BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F15 (854 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.39 SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) 29 6.4 >SB_13184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1297 Score = 32.7 bits (71), Expect = 0.39 Identities = 21/57 (36%), Positives = 25/57 (43%) Frame = +3 Query: 222 QVGGGKVFGTLGQNDDGLFGKAGYNREIFNDDRGKLTGQAYGTRVLGPAGDSTNYGG 392 Q G G FGT GLFG AG N G +TG +G + ST +GG Sbjct: 48 QTGFGSGFGTTQTTGTGLFGAAGTNTGTGLFGGGTVTGSMFGQPA---SAASTGFGG 101 >SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) Length = 3397 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 214 QVTSRGCRFEKCPLIGYPSSYSQ*TSALTHTRT 116 ++T GC FE P + +P+SY + T+T Sbjct: 2867 ELTKEGCVFETAPAVSHPASYVDEDGRVWATKT 2899 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,598,707 Number of Sequences: 59808 Number of extensions: 550863 Number of successful extensions: 2919 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2031 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2431332827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -