BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F17 (907 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g26000.2 68418.m03094 glycosyl hydrolase family 1 protein con... 31 0.79 At5g26000.1 68418.m03093 glycosyl hydrolase family 1 protein con... 31 0.79 At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetica... 29 4.2 At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetica... 29 4.2 At5g13960.1 68418.m01632 SET domain-containing protein (SUVH4) i... 28 9.8 At1g47750.1 68414.m05310 peroxisomal biogenesis factor 11 family... 28 9.8 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 28 9.8 >At5g26000.2 68418.m03094 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; identical to Myrosinase precursor (Sinigrinase) (SP:P37702) [Arabidopsis thaliana] Length = 456 Score = 31.5 bits (68), Expect = 0.79 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 4/65 (6%) Frame = +3 Query: 96 MKFFMIFVLALLAMANAQGNGYEPIDNRPYIVNPPKDYNPNGN---GY-EPIDNGAYYVD 263 MK M+ + LLA+A +G+ + +N P+ N K +N +GN G+ + + AY V+ Sbjct: 1 MKLLMLAFVFLLALATCKGDEFVCEENEPFTCNQTKLFN-SGNFEKGFIFGVASSAYQVE 59 Query: 264 RPQGR 278 +GR Sbjct: 60 GGRGR 64 >At5g26000.1 68418.m03093 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; identical to Myrosinase precursor (Sinigrinase) (SP:P37702) [Arabidopsis thaliana] Length = 541 Score = 31.5 bits (68), Expect = 0.79 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 4/65 (6%) Frame = +3 Query: 96 MKFFMIFVLALLAMANAQGNGYEPIDNRPYIVNPPKDYNPNGN---GY-EPIDNGAYYVD 263 MK M+ + LLA+A +G+ + +N P+ N K +N +GN G+ + + AY V+ Sbjct: 1 MKLLMLAFVFLLALATCKGDEFVCEENEPFTCNQTKLFN-SGNFEKGFIFGVASSAYQVE 59 Query: 264 RPQGR 278 +GR Sbjct: 60 GGRGR 64 >At3g63460.2 68416.m07146 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1102 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = +3 Query: 132 AMANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPF 302 A N Q P + P P NP N Y+ +YYV + P +PT F Sbjct: 790 ASGNTQPQSTMPYNQEPTQAQPNVLANPYDNQYQQPYTDSYYVPQVSHPPMQQPTMF 846 >At3g63460.1 68416.m07145 WD-40 repeat family protein hypothetical protein contains similarity to ec31p [Oryza sativa] gi|13928450|dbj|BAB47154; contains Pfam profile PF00400: WD domain, G-beta repeat Length = 1104 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/57 (29%), Positives = 22/57 (38%) Frame = +3 Query: 132 AMANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPF 302 A N Q P + P P NP N Y+ +YYV + P +PT F Sbjct: 792 ASGNTQPQSTMPYNQEPTQAQPNVLANPYDNQYQQPYTDSYYVPQVSHPPMQQPTMF 848 >At5g13960.1 68418.m01632 SET domain-containing protein (SUVH4) identical to SUVH4 [Arabidopsis thaliana] GI:13517749; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH4 (SUVH4) GI:13517748 Length = 624 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 167 RFVAVSLSVGHSQQSEDENHEEF 99 R VAV ++ G SQ SEDEN EF Sbjct: 514 RDVAVPMNNGVSQSSEDENAPEF 536 >At1g47750.1 68414.m05310 peroxisomal biogenesis factor 11 family protein / PEX11 family protein contains Pfam PF05648: Peroxisomal biogenesis factor 11 (PEX11) Length = 248 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/67 (28%), Positives = 33/67 (49%) Frame = -3 Query: 227 AVSIRVVVFGRINDVRAVVNRFVAVSLSVGHSQQSEDENHEEFHFYMITSYHRRKILKLC 48 +VSI++ ++ND + V + +S+S G + EDE + MI K+L + Sbjct: 149 SVSIKIRDLRKLNDEESCVASTIEISVSRGLACDGEDEKMK-----MIKEKKTLKVLSIL 203 Query: 47 PNLKDSL 27 +L D L Sbjct: 204 QDLADGL 210 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = +3 Query: 195 PPKDYNPNGNGYEPIDNGAYYVDRPQGRPYFKPTPFP 305 PP + P +P+D Y PQG Y+ P+P P Sbjct: 141 PPPQHPPPRPQSQPLD----YYSAPQGNHYYSPSPPP 173 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,638,055 Number of Sequences: 28952 Number of extensions: 198335 Number of successful extensions: 530 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -