS 416 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP T PP P PP P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP T PP P PP P Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPG 622 PP P P P P PP PPP T PP+ G Sbjct: 369 PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEG 418 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P T G PP PP PP P PP P Sbjct: 379 PPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/60 (26%), Positives = 17/60 (28%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P P + P P P PPP P P P PP P Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P P P TP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP P P T PP P P P Sbjct: 691 PPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/66 (28%), Positives = 21/66 (31%) Frame = +2 Query: 455 DPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPX 634 +P PP P P + P P PP PPP PPNP Sbjct: 113 NPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNA 172 Query: 635 XXPPTP 652 PP P Sbjct: 173 PYPPPP 178 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/63 (30%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXP---PXPPPXTXXPPNPGHQPXXXP 643 PP P + P +P P P P PPP PPNP + P P Sbjct: 134 PPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Query: 644 PTP 652 P P Sbjct: 194 PYP 196 Score = 35.5 bits (78), Expect = 0.065 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P NP A P P PP PPP P P + P PP P Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTX-XPPNPGHQPXXXPPTP 652 P P PP PPP PPNP + P P P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYP 125 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 557 PXTPGXXPPXPPP---XTXXPPNPGHQPXXXPPTP 652 P P PP PPP PPNP + P P P Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNP 220 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 557 PXTPGXXPPXPPPXT---XXPPNPGHQPXXXPPTP 652 P P PP PPP PPNP + P P P Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP P P PPN + P PP P Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/64 (28%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPP-PXTXXPPNPGHQPX 634 P PP P NP +P P P PP P PPN + P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPY 222 Query: 635 XXPP 646 PP Sbjct: 223 PPPP 226 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 6/38 (15%) Frame = +2 Query: 557 PXTPGXXPPXPPPXT------XXPPNPGHQPXXXPPTP 652 P P PP PPP PPN + P PP P Sbjct: 202 PNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 512 GXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 G NP T+ P P PP PP T P P P PPTP Sbjct: 1005 GPTNPGTTTNVPDPLPTDPPTEPPTDPP-TPPPTEPPTPPPTEPPTP 1050 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 P P PP PPP T P P +P PPT Sbjct: 1024 PTEPPTDPPTPPP-TEPPTPPPTEPPTPPPT 1053 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXX-PPXPPPXTXXPPNPGHQPXXXPPTP 652 P G P A P PG PP PPP P PG PP P Sbjct: 924 PPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/63 (26%), Positives = 17/63 (26%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P PP G P P G PP PPP P P P Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Query: 638 XPP 646 PP Sbjct: 991 PPP 993 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG GG Sbjct: 130 DDGGGGGGGGGGGGGGGGGGGGGGGG 155 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG GG Sbjct: 131 DGGGGGGGGGGGGGGGGGGGGGGGGG 156 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGG 157 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGG 158 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGG 159 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 146 GGGGGGGGGGGGGGGGGGGGGDG 168 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 563 TPGXXPPXPPPXTXXPP--NPGHQPXXXPPTP 652 TP PP PPP PP P P PP P Sbjct: 549 TPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPP 580 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG GG Sbjct: 51 DDGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG GG Sbjct: 52 DGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 57 GGGGGGGGGGGGGGGGGGGGGDG 79 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PPP + P P P PPTP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPTP 652 PP PPP PP+ P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP 1181 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P + A P P PP PPP PP P PP P Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 PP P T G P A P P PPP PP P P PP Sbjct: 152 PPPPPIAPATGGPPPPPPIAPAATVPA-PAVPLAAASPPPPSGGPPPPPPPPPPPPPP 208 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG GG Sbjct: 846 DGGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGG 797 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGG 799 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGG 805 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 851 GGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 852 GGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 853 GGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXG 793 D G GGG GG G GGGG G Sbjct: 778 DGGGGGDGGGGGGGGGGGGGGGGGG 802 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG G G GGGG GG Sbjct: 832 DGGGFGDGGGYADGDGGGGGGGGGGG 857 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 32.3 bits (70), Expect = 0.60 Identities = 20/66 (30%), Positives = 22/66 (33%) Frame = +2 Query: 455 DPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPX 634 +P PP T P T + R P P P P P T PP P P Sbjct: 917 EPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPP--LPP 974 Query: 635 XXPPTP 652 PP P Sbjct: 975 LPPPPP 980 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG GG Sbjct: 658 DGGDGGGGGGGGGGGGGGGGGGGGGG 683 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG GG Sbjct: 661 DGGGGGGGGGGGGGGGGGGGGGGGGG 686 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG GG Sbjct: 655 DYGDGGDGGGGGGGGGGGGGGGGGGG 680 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGG 687 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGG 688 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGG 689 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGG 690 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGG 692 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 681 GGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG G Sbjct: 680 GGGGGGGGGGGGGGGGGGGGGGAG 703 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 519 GIXXXPXPRPGXTPXPRGXXPPXHHLXPKXPRTRGTNPXXXXPP 650 G+ P P G P PRG PP P P RG P PP Sbjct: 464 GMRGMPPPPMGMYPPPRGFPPPP--FGPPPPFYRGPPPPRGMPP 505 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/60 (26%), Positives = 21/60 (35%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P + R ++P +P P PP PP P P PP+P Sbjct: 300 PPSPPRYPPSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSP 359 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 31 GGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG GGGG GG Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGG 48 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 864 PGXXXXGGGXRXXGGXGXGGGGXGG 790 PG GGG GG G GGGG G Sbjct: 486 PGGFGGGGGASGGGGGGGGGGGFSG 510 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPTP 652 PP PPP + PP P + PP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLP 535 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXP-PXPPPXTXXPPNP-GHQPXXXPP 646 PP P G P A P P P P PPP PP+ G+ P PP Sbjct: 339 PPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P RG P S A P P PPP + P PP P Sbjct: 290 PPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/51 (29%), Positives = 18/51 (35%) Frame = +2 Query: 500 TXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 T G + P A P + G PP P + PP P PP P Sbjct: 280 TASLGIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPP 330 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/61 (27%), Positives = 20/61 (32%), Gaps = 1/61 (1%) Frame = +2 Query: 473 PPRXXXXPXTXGR-GXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 P R P R G P +++ P P P PP PP G PP Sbjct: 309 PSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 368 Query: 650 P 652 P Sbjct: 369 P 369 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P P R P RG P S A P PP PPP PP P Sbjct: 326 PPPPPPSRSSQRPPPPSRGAP-PPPSMGMAPP-PVGGAAPPPPPPPPVGGPPPPPPPIEG 383 Query: 638 XPPT 649 PP+ Sbjct: 384 RPPS 387 Score = 28.3 bits (60), Expect = 9.8 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPX------PPPXTXXPPNPGHQPXXXPPTP 652 P G P S + R P + G PP PP PP P P PP P Sbjct: 319 PARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPP 377 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 8/60 (13%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTP-----GXXPPXPPPXTXXP---PNPGHQPXXXPPT 649 P + G R+ + + ++ HP P PP PPP + P + G QP PPT Sbjct: 248 PPSPTLGLRDKHLASSSSKGHPPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPT 307 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 569 GXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 G PP PPP PP P +P P P Sbjct: 298 GFQPPPPPPTDFAPPPPPPEPTSELPPP 325 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 864 PGXXXXGGGXRXXGGXGXGGGGXGG 790 PG GGG GG G GGGG G Sbjct: 225 PGGFGGGGGVWGNGGGGGGGGGYSG 249 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGG 103 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG G G GGGG GG Sbjct: 79 DGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGG 105 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/62 (30%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXX--PPXPPPXTXXPPNPGHQPXXXP 643 +P R P G P AR P P PP PP PP+ G P P Sbjct: 2132 APARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPS-GPPPMGAP 2190 Query: 644 PT 649 P+ Sbjct: 2191 PS 2192 Score = 28.7 bits (61), Expect = 7.4 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 1/69 (1%) Frame = +2 Query: 443 SXCGDPXXXSPPRXXXX-PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNP 619 S G P P R P G P A P P PP PP PP+ Sbjct: 2146 SRYGPPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPP--PMGAPPSGPPPMGTPPS- 2202 Query: 620 GHQPXXXPP 646 GH P PP Sbjct: 2203 GHPPMGAPP 2211 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGGCXR 781 D G GGG G G GGGG GG R Sbjct: 87 DGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 62 GGGGGGGGGGGGGGGGGGG 80 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 63 GGGGGGGGGGGGGGGGGGG 81 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 64 GGGGGGGGGGGGGGGGGGG 82 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 65 GGGGGGGGGGGGGGGGGGG 83 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGGG G Sbjct: 61 DGGGGGGGGGGGGGGGGGGGGGGDDG 86 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGG 799 D G GGG GG G GGGG Sbjct: 60 DDGGGGGGGGGGGGGGGGGGGGG 82 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGG 108 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 98 GGGFGGGGGGGFGGGGGGGGGFGG 121 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GG G GG Sbjct: 187 GGGGYGGGGYGGGGGGYGGSGYGG 210 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPP--XTXXPPNPGHQP 631 P SPP P R P + A P P P PPP P NP H P Sbjct: 1044 PRKPSPP-PSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAH-P 1101 Query: 632 XXXPP 646 PP Sbjct: 1102 TEPPP 1106 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 557 PXTPGXXPPXPP-PXTXXPPNPGHQPXXXPPTP 652 P TP PP PP P T P P P PPTP Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPP--TPRPGPPTP 1385 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGGCXR 781 GGG GG G GGGG GG R Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGR 535 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GG R GG G GGGG GG Sbjct: 337 GGSGRGGGGGGGGGGGGGG 355 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 344 GGGGGGGGGGGGGGGGRGG 362 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGG 359 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 509 RGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNP 619 RG + + R P P PP PPP PP P Sbjct: 848 RGRGRGRSRYRRPRPRPRRPPPPPPPPPPPPPPPPPP 884 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 548 RXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 R HP P P PP PP P P P P Sbjct: 167 RQHPSYPPTQPFYPPTQPFYPPTPSSYPPTQPSYP 201 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 41 GGGGGGGGGGGGGGGGGGG 59 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 308 GGGGGDGGGGGGGGGGGGG 326 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGG 326 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 321 GGGGGGGGGGGGGGGGGGG 339 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +2 Query: 452 GDPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQP 631 G P PP P G P P PP PP P PG Q Sbjct: 146 GPPGDVGPPGNPGGPGLQGNHGNPAGIQGPNGLPGPNGP-LGPPGPPGDMGPPGLPGPQG 204 Query: 632 XXXPPTP 652 PP P Sbjct: 205 PQMPPGP 211 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPP 646 PP PPP PP PG PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPP 51 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P GR P + P PG P P P P H+P P P Sbjct: 326 PYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 378 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P GR P + P PG P P P P H+P P P Sbjct: 333 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEP 385 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P GR P + P PG P P P P H+P P P Sbjct: 319 PHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 371 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/57 (26%), Positives = 17/57 (29%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXP 643 P P GR P + P PG P P P P H+P P Sbjct: 340 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNP 619 P PG PP PPP PP P Sbjct: 204 PGFPGGAPPPPPPPFGAPPPP 224 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 Query: 533 SXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 S A A + +P P PPP P PG P PP Sbjct: 179 SSAMAAANKPSPMAGMPPPPPPPPPPGFPGGAPPPPPP 216 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG G GGGG G Sbjct: 756 GGGYRGGGGYGGGGGGYRG 774 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P GR P + P PG P P P P H+P P P Sbjct: 92 PYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 144 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P GR P + P PG P P P P H+P P P Sbjct: 99 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEP 151 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P GR P + P PG P P P P H+P P P Sbjct: 85 PHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 137 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/57 (26%), Positives = 17/57 (29%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXP 643 P P GR P + P PG P P P P H+P P Sbjct: 106 PHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG G GGG GG Sbjct: 316 GGGYRSGGGGGYGGGRGGG 334 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGGCXR 781 GGG GG GGGG GG R Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSR 113 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 D G GGG GG G GGG GG Sbjct: 161 DGGDDGDGGGDDDDGGDGDGGGDDGG 186 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P P PPP PP P P P P Sbjct: 761 PPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPT 649 PP PPP P PG+ P PPT Sbjct: 174 PPQPPPQAY--PQPGYPPQGYPPT 195 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSG 491 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 530 TSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 T+ A P TP P P T P P P PTP Sbjct: 67 TTPTPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTP 107 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 566 PGXXPPXPPPXTXX---PPNPGHQPXXXPPTP 652 P PP PPP T PP GH PP P Sbjct: 276 PTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPP 307 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG G GGG GG Sbjct: 93 GGGRRERGGRGGGGGYGGG 111 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG GGGG GG Sbjct: 105 GGGYGGGGGYGGGGRSYGGGGGGG 128 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG GGGG GG Sbjct: 153 GGGGRRGGGGCCGGGGGGG 171 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG GGGG GG Sbjct: 154 GGGRRGGGGCCGGGGGGGG 172 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 29.1 bits (62), Expect = 5.6 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 452 GDPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQP 631 G P PP P G +P A HP P PP P PP HQ Sbjct: 445 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGA-PHPRVP---PPGAPHPRVPPPGAPHQR 500 Query: 632 XXXPPTP 652 P P Sbjct: 501 VPPPGAP 507 Score = 28.7 bits (61), Expect = 7.4 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +2 Query: 452 GDPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQP 631 G P PP P G +P A HP P PP P PP H Sbjct: 525 GAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAS-HPRVP---PPGAPHPRVPPPGAPHPR 580 Query: 632 XXXPPTP 652 P TP Sbjct: 581 VPPPGTP 587 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG GGGG GG Sbjct: 70 GGGGRRGGGGCCGGGGGGG 88 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG GGGG GG Sbjct: 71 GGGRRGGGGCCGGGGGGGG 89 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG GGGG GG Sbjct: 153 GGGGRRGGGGCCGGGGGGG 171 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG R GG GGGG GG Sbjct: 154 GGGRRGGGGCCGGGGGGGG 172 >SB_53344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/59 (28%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTX-GRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQP 631 P +PP P GRG S P PP + PP PGH P Sbjct: 767 PAGMTPPPTSTSPSGWQGRGRYPSQPSPTDVLPPTLPQAPYPGGPPSMSGMPPPPGHSP 825 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXP-PNPGHQPX-XXPPT 649 P PG P PPP PN GH P PPT Sbjct: 218 PGGPGMPPGGPPPFPPTSDPNMGHHPPISGPPT 250 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/59 (23%), Positives = 17/59 (28%) Frame = +2 Query: 476 PRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P + P + P TP P P PP P + PP P Sbjct: 227 PHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNP 285 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 843 GGXRXXGGXGXGGGGXGGC 787 GG GG G GGGG G C Sbjct: 300 GGSGGAGGVGGGGGGTGSC 318 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/68 (26%), Positives = 25/68 (36%), Gaps = 4/68 (5%) Frame = +2 Query: 452 GDPXXXSPPRXXXXPXTXGRGX--RNPXTSXAQARXHPXTP--GXXPPXPPPXTXXPPNP 619 GDP PP P + ++ ++ A HP + P PPP T PP+ Sbjct: 190 GDPGAPEPPEPDNPPASPPMASLSQDRHSASGNAVTHPTSQENSYTGPPPPPYTSLPPDD 249 Query: 620 GHQPXXXP 643 P P Sbjct: 250 PPPPYDEP 257 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 1794 GGEGMGGGGMAGGGGGMGGGGGG 1816 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 1801 GGMAGGGGGMGGGGGGMGGGGEG 1823 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG GGGG GG Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGG 1782 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGG GG Sbjct: 151 GGRGRGGGEGGWGGRGGNGGGRGG 174 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPTP 652 PP PPP PP P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 Query: 518 RNPXTSXAQARXHPXTPGXXPPXPPPXTXXPP 613 R+P S + R TP P PPP PP Sbjct: 797 RSPWASHREERKRRHTPHEDSPPPPPPPPPPP 828 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 563 TPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 TP PP PP PP PG Q PP P Sbjct: 655 TPEAGPPPPP-----PPPPGGQAGGAPPPP 679 >SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 775 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 563 TPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 TP P PP T PNP + P PP Sbjct: 461 TPCYGPSAQPPATALVPNPCYVPSAQPP 488 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PP T PP P P P P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PP T PP P P P P Sbjct: 194 PPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGGCXR 781 GGG GG GGGG GG R Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSR 204 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG G G GGGG GG Sbjct: 71 GDDDDGGGISGCGDGGGGGGGAGG 94 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/35 (37%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 554 HPXTPGXXPPXPPPXT--XXPPNPGHQPXXXPPTP 652 +P P P PPP PP P P PP P Sbjct: 214 NPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 542 QARXHPXTPGXX-PPXPPPXTXXPPNPGHQPXXXPPTP 652 QA P P PP P P T PP P PPTP Sbjct: 231 QASLLPLIPNTSIPPTPTPHTSIPPTPTPH-TSIPPTP 267 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 28.3 bits (60), Expect = 9.8 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +2 Query: 452 GDPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGX---XPPXPPPXTXXPPNPG 622 G P + P G+G P Q P PG PP P PP PG Sbjct: 535 GPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGG-PPPPGAGQGGPPPPGAGQEGPPPPG 593 Query: 623 HQPXXXPPTP 652 PP P Sbjct: 594 AGQGGGPPPP 603 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PG P P P PP P PP P Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPP 212 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,479,982 Number of Sequences: 59808 Number of extensions: 108444 Number of successful extensions: 2170 Number of sequences better than 10.0: 75 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1497 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2836293838 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -