BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F18 (964 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 41 0.001 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 39 0.006 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 36 0.053 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 36 0.053 At5g38560.1 68418.m04662 protein kinase family protein contains ... 35 0.093 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 34 0.16 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 34 0.16 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 33 0.21 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 33 0.21 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 33 0.21 At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro... 33 0.28 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 33 0.28 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 33 0.28 At1g10620.1 68414.m01204 protein kinase family protein contains ... 33 0.28 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 33 0.37 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 33 0.37 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 33 0.37 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 32 0.49 At1g70990.1 68414.m08190 proline-rich family protein 32 0.49 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 32 0.49 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 32 0.65 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 32 0.65 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 0.86 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 31 0.86 At2g30560.1 68415.m03722 glycine-rich protein 31 0.86 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 31 0.86 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 31 0.86 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 31 0.86 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 31 1.1 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 31 1.1 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 31 1.1 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 31 1.1 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 31 1.1 At1g27710.1 68414.m03387 glycine-rich protein 31 1.1 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 31 1.5 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 31 1.5 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 31 1.5 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 31 1.5 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 31 1.5 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 1.5 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 1.5 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 31 1.5 At1g75550.1 68414.m08780 glycine-rich protein 31 1.5 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 1.5 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 30 2.0 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 30 2.0 At1g29380.1 68414.m03592 hypothetical protein 30 2.0 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 30 2.0 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 30 2.6 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 30 2.6 At4g18570.1 68417.m02749 proline-rich family protein common fami... 30 2.6 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 30 2.6 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 2.6 At4g08230.1 68417.m01358 glycine-rich protein 30 2.6 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 30 2.6 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 30 2.6 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 30 2.6 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 30 2.6 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 30 2.6 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 30 2.6 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 30 2.6 At1g53625.1 68414.m06096 expressed protein 30 2.6 At1g26150.1 68414.m03192 protein kinase family protein similar t... 30 2.6 At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family... 30 2.6 At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family... 30 2.6 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 29 3.5 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 29 3.5 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 3.5 At4g33660.1 68417.m04781 expressed protein 29 3.5 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 3.5 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 29 3.5 At1g35617.1 68414.m04424 hypothetical protein 29 3.5 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 4.6 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 29 4.6 At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family... 29 4.6 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 29 4.6 At1g15840.1 68414.m01901 expressed protein 29 4.6 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 29 4.6 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 29 4.6 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 29 6.1 At4g21720.1 68417.m03145 expressed protein 29 6.1 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 29 6.1 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 29 6.1 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 29 6.1 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 29 6.1 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 29 6.1 At1g62240.1 68414.m07021 expressed protein 29 6.1 At1g61080.1 68414.m06877 proline-rich family protein 29 6.1 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 29 6.1 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 28 8.0 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 28 8.0 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 28 8.0 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 28 8.0 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 28 8.0 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 28 8.0 At4g30460.1 68417.m04325 glycine-rich protein 28 8.0 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 28 8.0 At4g01985.1 68417.m00265 expressed protein 28 8.0 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 28 8.0 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 28 8.0 At2g41260.2 68415.m05096 glycine-rich protein / late embryogenes... 28 8.0 At2g41260.1 68415.m05095 glycine-rich protein / late embryogenes... 28 8.0 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 28 8.0 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 28 8.0 At1g11850.2 68414.m01364 expressed protein 28 8.0 At1g02170.1 68414.m00145 latex-abundant family protein (AMC1) / ... 28 8.0 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/60 (36%), Positives = 25/60 (41%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PPR P G ++ T+ AR G PP PPP PP PG P PP P Sbjct: 648 PPRVPRPPPRSAGGGKS--TNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 38.7 bits (86), Expect = 0.006 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP + PP+P +P PP P Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPP 94 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P +P PP PPP PP P P PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P P PP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 569 GXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 G PP PPP PP P P PP P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPP 400 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 563 TPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 +P PP PPP PP P P PP P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P + PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P PP+P Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXP-PPXTXXPPNPGHQPX 634 P PP P P + P P PP P PP PP P QP Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPY 454 Query: 635 XXPPTP 652 P P Sbjct: 455 MYPSPP 460 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P P P+P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP 413 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P P P P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P PP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P P PP PPP P+P P PP Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 35.5 bits (78), Expect = 0.053 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 141 PPTPSYSPPVKPPPVQMPPTPTYSPPIKPP 170 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 158 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 187 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 310 PPTPTYSPPIKPPPVQKPPTPTYSPPIKPP 339 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 477 PPTPTYSPPVQPPPVQKPPTPTYSPPVKPP 506 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 527 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 556 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 561 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 590 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 578 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 607 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 595 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 624 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 612 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 641 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 629 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPP 658 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 646 PPTPTYSPPIKPPPVQKPPTPTYSPPVKPP 675 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 663 PPTPTYSPPVKPPPVQLPPTPTYSPPVKPP 692 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 680 PPTPTYSPPVKPPPVQVPPTPTYSPPVKPP 709 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 697 PPTPTYSPPVKPPPVQVPPTPTYSPPIKPP 726 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 124 PPTPTYSPPIYPPPIQKPPTPSYSPPVKPP 153 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 494 PPTPTYSPPVKPPPIQKPPTPTYSPPIKPP 523 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 544 PPTPTYSPPIKPPPIHKPPTPTYSPPIKPP 573 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 208 PPTPIYSPPIKPPPVHKPPTPTYSPPVKPP 237 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 225 PPTPTYSPPVKPPPVHKPPTPIYSPPIKPP 254 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 444 PPTPIYSPPVKPPPVHKPPTPTYSPPIKPP 473 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 90 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 119 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 107 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 136 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 377 PPTPIYSPPVKPPPIQKPPTPTYSPPIKPP 406 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 191 PPTPIYSPPIKPPPVHKPPTPIYSPPIKPP 220 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 242 PPTPIYSPPIKPPPVHKPPTPIYSPPVKPP 271 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 259 PPTPIYSPPVKPPPVQTPPTPIYSPPVKPP 288 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 343 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 372 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 360 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 389 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 427 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPP 456 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP P PP P + P PP Sbjct: 293 PPTPTYSPPVKSPPVQKPPTPTYSPPIKPP 322 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQ-----PXXXPPTP 652 P TP PP PP PP P + P PPTP Sbjct: 394 PPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTP 430 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P P Sbjct: 276 PPTPIYSPPVKPPPVHKPPTPTYSPPVKSP 305 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 461 PPTPTYSPPIKPPPV-KPPTPTYSPPVQPP 489 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 511 PPTPTYSPPIKPPPV-KPPTPTYSPPIKPP 539 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 175 PPTPTYSPPIKPP-VHKPPTPIYSPPIKPP 203 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP PP PP P + P PP Sbjct: 327 PPTPTYSPPIKPPPV-KPPTPIYSPPVKPP 355 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P PP PP PP P + P PP Sbjct: 76 PTYSPPIYPPPIQKPPTPTYSPPIYPP 102 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 SPP P T +P A P TP PP PP PP P P PT Sbjct: 73 SPPVITSPPPTVAS---SPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPT 129 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P H P PP P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSP---PPPP 554 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 554 HPXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 H P P PP PP P H P PP Sbjct: 587 HSPPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQ---PXXXPPTP 652 P P PP PPP PP P P PP P Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 1/66 (1%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQ-ARXHPXTPGXXPPXPPPXTXXPPNPGHQPX 634 P SPP P P S A H P P PPP PP P P Sbjct: 570 PPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPP 629 Query: 635 XXPPTP 652 P Sbjct: 630 PSQSPP 635 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPX-TSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPX 634 P PP P T P T P P PP P P PP P P Sbjct: 136 PSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTP-TPPV 194 Query: 635 XXPPTP 652 PPTP Sbjct: 195 VTPPTP 200 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 P + HP P PP P P T P+P P PPT Sbjct: 81 PHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHP-KPPIVKPPT 121 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P T + P TP PPP T PP+ H+P PPTP Sbjct: 125 PSTPKPPTKPPPSTPKPPTTKPPPSTPKPPH--HKP---PPTP 162 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP P P PP P P PPTP Sbjct: 190 PTPPVVTPPTPTPPVITPPTP-TPPVITPPTP 220 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP P P PP P P PPTP Sbjct: 210 PTPPVITPPTPTPPVVTPPTP-TPPVVTPPTP 240 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 554 HPXTPGXXPP-XPPPXTXXPPNPGHQPXXXPPT 649 HP P PP PPP T PP PPT Sbjct: 111 HPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPT 143 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/67 (26%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +2 Query: 458 PXXXSPPRXXXX-PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXP-PNPGHQP 631 P PP+ P T P + HP P P PP P P P +P Sbjct: 49 PPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKP 108 Query: 632 XXXPPTP 652 P P Sbjct: 109 HPHPKPP 115 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P T P + P P P PP T P P P PPTP Sbjct: 134 PPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTP---PVITPPTP 190 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P P T + P P PP PPP PP P + P PP P Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP----PPPPVYSPPPPPPPP 458 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P SPP P +P P TP PP PPP PP P Sbjct: 570 PPPHSPPPPHSPPPPI-YPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYS 628 Query: 638 XPPTP 652 PP P Sbjct: 629 PPPPP 633 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/65 (27%), Positives = 19/65 (29%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P SPP P P + P P PP P PP P P Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVY 480 Query: 638 XPPTP 652 PP P Sbjct: 481 SPPPP 485 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PPP PP P + PP+P Sbjct: 499 PPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P PP P Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 557 PXTPGXXPPX---PPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P + P PP P Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/67 (26%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPN--PGHQP 631 P PP P P P P PP PP + PP+ P P Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Query: 632 XXXPPTP 652 PP P Sbjct: 494 VYSPPPP 500 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PPP PP P P PP P Sbjct: 483 PPPSPPPPPPPVYSPPPP---PPPPPPPP 508 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPX-PPPXTXXPPNPGHQPX 634 P PP P P S A + P PP PPP PP P Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYY 560 Query: 635 XXPPTP 652 PP P Sbjct: 561 SSPPPP 566 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +2 Query: 578 PPXPP--PXTXXPPNPGHQPXXXPPTP 652 PP PP P PP P HQP PP P Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPP 49 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/61 (29%), Positives = 21/61 (34%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 SP + P R+P T+ Q P PP P P PP P PP Sbjct: 542 SPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPP 601 Query: 650 P 652 P Sbjct: 602 P 602 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P R P R P PP PPP + P+P P PP P Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPP------PPPPPPSSRSIPSPSAPPPPPPPPP 626 >At4g27520.1 68417.m03952 plastocyanin-like domain-containing protein similar to PIR|JC7196 phytocyanin-related protein Pn14 {Ipomoea nil}; contains Pfam profile PF02298: Plastocyanin-like domain Length = 349 Score = 33.1 bits (72), Expect = 0.28 Identities = 20/67 (29%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGR--GXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQP 631 P +PP P + +P S A P +P PP PP T P +P P Sbjct: 175 PGSTTPPGGAHSPKSSSAVSPATSPPGSMAPKSGSPVSPTTSPPAPPKSTS-PVSPSSAP 233 Query: 632 XXXPPTP 652 PP P Sbjct: 234 MTSPPAP 240 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P T P P PP PP T PP P + PP P Sbjct: 127 PYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P P PPP PP P +P PPTP Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKP-PPPPTP 127 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P P PPP T PP P PPTP Sbjct: 105 PPPPPYVKPPPPP-TVKPPPPPTPYTPPPPTP 135 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 557 PXTPGXXPPXPP-PXTXXPPNP--GHQPXXXPPTP 652 P P PP PP P T PP P P PP P Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP 148 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +2 Query: 476 PRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPX-PPPXTXXPPNPGHQPXXXPPTP 652 P P T P S P P PP PPP T P P P PP P Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 138 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPX-PPPXTXXPPNPGHQPXXXPPTP 652 P S P P PP PPP T P P P PP P Sbjct: 113 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 156 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPG-HQPXXXPPTP 652 P TP P PP T PP P P PTP Sbjct: 185 PPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTP 217 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/66 (30%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +2 Query: 458 PXXXSP-PRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPX 634 P SP P P T +P + P TP P PP T P+P Sbjct: 124 PSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP-TPSVPSPTPPVPTDPMPSPPPPVS 182 Query: 635 XXPPTP 652 PPTP Sbjct: 183 PPPPTP 188 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 521 NPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQP---XXXPPTP 652 +P + Q P T PP PP T PP P P PP+P Sbjct: 50 SPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSP 96 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PPP + PP P P PP P Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +2 Query: 578 PPXPP-PXTXXPPNPGHQPXXXPPTP 652 PP PP P + PP+P P PP P Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPP 1095 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P +P P PPP PP P P PP P Sbjct: 96 PLSPPQTTPPPPPAITPPPPPAITPPLSPPPP 127 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P P PPP + PP P PP P Sbjct: 61 PAPPANDQPPPPPQSTSPPPVATTPPALPPKP 92 Score = 28.7 bits (61), Expect = 6.1 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P SPP P P S Q P P PP PPP P +P P Sbjct: 73 PQSTSPPPVATTPPALPPKPLPPPLSPPQTTP-PPPPAITPP-PPPAITPPLSP-PPPAI 129 Query: 638 XPPTP 652 PP P Sbjct: 130 TPPPP 134 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPP 646 PP PP T PP P P PP Sbjct: 149 PPLSPPQTTPPPPPAITPPLSPP 171 Score = 28.3 bits (60), Expect = 8.0 Identities = 21/70 (30%), Positives = 25/70 (35%), Gaps = 4/70 (5%) Frame = +2 Query: 455 DPXXXSPPRXXXXPXTXGRGXRNPXTSXAQ--ARXHPXTPGXX--PPXPPPXTXXPPNPG 622 DP +PP P + P ++ A P P PP PP T PP P Sbjct: 50 DPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPA 109 Query: 623 HQPXXXPPTP 652 P PP P Sbjct: 110 ITP---PPPP 116 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 32.7 bits (71), Expect = 0.37 Identities = 21/65 (32%), Positives = 25/65 (38%), Gaps = 3/65 (4%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTP-GXXPPX--PPPXTXXPPNPGHQ 628 P + P P T G P T+ TP G PP PPP T PP+ G+ Sbjct: 134 PPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPIINPPPVTVPPPSSGYP 193 Query: 629 PXXXP 643 P P Sbjct: 194 PYGPP 198 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/65 (30%), Positives = 22/65 (33%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P SPP P P S P P PP PP + PP P + P Sbjct: 694 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSP-- 751 Query: 638 XPPTP 652 PP P Sbjct: 752 -PPPP 755 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 4/69 (5%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQ-ARXHPXTPGXXPPXPPPXTXXPPNPGHQ-- 628 P SPP P P S + P P PP P P PP P H Sbjct: 701 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPP 760 Query: 629 -PXXXPPTP 652 P PP P Sbjct: 761 PPVHSPPPP 769 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/69 (27%), Positives = 20/69 (28%), Gaps = 3/69 (4%) Frame = +2 Query: 455 DPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQ-- 628 DP SP + TS H P PPP PP P H Sbjct: 612 DPYDASPIKKRRPQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPP 671 Query: 629 -PXXXPPTP 652 P PP P Sbjct: 672 PPVYSPPPP 680 Score = 28.7 bits (61), Expect = 6.1 Identities = 20/70 (28%), Positives = 21/70 (30%), Gaps = 5/70 (7%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXH-PXTPGXXPP----XPPPXTXXPPNPG 622 P SPP P P H P P PP PPP PP P Sbjct: 665 PPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 724 Query: 623 HQPXXXPPTP 652 H P +P Sbjct: 725 HSPPPPVQSP 734 Score = 28.7 bits (61), Expect = 6.1 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXH-PXTPGXXPPXPPPXTXXPPNPGHQPX 634 P SPP P P S P P PPP PP P H P Sbjct: 708 PPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSP- 766 Query: 635 XXPPTP 652 PP P Sbjct: 767 --PPPP 770 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P PP P P S P P PP P P PP P P Sbjct: 762 PVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP-IYSPPPPVFSPPP 820 Query: 638 XPPTP 652 P TP Sbjct: 821 KPVTP 825 Score = 28.3 bits (60), Expect = 8.0 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 8/69 (11%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPP-----XPPPXTXXPPNPGHQ-- 628 SPP P P S P P PP PPP PP P H Sbjct: 641 SPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPP 700 Query: 629 -PXXXPPTP 652 P PP P Sbjct: 701 PPVHSPPPP 709 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PPP + PP+ P PP+P Sbjct: 86 PCLQNIPPPSPPPPSPPPPSQACPPPPLPPSP 117 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 32.3 bits (70), Expect = 0.49 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +2 Query: 506 GRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 G NP S + P PP PPP PP+P P PP+P Sbjct: 40 GGNDNNPPPSPSP-EPEPEPADCPPPPPPPPCPPPPSP--PPCPPPPSP 85 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PPP + P P P PP P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPN--PGHQPXXXPPTP 652 P A P P PP PP PP+ P P PP P Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PP + PP P PP P Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PP PP +P PPTP Sbjct: 87 PSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PP PP P P PP P Sbjct: 78 PCPPPPSPPPSPPPPQLPP-PPQLPPPAPPKP 108 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/60 (28%), Positives = 20/60 (33%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 SPP P G +P + P P P PP PP G P PP+ Sbjct: 560 SPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPS 619 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/61 (31%), Positives = 21/61 (34%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 SPP P + P T P TP P PP + P PG P P T Sbjct: 457 SPPSTTPSPGSPPTSPTTP-TPGGSPPSSPTTP--TPGGSPPSSPTTPTPGGSPPSSPTT 513 Query: 650 P 652 P Sbjct: 514 P 514 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/62 (32%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXP-PXPPPXTXXPPNPGHQPXXXPP 646 SPP P T +P S P P P P PP + P PG P P Sbjct: 431 SPPITVPSPPTTP----SPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPT 486 Query: 647 TP 652 TP Sbjct: 487 TP 488 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/64 (29%), Positives = 22/64 (34%), Gaps = 3/64 (4%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXP---PPXTXXPPNPGHQPXXX 640 SPP P G +P T P +P P P P P +PG P Sbjct: 493 SPPSSPTTPTPGGSPPSSPTTPSPGGS--PPSPSISPSPPITVPSPPSTPTSPGSPPSPS 550 Query: 641 PPTP 652 PTP Sbjct: 551 SPTP 554 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +2 Query: 542 QARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 Q++ P P PP PPP PP P P PP P Sbjct: 31 QSQDPPLFPQSPPPPPPPPPPPPPPP---PPPPPPPP 64 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQ--PXXXPPTP 652 PP PPP + PP P + P PP P Sbjct: 93 PPQPPPRSQPPPKPPQKNLPRRHPPPP 119 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 554 HPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 HP P PP P P PP P H PPTP Sbjct: 62 HPHPP---PPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXP--PPXTXXPPNPGHQPXXXPPTP 652 P S P +P PP P P PP+P P PP+P Sbjct: 26 PPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PPP PP P P PP P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPP 47 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +2 Query: 506 GRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXP-PNPGHQPXXXPPTP 652 GR R P A+AR P P P PPP P P P PP P Sbjct: 536 GRRPRPPLPPPARARPLP-PPARARPMPPPARARPLPPPARSYDRRPPVP 584 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG + GG G GGGG GG Sbjct: 110 GGGGKNGGGCGGGGGGKGG 128 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 867 DPGXXXXGGGXRXXGGXGXGGGGXGG 790 DP GGG GG G GGG GG Sbjct: 72 DPKGGSGGGGKGGGGGGGISGGGAGG 97 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG + GG G GGG GG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGG 28 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGG--XGGC 787 G GGG GG G GGGG GGC Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGC 37 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 554 HPXTPGXXPPXPPPXTXXPPNPGHQPXXXP 643 HP +P PP PPP PP+P H P P Sbjct: 55 HPHSPS--PPPPPPPQWGPPSP-HYPQGQP 81 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 554 HPXTPGXXPPXPPPXTXXPPNPGHQPXXXP 643 HP +P PP PPP PP+P H P P Sbjct: 55 HPHSPS--PPPPPPPQWGPPSP-HYPQGQP 81 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGGC 787 G GGG GG G GG G GGC Sbjct: 783 GGGGCGGGHHGGGGGGCGGCGGGGC 807 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 796 GGGCGGCGGGGCGGGGDGG 814 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG R GG G GGG GG Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGG 116 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG R GG G GGG GG Sbjct: 93 GRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGGCXR 781 GGG GG G GGG GG R Sbjct: 106 GGGYSGGGGGGYSGGGGGGYER 127 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGGCXR 781 G GGG GG G GGGG GG R Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGGGR 176 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 155 GGGYGGGGGYGGGGGGYGGGGRGG 178 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 160 GGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 102 GGGRGSGGGYGGGGGGYGG 120 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGGC 787 G GGG GG GGGG G C Sbjct: 161 GGGYGGGGGGYGGGGRGGGGGGGSC 185 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGG 170 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/69 (30%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXP--PNP--GH 625 P PP+ P P T A P T PP PP T P P+P Sbjct: 24 PPPGIPPQSGGPPTGSEAVGFRPFTPSASQPTRPFTASGPPPAPPVGTMRPGQPSPFVSQ 83 Query: 626 QPXXXPPTP 652 P PP P Sbjct: 84 IPGSRPPPP 92 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P +P PP PP + PP P + P PP Sbjct: 503 PPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 548 RXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 R P P PP P P PP P + P PP Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 557 PXTPGXXPPXPPP-XTXXPPNPGHQPXXXPP 646 P P PP PPP + PP P + P PP Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQ---PXXXPPTP 652 P P P PPP PP P H P PP P Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/68 (27%), Positives = 20/68 (29%), Gaps = 3/68 (4%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQ--- 628 P SPP P P H P P PP + PP P H Sbjct: 568 PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Query: 629 PXXXPPTP 652 P PP P Sbjct: 628 PVFSPPPP 635 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 8/73 (10%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPP-----XPPPXTXXPPNPG 622 P SPP P P S P P PP PPP PP P Sbjct: 540 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPV 599 Query: 623 HQ---PXXXPPTP 652 H P PP P Sbjct: 600 HSPPPPVHSPPPP 612 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P P PP PPP PP P + P PP Sbjct: 646 PPPPVYSPP-PPPVKSPPPPPVYSPPLLPP 674 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 3/68 (4%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQ--- 628 P SPP P P H P P PPP PP P Sbjct: 575 PPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634 Query: 629 PXXXPPTP 652 P PP P Sbjct: 635 PVHSPPPP 642 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P P PPP PP P P PP P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPP--PPVYSPPPP 539 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P P PPP PP P P PP P Sbjct: 519 PPPPPVYSPPPPPPVYSPPPP--PPVHSPPPP 548 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 2/65 (3%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXT--XXPPNPGHQP 631 P PP P +P T P TP PPP PP GHQ Sbjct: 657 PVKSPPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQY 716 Query: 632 XXXPP 646 PP Sbjct: 717 ASPPP 721 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -2 Query: 864 PGXXXXGGGXRXXGGXGXG---GGGXGGC 787 PG GGG GG G G GGG GGC Sbjct: 157 PGYGSGGGGIGGGGGIGGGVIIGGGGGGC 185 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 521 NPXTSXAQARXHPXT-PGXXPPXPP---PXTXXPPNPGHQPXXXPPTP 652 +P +Q HP P PP P P T P P P PPTP Sbjct: 23 SPTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTP 70 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 501 PKAGDXGIXXXPXPRPGXTPXPRGXXPPXHHLXP 602 P G+ P PRPG P P G PP + P Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 501 PKAGDXGIXXXPXPRPGXTPXPRGXXPPXHHLXP 602 P G+ P PRPG P P G PP + P Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PG P PPP PP P P P P Sbjct: 260 PGRSAPPPPPAAAPPPQPPPPPPPKPQPP 288 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 132 GGYGGGGGGYGGGGGGYGGGGDGG 155 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 125 GGYSGGGGGYGGGGGGYGGGGGG 147 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGG 597 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGG 597 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGGC 787 G GGG GG G GG G GGC Sbjct: 149 GHGCGGGGGGGGGGLGGGGCGGGGC 173 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 157 GGGGGGLGGGGCGGGGCGG 175 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGG 91 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGGG GG Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 74 GGGGGGGGGGGGGGGGGGG 92 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGG 92 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG GG G GGGG G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWG 94 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 554 HPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 H PG PP PP PP G+ P PP P Sbjct: 22 HGYPPGAYPP--PPQGAYPPPGGYPPQGYPPPP 52 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 4/64 (6%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPP----NPGHQPXXX 640 PP P T R P P PP PPP T PP GH Sbjct: 123 PPPPPPPPPTITPPVTTTTAGHHHHRRSPPPP--PPPPPPPPTITPPVTTTTTGHHHHRP 180 Query: 641 PPTP 652 PP P Sbjct: 181 PPPP 184 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/65 (21%), Positives = 21/65 (32%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX 637 P SP P + +P + + + PP PPP P +P + Sbjct: 106 PPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSPSPPPPPPQPESPSSPSYPEPA 165 Query: 638 XPPTP 652 P P Sbjct: 166 PVPAP 170 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 864 PGXXXXGGGXRXXGGXGXGGGGXGG 790 PG GGG GG GGGG GG Sbjct: 95 PGGGDVGGGGGGYGGGTPGGGGGGG 119 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P G + Q + P P PPP PP P P PP P Sbjct: 848 PPPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPP 900 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 554 HPXTPGXXPPXPP-PXTXXPPNPGHQPXXXPP 646 HP G P PP P PPNP QP PP Sbjct: 347 HPS--GYNPEEPPYPQQSYPPNPPRQPPSHPP 376 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/60 (30%), Positives = 21/60 (35%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP+ P G P Q + +P P PP PP P QP PP P Sbjct: 262 PPQQFIQPPASQHGLSPPSLQLPQL-PNQFSPQQEPYFPPSGQSQPP-PTIQPPYQPPPP 319 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 533 SXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 S A A P G P PPP PP P PP P Sbjct: 7 SGADAVVSPPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPP 46 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/59 (27%), Positives = 18/59 (30%) Frame = +2 Query: 476 PRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PR P + + A P PP PPP PP P PP P Sbjct: 280 PRVPKPPPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPP 338 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 554 HPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 +P P PP PPP PP P PP P Sbjct: 39 NPCQPNPSPP-PPPSNPSPPPPSPTTTACPPPP 70 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 132 GGGGYGGGGGGYGGGGDGG 150 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 63 GGGGGGGGGSGGGGGGRGG 81 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 P S R P TP P PP T P P P PP+ Sbjct: 124 PPPSKTHERSRPITPS---PPPPSKTHEPSRPNTPPPPPPPS 162 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 211 GGGGGLGGGNGSGGGGGGG 229 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P P PP P P PP P P PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 581 PXPPPXTXXPPNPGHQPXXXPPTP 652 P PPP T PP P PP+P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSP 87 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPTP 652 PP PPP T PP PPTP Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTP 218 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/67 (26%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPX--PPPXTXXPPNPGHQP 631 P +PP P +P + P P PP PPP PP P P Sbjct: 60 PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 Query: 632 XXXPPTP 652 P P Sbjct: 120 PAQVPAP 126 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/67 (26%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPX--PPPXTXXPPNPGHQP 631 P +PP P +P + P P PP PPP PP P P Sbjct: 60 PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASP 119 Query: 632 XXXPPTP 652 P P Sbjct: 120 PAQVPAP 126 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/62 (27%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPP-XTXXPPNPGHQPXXXPP 646 S P P + +P + A P +P P PPP PP P PP Sbjct: 107 SAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPP 166 Query: 647 TP 652 P Sbjct: 167 AP 168 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/61 (29%), Positives = 21/61 (34%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 +PP P T T A P +P PP P + PP P P P T Sbjct: 38 APPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTPPPAVTPTS--PPAPKVAPVISPAT 95 Query: 650 P 652 P Sbjct: 96 P 96 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = +2 Query: 518 RNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 ++P S P +P P PPP PP P P +P Sbjct: 102 QSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASP 146 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +2 Query: 557 PXTPGXXPPXPPP---XTXXPP--NPGHQPXXXPPTP 652 P TP PP PP T PP +P P PPTP Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTP 129 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/59 (28%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPX-TPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 PP+ P P S A P TP PP P P +P P PP Sbjct: 97 PPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 521 NPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 +P TS A PPP T PP QP P TP Sbjct: 30 SPVTSTTTAPPPTTAAPPTTAAPPPTTTTPPVSAAQPPASPVTP 73 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGG 790 GGG GG G GGGG GG Sbjct: 71 GGGGGCGGGGGCGGGGGGG 89 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/66 (27%), Positives = 24/66 (36%) Frame = +2 Query: 455 DPXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPX 634 +P +PP P + P T + P P PPP T P +P +P Sbjct: 44 EPTNGNPPETTNTP---AQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTI-PVSPPPEPS 99 Query: 635 XXPPTP 652 PP P Sbjct: 100 PPPPLP 105 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQP 631 P P+ P G P P P PP PP T PP P P Sbjct: 219 PPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPS--PPSPPEETLPPPKPSPDP 274 >At1g14710.2 68414.m01759 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 601 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PG P PP PP+P HQ P P Sbjct: 520 PGGVPTGPPVWPLLPPHPRHQTAPQPRMP 548 >At1g14710.1 68414.m01758 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 601 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PG P PP PP+P HQ P P Sbjct: 520 PGGVPTGPPVWPLLPPHPRHQTAPQPRMP 548 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P +P PP PP PP P P PP+P Sbjct: 166 PFSPSIPPPSPP---YFPPEPPSIPPPPPPSP 194 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 566 PGXXPPXPPPX-TXXPPNPGHQPXXXPPTP 652 P PP P P PPNP P PP P Sbjct: 79 PAPTPPKPKPKPAPTPPNPKPTPAPTPPKP 108 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 563 TPGXXPPXPPPX-TXXPPNPGHQPXXXPPTP 652 TP PP P P PP P P PP P Sbjct: 45 TPAPTPPKPKPKPAPTPPKPKPAPAPTPPKP 75 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/30 (40%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 566 PGXXPPXPPPX-TXXPPNPGHQPXXXPPTP 652 P PP P P PP P +P PP P Sbjct: 68 PAPTPPKPKPAPAPTPPKPKPKPAPTPPNP 97 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP P P P P P Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAP 1157 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PG P PPP PP P PP P Sbjct: 13 PGNYPQGPPPPVGVPPQYYPPPPPPPPPP 41 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPG-HQPXXXPP 646 P P PP PPP PP+P P PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 557 PXTPGXXPPXPPP--XTXXPPNPGHQPXXXPPTP 652 P P PP PP + PP P H PP+P Sbjct: 438 PSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPN-PGHQPXXXPPTP 652 P P PP PPP PP P P PP P Sbjct: 35 PLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEP 67 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PPP P P +P PP P Sbjct: 82 PPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPTP 652 PP PPP + PP P P PP P Sbjct: 22 PPAPPPESSSPPTPPEPP--DPPDP 44 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/60 (26%), Positives = 19/60 (31%) Frame = +2 Query: 473 PPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 PP P P + ++ P TP PP P P P P PP P Sbjct: 101 PPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPP 160 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/42 (30%), Positives = 17/42 (40%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 P S + + P TP P PP PP P + PP+ Sbjct: 71 PAISISPSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPS 112 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/53 (30%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = +2 Query: 470 SPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPP-XTXXPPNPGH 625 +P + P T P S + P TP PP PP + P NP H Sbjct: 121 TPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNPPH 173 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/62 (32%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +2 Query: 476 PRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXX---XPP 646 P+ P T + P S HP TP P PP + PP P P PP Sbjct: 95 PKKSPPPPTPKKSPSPP--SLTPFVPHP-TPKKSPSPPPTPSLPPPAPKKSPSTPSLPPP 151 Query: 647 TP 652 TP Sbjct: 152 TP 153 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGGC 787 G GGG GG GGGG G C Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGGPC 38 >At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family protein identical to proline-rich protein 2 [Arabidopsis thaliana] gi|7620011|gb|AAF64549 Length = 321 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P PP P PP H+P PP P Sbjct: 183 PCPPIYKPPVVIPKKPCPPKIAHKPIYKPPVP 214 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXG-XGGGGXGG 790 G GGG R GG G GGGG GG Sbjct: 89 GGRYQGGGGRYQGGGGRQGGGGSGG 113 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/69 (33%), Positives = 25/69 (36%) Frame = -1 Query: 739 GXXXQGGEAGLGXXV*GGGXGVXXXWXXXRGGXXXXGLVPRVRGXXGXRWWXGGXXPRGX 560 G GGE G GGG G GG GL G G + G RG Sbjct: 40 GGEGGGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTK----GGGRRGD 95 Query: 559 GVXPGLGXG 533 G+ GLG G Sbjct: 96 GLGRGLGRG 104 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +2 Query: 557 PXTPGXXPPXP---PPXTXXPPNPGHQPXXXPP-TP 652 P TP PP P PP T PP P P PP TP Sbjct: 622 PVTPSPPPPSPVYYPPVTPSPPPP--SPVYYPPVTP 655 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 548 RXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 R +P P P PPP P P + PP P Sbjct: 454 RAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPP 488 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/30 (43%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 563 TPGXXPPXPPP--XTXXPPNPGHQPXXXPP 646 TP PP PPP + PP+P P PP Sbjct: 61 TPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/66 (27%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNP-GHQPX 634 P P+ P G + +P P PP PPP + PP P QP Sbjct: 173 PQVQQYPQPSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPP-PPPSSAYPPQPYPPQPS 231 Query: 635 XXPPTP 652 P P Sbjct: 232 YYPQGP 237 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPT 649 P PP PP PP P Q PPT Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQPPT 131 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 28.7 bits (61), Expect = 6.1 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXX--PPXPPPXTXXPPNPGHQP 631 P P P G +P S + P P P PPP T PP P Sbjct: 66 PFPNPNPNPNPNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPP-----P 120 Query: 632 XXXPPTP 652 PP P Sbjct: 121 EFSPPPP 127 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG R GG G GGG G Sbjct: 98 GGSYGGGGGRREGGGGYSGGGGG 120 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG R GG G GGG G Sbjct: 115 GGSYGGGGGRREGGGGYSGGGGG 137 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXG 793 G GGG R G G GGGG G Sbjct: 157 GYSGGGGGGRYGSGGGGGGGGGG 179 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG G G GGGG GG Sbjct: 156 GGYSGGGGGGRYGSGGGGGGGGGG 179 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P P P PPP PP+ P PP P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 864 PGXXXXGGGXRXXGGXGXGGGGXG 793 PG GGG GG G GGG G Sbjct: 89 PGGIVVGGGGGGGGGGGGGGGSGG 112 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 5/30 (16%) Frame = +2 Query: 578 PPXPPPXTXX-----PPNPGHQPXXXPPTP 652 PP PPP T PP PG Q PP P Sbjct: 538 PPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 554 HPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 +P P PP PPP PP P PP P Sbjct: 58 NPPPPSPPPPSPPPPACPPP-----PALPPPPP 85 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 557 PXTPGXXPPX-PPPXTXXPPNPGHQPXXXPPTP 652 P P PP PPP PP P PP P Sbjct: 64 PPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +2 Query: 524 PXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P + QA +P P PP PP P P PP P Sbjct: 351 PNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPPP 393 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +2 Query: 542 QARXHPXTPGXX--PPXPPPXTXXPPNPG 622 Q HP PG PP PPP PP+PG Sbjct: 343 QPDVHPP-PGMLRFPPPPPPLDMHPPHPG 370 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G G GG GG Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGG 152 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPTP 652 PP PPP PP P PP P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPP 731 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 6/36 (16%) Frame = +2 Query: 557 PXTPGXXPPXPP------PXTXXPPNPGHQPXXXPP 646 P TPG P PP P T PP P P PP Sbjct: 121 PQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPP 156 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 557 PXTPGXXPPXPPPX-TXXPPNPGHQPXXXPPTP 652 P P P PP PP P ++P P TP Sbjct: 36 PTLPSPSPATKPPSPALKPPTPSYKPPTLPTTP 68 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 557 PXTPGXXPPXPPPXTXXPPNPGHQPXXXPP 646 P TP PP P T PP P +P P Sbjct: 109 PPTPTVKPPSVQPPTYKPPTPTVKPPTTSP 138 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GG GG G GGGG GG Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGG 137 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 566 PGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P PP PP + PP P P P +P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSP 189 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G G GG GG Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGG 472 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGG GG Sbjct: 476 GSVGAGGGVGVGGGGGIGGGAGGG 499 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/72 (27%), Positives = 25/72 (34%), Gaps = 7/72 (9%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPP--PXTXXPPNPGHQP 631 P +PP P + +P T HP + G PP P PP+P P Sbjct: 98 PTPHTPPCNCGSPPSHPSTPSHPSTPSHPTPSHPPSGGYYSSPPPRTPVVVTPPSPIVDP 157 Query: 632 -----XXXPPTP 652 PPTP Sbjct: 158 GTPIIGGSPPTP 169 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 28.3 bits (60), Expect = 8.0 Identities = 20/72 (27%), Positives = 25/72 (34%), Gaps = 7/72 (9%) Frame = +2 Query: 458 PXXXSPPRXXXXPXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPP--PXTXXPPNPGHQP 631 P +PP P + +P T HP + G PP P PP+P P Sbjct: 98 PTPHTPPCNCGSPPSHPSTPSHPSTPSHPTPSHPPSGGYYSSPPPRTPVVVTPPSPIVDP 157 Query: 632 -----XXXPPTP 652 PPTP Sbjct: 158 GTPIIGGSPPTP 169 >At2g41260.2 68415.m05096 glycine-rich protein / late embryogenesis abundant protein (M17) identical to late-embryogenesis abundant M17 protein GI:3342551 from [Arabidopsis thaliana] Length = 280 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 825 GGXGXGGGGXGGC 787 GG G GGGG GGC Sbjct: 121 GGGGGGGGGRGGC 133 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 825 GGXGXGGGGXGGC 787 GG G GGGG GGC Sbjct: 176 GGGGGGGGGRGGC 188 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 825 GGXGXGGGGXGGC 787 GG G GGGG GGC Sbjct: 231 GGGGGGGGGRGGC 243 >At2g41260.1 68415.m05095 glycine-rich protein / late embryogenesis abundant protein (M17) identical to late-embryogenesis abundant M17 protein GI:3342551 from [Arabidopsis thaliana] Length = 225 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 825 GGXGXGGGGXGGC 787 GG G GGGG GGC Sbjct: 121 GGGGGGGGGRGGC 133 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 825 GGXGXGGGGXGGC 787 GG G GGGG GGC Sbjct: 176 GGGGGGGGGRGGC 188 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 578 PPXPPPXTXXPPNPGHQPXXXPPTP 652 PP PPP PP P PP P Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPP 256 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 846 GGGXRXXGGXGXGGGGXGGCXR 781 GGG GG G GGGG C R Sbjct: 611 GGGGGGGGGPGGGGGGGPYCGR 632 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 861 GXXXXGGGXRXXGGXGXGGGGXGG 790 G GGG GG G GGG GG Sbjct: 80 GGGLGGGGGGLLGGGGFGGGAGGG 103 >At1g02170.1 68414.m00145 latex-abundant family protein (AMC1) / caspase family protein contains similarity to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam profile PF00656: ICE-like protease (caspase) p20 domain Length = 367 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +2 Query: 494 PXTXGRGXRNPXTSXAQARXHPXTPGXXPPXPPPXTXXPPNPGHQPXXXPPTP 652 P G R+ + QA H P PP P PP H P P P Sbjct: 24 PLQLPSGARSIRCALCQAVTHIADPRTAPPPQPSSAPSPPPQIHAPPGQLPHP 76 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,638,236 Number of Sequences: 28952 Number of extensions: 90834 Number of successful extensions: 3369 Number of sequences better than 10.0: 106 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2253 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2324382072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -