BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F14 (972 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 45 7e-05 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 43 3e-04 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 43 4e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 42 6e-04 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 41 0.001 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 29 0.001 At4g18570.1 68417.m02749 proline-rich family protein common fami... 40 0.002 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 40 0.002 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 40 0.002 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 40 0.002 At1g61080.1 68414.m06877 proline-rich family protein 40 0.003 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 35 0.004 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 36 0.005 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 36 0.005 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 35 0.006 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 39 0.006 At1g75550.1 68414.m08780 glycine-rich protein 39 0.006 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 38 0.008 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 38 0.010 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 0.010 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 38 0.013 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 38 0.013 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 38 0.013 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 37 0.018 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 36 0.021 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 37 0.023 At1g29380.1 68414.m03592 hypothetical protein 37 0.023 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 33 0.028 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 34 0.036 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 36 0.041 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 36 0.041 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 36 0.041 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 36 0.054 At2g30560.1 68415.m03722 glycine-rich protein 36 0.054 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 36 0.054 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 35 0.071 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 35 0.071 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 35 0.071 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 28 0.078 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 35 0.094 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 35 0.094 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 35 0.094 At4g33660.1 68417.m04781 expressed protein 35 0.094 At4g30460.1 68417.m04325 glycine-rich protein 35 0.094 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 35 0.094 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 35 0.094 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 35 0.094 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 31 0.11 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 32 0.12 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 34 0.12 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 34 0.12 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 34 0.12 At3g50180.1 68416.m05486 hypothetical protein 32 0.14 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 30 0.14 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 34 0.16 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 34 0.16 At1g15830.1 68414.m01900 expressed protein 32 0.18 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 33 0.22 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 33 0.22 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 33 0.22 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 33 0.22 At4g01985.1 68417.m00265 expressed protein 33 0.22 At2g05440.2 68415.m00575 glycine-rich protein 33 0.22 At1g53625.1 68414.m06096 expressed protein 33 0.22 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 33 0.22 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 33 0.29 At5g46730.1 68418.m05757 glycine-rich protein 33 0.29 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 33 0.29 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 33 0.29 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 33 0.29 At4g16240.1 68417.m02464 hypothetical protein 33 0.29 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 33 0.29 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 33 0.29 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 33 0.29 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 33 0.29 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 33 0.29 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 33 0.29 At1g02710.1 68414.m00222 glycine-rich protein 33 0.29 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 30 0.31 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 26 0.32 At3g51290.1 68416.m05614 proline-rich family protein 33 0.38 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 33 0.38 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 33 0.38 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 33 0.38 At2g05440.1 68415.m00574 glycine-rich protein 33 0.38 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 33 0.38 At1g55540.1 68414.m06356 proline-rich family protein contains pr... 33 0.38 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 33 0.38 At1g26150.1 68414.m03192 protein kinase family protein similar t... 33 0.38 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 32 0.50 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 32 0.50 At5g38560.1 68418.m04662 protein kinase family protein contains ... 32 0.50 At4g21720.1 68417.m03145 expressed protein 32 0.50 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 32 0.50 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 32 0.50 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 32 0.50 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 32 0.50 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 32 0.54 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 32 0.66 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 32 0.66 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 32 0.66 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 32 0.66 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 32 0.66 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 32 0.66 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 32 0.66 At1g70990.1 68414.m08190 proline-rich family protein 32 0.66 At1g27710.1 68414.m03387 glycine-rich protein 32 0.66 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 24 0.82 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 29 0.86 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 31 0.87 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 31 0.87 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 31 0.87 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 31 0.87 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 31 0.87 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 31 0.87 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 31 0.87 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 31 0.87 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 31 0.87 At1g15840.1 68414.m01901 expressed protein 31 0.87 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 31 0.87 At1g07135.1 68414.m00759 glycine-rich protein 31 0.87 At3g18810.1 68416.m02389 protein kinase family protein contains ... 30 1.1 At1g12380.1 68414.m01431 expressed protein 28 1.1 At1g10620.1 68414.m01204 protein kinase family protein contains ... 28 1.1 At5g08530.1 68418.m01013 NADH-ubiquinone oxidoreductase 51 kDa s... 26 1.1 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 31 1.2 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 31 1.2 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 31 1.2 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 31 1.2 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 31 1.2 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 31 1.2 At1g04800.1 68414.m00476 glycine-rich protein 31 1.2 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 31 1.5 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 1.5 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 31 1.5 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 31 1.5 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 31 1.5 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 31 1.5 At3g08640.1 68416.m01003 alphavirus core protein family contains... 31 1.5 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 31 1.5 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 26 2.0 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 30 2.0 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 30 2.0 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 30 2.0 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 30 2.0 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 30 2.0 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 30 2.0 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 30 2.0 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 30 2.0 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 28 2.5 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 28 2.5 At5g65410.1 68418.m08226 zinc finger homeobox family protein / Z... 30 2.7 At5g58540.1 68418.m07330 protein kinase family protein contains ... 30 2.7 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 30 2.7 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 30 2.7 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 30 2.7 At4g08230.1 68417.m01358 glycine-rich protein 30 2.7 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 30 2.7 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 30 2.7 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 30 2.7 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 30 2.7 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 30 2.7 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 30 2.7 At2g05510.1 68415.m00583 glycine-rich protein 30 2.7 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 30 2.7 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 30 2.7 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 30 2.7 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 30 2.7 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 25 3.3 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 29 3.5 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 29 3.5 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 29 3.5 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 3.5 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 29 3.5 At1g11850.2 68414.m01364 expressed protein 29 3.5 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 28 4.0 At3g50190.1 68416.m05488 expressed protein contains Pfam profile... 25 4.2 At1g45688.1 68414.m05202 expressed protein 27 4.3 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 26 4.3 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 29 4.3 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 29 4.7 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 29 4.7 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 29 4.7 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 29 4.7 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 29 4.7 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 4.7 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 4.7 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 4.7 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 29 4.7 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 29 4.7 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 29 4.7 At2g05530.1 68415.m00585 glycine-rich protein 29 4.7 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 4.7 At1g62240.1 68414.m07021 expressed protein 29 4.7 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 29 4.7 At1g35617.1 68414.m04424 hypothetical protein 29 4.7 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 6.2 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 29 6.2 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 29 6.2 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 6.2 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 29 6.2 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 29 6.2 At4g32285.1 68417.m04593 epsin N-terminal homology (ENTH) domain... 29 6.2 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 29 6.2 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 29 6.2 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 29 6.2 At3g52400.1 68416.m05763 syntaxin, putative (SYP122) similar to ... 29 6.2 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 6.2 At2g25430.1 68415.m03046 epsin N-terminal homology (ENTH) domain... 29 6.2 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 29 6.2 At1g67035.1 68414.m07623 expressed protein ; expression supporte... 29 6.2 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 29 6.2 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 6.2 At3g43583.1 68416.m04636 hypothetical protein 24 6.6 At4g23890.1 68417.m03436 expressed protein hypothetical protein,... 24 7.4 At5g61660.1 68418.m07736 glycine-rich protein 28 8.1 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 28 8.1 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 28 8.1 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 28 8.1 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 28 8.1 At5g11550.1 68418.m01347 expressed protein 28 8.1 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 28 8.1 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 28 8.1 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 28 8.1 At4g12880.1 68417.m02016 plastocyanin-like domain-containing pro... 28 8.1 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 28 8.1 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 28 8.1 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 28 8.1 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 28 8.1 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 28 8.1 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 28 8.1 At2g48160.1 68415.m06031 PWWP domain-containing protein 28 8.1 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 28 8.1 At2g30505.1 68415.m03716 Expressed protein 28 8.1 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 28 8.1 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 28 8.1 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 28 8.1 At1g47660.1 68414.m05295 hypothetical protein 28 8.1 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 28 8.1 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 28 8.1 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 28 8.1 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 45.2 bits (102), Expect = 7e-05 Identities = 32/130 (24%), Positives = 33/130 (25%), Gaps = 5/130 (3%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 PP S PP PP P P + P PP PP Sbjct: 412 PPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Query: 778 PPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPP 957 PPP P PPPP S P P P P P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTP 531 Query: 958 -----PPXPP 972 PP PP Sbjct: 532 VYCTRPPPPP 541 Score = 45.2 bits (102), Expect = 7e-05 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P P PPP P Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPP 474 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P PPP P Sbjct: 442 PPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPP P P P P PPP P Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P PPP P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 512 PPPPPVYSSPPPPPSPAPTPVYCTRPPPP 540 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P P PPP P Sbjct: 451 PPPPP----PPPPPPPVYSPPPPPPPPPPPPP 478 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPPP PPPPP P P P PP Sbjct: 489 PPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P + P PPP P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P P PPP P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPP 462 Score = 39.1 bits (87), Expect = 0.004 Identities = 30/130 (23%), Positives = 32/130 (24%), Gaps = 5/130 (3%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXP- 774 PP P PPP PP P P + P PP P Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPV 517 Query: 775 ----PPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPX 942 PPPP P + PPPP P Sbjct: 518 YSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577 Query: 943 PXPPPPPXPP 972 P PPPP P Sbjct: 578 PHSPPPPIYP 587 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLP---XXXPXXPPPXXP 970 PPPPP PPPPP P P P PPP P Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP PPPP P P P PPP P Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P P PPP P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 37.9 bits (84), Expect = 0.010 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P P PPP P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP 503 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P P PPP P Sbjct: 466 PPPPPP---PPPPPPPVYSP-PPPSPPPPPPP 493 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P P PPP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 878 PPPPXXXX--PPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P P P PP P Sbjct: 581 PPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPP 613 Score = 33.9 bits (74), Expect = 0.16 Identities = 33/157 (21%), Positives = 36/157 (22%), Gaps = 1/157 (0%) Frame = +1 Query: 505 PPPPXXXXXAXXXXXXXTXIFFLGXXRAXGRPPXXPXKXXXXFXSXAPPPXXGARXXPPX 684 PPPP ++ PP P PPP PP Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQ 549 Query: 685 PXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXX 864 P + P SPP P PP P L Sbjct: 550 FSPPPPEPYYYSSPPPPHSSPPPH-SPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYS 608 Query: 865 XXXXXXXXXXXPPPPXXX-SXXSPXPXPXPPPPPXPP 972 PPPP S P P PP PP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 31.9 bits (69), Expect = 0.66 Identities = 32/132 (24%), Positives = 32/132 (24%), Gaps = 6/132 (4%) Frame = +1 Query: 595 RPPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXP 774 RPP P PPP PP P P SPP P Sbjct: 536 RPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPH-SPPPPHSPPPPIYPYLSPPPP 594 Query: 775 P-----PPPXPXXXXLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPX 936 P PPP P PPPP S P Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Query: 937 PXPXPPPPPXPP 972 P PPP PP Sbjct: 655 PVYYSSPPPPPP 666 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPP P P PPP P Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSP 575 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPP P P PP P Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPP 622 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP 946 PPPPP PPPPP P P Sbjct: 610 PPPPPCIEPPPPPPCIEYSPPPPP 633 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PPP PPPP P PPP P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPP 432 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPPP PPP P + P PP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPP---XPXXLPXXXPXXPPP 961 PPPP PPP P P P P PPP Sbjct: 592 PPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 878 PPPPXXXXPP--PPPXPXXLPXXXPXXPPPXXP 970 PPPP PP PPP P P PP P Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +3 Query: 873 PP--PPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PP PPPP P PP P P PP P Sbjct: 571 PPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTP 605 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P P PPP Sbjct: 609 PPPPPPCIEPPPPPPCI--EYSPPPPPP 634 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP PPPP P Sbjct: 651 PPPPPVYYSSPPPPPP 666 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXPPPPP---XPXXLPXXXPXXPPPXXP 970 PPP P PPPP P P PPP P Sbjct: 553 PPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYP 587 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP + P PPP Sbjct: 641 PPPPPVYYSSPPPP---PVYYSSPPPPPP 666 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 5/34 (14%) Frame = +2 Query: 875 PPPPPXXXXPPPPP-----XPXXLPXXXPXXPPP 961 PPPPP PPPP P P PPP Sbjct: 662 PPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPP 695 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PP P P P P PPP P Sbjct: 570 PPPHSPPPPHSPPPPIYPYLSP--PPPPTP 597 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP----XXPPP 961 PPPP PPPPP P P PPP Sbjct: 642 PPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPPP 674 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPP P PP P P PP P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPP 442 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 P P P PPPP P P PPP Sbjct: 527 PAPTPVYCTRPPPPPPHSPPPPQFSPPPP 555 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P PPP P PP Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPP 434 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPP PP P PPP P Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 4/28 (14%) Frame = +1 Query: 901 PPPXXXSXXSPXPXP----XPPPPPXPP 972 PPP SP P P PPPPP P Sbjct: 672 PPPPEVHYHSPPPSPVHYSSPPPPPSAP 699 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P P PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P P PPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P PPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP PPPPP P P P PPP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P P PP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYP 411 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P PPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P P P PPP Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 35.9 bits (79), Expect = 0.041 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PP P P P P PPPPP PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPP 400 Score = 35.9 bits (79), Expect = 0.041 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P PP P P P PPPPP PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P P P P P Sbjct: 426 PPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYP 457 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P PP P P PP P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PPP PPPPP P P PP P Sbjct: 418 PSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 919 SXXSPXPXPXPPPPPXPP 972 S SP P P PPPPP PP Sbjct: 375 SPPSPPPPPPPPPPPPPP 392 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PP PPP P PP P P PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 P PPPP P PP P P PPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 32.7 bits (71), Expect = 0.38 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +1 Query: 760 SPPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXP 939 SPP PPPPP P PPPP P P Sbjct: 375 SPPSPPPPPPPPPPP------PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Query: 940 XP--XPPPPPXPP 972 P PPPP PP Sbjct: 429 PPPYVYPPPPSPP 441 Score = 32.3 bits (70), Expect = 0.50 Identities = 18/70 (25%), Positives = 19/70 (27%) Frame = +1 Query: 763 PPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPX 942 PP PPPPP P + PPP P P Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPS 450 Query: 943 PXPPPPPXPP 972 P P P PP Sbjct: 451 PQPYMYPSPP 460 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPPXXP 970 PP PP PPPPP P P PPP P Sbjct: 417 PPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXP---PPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P PPPP P P P PP P Sbjct: 413 PPPPPPSPPPYVYPPPPPPYVYP--PPPSPPYVYP 445 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +1 Query: 646 PPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPP---PPXP 792 PPP PP P P + P PP PPP PP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 7/34 (20%) Frame = +2 Query: 875 PPPPPXXXXPPP-------PPXPXXLPXXXPXXP 955 PPPPP PPP PP P P P P Sbjct: 427 PPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 28.3 bits (60), Expect = 8.1 Identities = 19/68 (27%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXP- 774 PP P PPP PP P P+ + P PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY---VYPSPPPPPPSPPPYVYPPPPPPY 432 Query: 775 --PPPPXP 792 PPPP P Sbjct: 433 VYPPPPSP 440 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 42.7 bits (96), Expect = 4e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P P PPP Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P P PPP Sbjct: 398 PPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 6/31 (19%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXP------PPPPXPP 972 PPPP S +P P P P PPPP PP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 4/29 (13%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXP----PPPPXPP 972 P PP + SP P P P PPPP PP Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPP 401 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P P P P PPP P Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 578 PXGXXGXPXXXPKKXXXXFXPXPPPXXXGXGPXPXXPXHTXXXXFXPXXP 727 P P PKK P PPP G GP P P P P Sbjct: 390 PSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPPP P P P PPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 7/39 (17%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXL-------PXXXPXXPPPXXP 970 PP P PPPPP P P P PPP P Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 29.5 bits (63), Expect = 3.5 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 5/78 (6%) Frame = +1 Query: 574 GXXRAXGRPPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXX 753 G PP P S PPP A PP P P P G Sbjct: 364 GQFTTANAPPAPPGPANQT--SPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPG----KK 417 Query: 754 XXSPPXPPP-----PPXP 792 PP PPP PP P Sbjct: 418 GAGPPPPPPMSKKGPPKP 435 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPPP PP P + P PP Sbjct: 409 PPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 41.9 bits (94), Expect = 6e-04 Identities = 33/130 (25%), Positives = 36/130 (27%), Gaps = 5/130 (3%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPX-----PXPHXXXXFXXXXPXXGXGXXXXXXS 762 PP P + + PPP PP P P P G Sbjct: 579 PPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQ 638 Query: 763 PPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPX 942 PP PPPPP P PPPP + S P Sbjct: 639 PPPPPPPPPPTRIPAAKCA-PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPK 697 Query: 943 PXPPPPPXPP 972 P P PPP PP Sbjct: 698 P-PAPPPLPP 706 Score = 39.9 bits (89), Expect = 0.002 Identities = 27/109 (24%), Positives = 28/109 (25%) Frame = +1 Query: 646 PPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXPXXXXLXXXXFX 825 PPP +R PP P S P PPPPP P Sbjct: 578 PPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQA 637 Query: 826 XXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P PPPP PP Sbjct: 638 QPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPP 686 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP +P PPP P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P P + P P PPP P Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S S P PPPPP PP Sbjct: 488 PPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S S P PPPPP PP Sbjct: 509 PPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPP P P PP P P PPP P Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P PP P P PPP P Sbjct: 482 PPPPPP--PPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P P PPPP PP Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPPP 601 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 3/72 (4%) Frame = +1 Query: 763 PPXPPPPPXPXXXX---LXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSP 933 PP PPPPP P PPPP S S Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSF 541 Query: 934 XPXPXPPPPPXP 969 P PPPPP P Sbjct: 542 SPSQPPPPPPLP 553 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP P PPP P P PPP Sbjct: 717 PPPPPLSKTPAPPPPPL---SKTPVPPPP 742 Score = 32.3 bits (70), Expect = 0.50 Identities = 23/82 (28%), Positives = 24/82 (29%), Gaps = 11/82 (13%) Frame = +1 Query: 760 SPPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXX---SXXS 930 SP PPPPP P + F PPPP S Sbjct: 500 SPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLPSFSNRD 559 Query: 931 PXPX--------PXPPPPPXPP 972 P P PPPPP PP Sbjct: 560 PLTTLHQPINKTPPPPPPPPPP 581 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 P PPP P PP P P PPP P Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P P P PPP P Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPPP P PP P P PP Sbjct: 716 PPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 P PPP P PP P P PPP Sbjct: 522 PSQPPPPPPPPPLFTSTTSFSPSQPPPPPP 551 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PPPPP P PPP P Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPP 706 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP P P P L PPP Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP P PP P L PPP Sbjct: 728 PPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP + P PPPP PP Sbjct: 486 PPPPPPLFTSTTSFSPSQPPPPPPP 510 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXP--XPPPPPXPP 972 PPPP +P P P P PP PP Sbjct: 717 PPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 25.8 bits (54), Expect(2) = 0.37 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 943 PXPPPPPXPP 972 P PPPPP PP Sbjct: 482 PPPPPPPPPP 491 Score = 25.4 bits (53), Expect(2) = 0.37 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 904 PPXXXSXXSPXPXPXPPPPP 963 PP + P P PPPPP Sbjct: 471 PPSSGDHVTLLPPPPPPPPP 490 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P PP S P P PPP P Sbjct: 707 PPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 35.5 bits (78), Expect = 0.054 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S + P P PP PP PP Sbjct: 694 PPPPMQHSTVTKVPPPPPPAPPAPP 718 Score = 35.1 bits (77), Expect = 0.071 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PP SP P P PPPPP PP Sbjct: 717 PPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 31.9 bits (69), Expect = 0.66 Identities = 30/124 (24%), Positives = 32/124 (25%), Gaps = 2/124 (1%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 PP P + PPP A PP P H SPP PP Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTS-------------------SPPPPP 731 Query: 778 PPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPP--PPXXXSXXSPXPXPXP 951 PPP P PP PP + P P Sbjct: 732 PPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPP 791 Query: 952 PPPP 963 PPPP Sbjct: 792 PPPP 795 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +1 Query: 901 PPPXXXSXXSPX-PXPXPPPPPXP 969 PPP S P P P PPPPP P Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPP 697 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 3/28 (10%) Frame = +1 Query: 898 PPPPXXXSXXSPX---PXPXPPPPPXPP 972 PPPP + +P P PPPPP PP Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPP 736 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP PP P PP P Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPP 758 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P PPP P Sbjct: 689 PPPP----PPPPPMQHSTVTKVPPPPPPAPP 715 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S PPPPP PP Sbjct: 691 PPPPPPPMQHSTVTKVPPPPPPAPP 715 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P PP S P P PPPPP P Sbjct: 715 PAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 876 PPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 P PPP P PP + P P PP P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPP 718 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +3 Query: 873 PPPPPPXXPXPP----XXXXXLXSXPXXPXXPP 959 PPPPPP P PP + S P P PP Sbjct: 729 PPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPP 761 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 770 PPPPTA--PPPPPLGQTRAPSAPPPPPP 795 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 902 PPPPPXPXXLPXXXPXXPPPXXP 970 PP PP P LP PPP P Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAP 776 Score = 24.2 bits (50), Expect(2) = 6.4 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = -1 Query: 471 PPPPPPXX*XKKPXXXGGGEXXXXXXKPAGXVXPXPP 361 PPPPPP P G PA P P Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLP 764 Score = 22.6 bits (46), Expect(2) = 6.4 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -1 Query: 474 SPPPPPP 454 SPPPPPP Sbjct: 726 SPPPPPP 732 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPP PP P PPP P Sbjct: 25 PPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLPP 57 Score = 26.6 bits (56), Expect(4) = 0.001 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP S S P PPPPP Sbjct: 11 PPPPPPPSFRS---IPRPPPPP 29 Score = 26.2 bits (55), Expect(2) = 3.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPP P PPP P Sbjct: 14 PPPPSFRSIPRPPPPP 29 Score = 23.8 bits (49), Expect(4) = 0.001 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 +PP PPPPP Sbjct: 8 TPPPPPPPP 16 Score = 23.4 bits (48), Expect(4) = 0.001 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 949 PPPPPXPP 972 PPPPP PP Sbjct: 50 PPPPPLPP 57 Score = 23.0 bits (47), Expect(4) = 0.001 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 9 PPPPPPPPP 17 Score = 21.8 bits (44), Expect(2) = 3.2 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 902 PPPPPXPXXLP 934 PPPPP P P Sbjct: 50 PPPPPLPPARP 60 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +1 Query: 898 PPPPXXXSXXSPXPX----PXPPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXP----XPPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPP 341 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P L P PPP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPP--PPP 328 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 878 PPPPXXXXPP---PPPXPXXLPXXXPXXPPPXXP 970 PPPP PP PP P + P PPP P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPPP P + P P PPP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXL-----PXXXPXXPPPXXP 970 PPP PPPPP P L P PPP P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPP 339 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 928 SPXPXPXPPPPPXPP 972 SP P P PPPPP P Sbjct: 26 SPLPLPPPPPPPLKP 40 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/65 (27%), Positives = 21/65 (32%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 PP + A PP + PP P P P +PP PP Sbjct: 286 PPKRSISLGDSTENRADPPPQKSIPPPPPPPPPPLLQQPPPPPSVSK-------APPPPP 338 Query: 778 PPPXP 792 PPP P Sbjct: 339 PPPPP 343 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 904 PPXXXSXXSPXPXPXPPPPPXP 969 P + P P P PPPPP P Sbjct: 16 PSTKKTKDMPSPLPLPPPPPPP 37 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P P P PPP Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPP 140 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P P PPP P Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P PPP P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTP 127 Score = 34.7 bits (76), Expect = 0.094 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +2 Query: 875 PPPPPXXXXPP-----PPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP PPP P P P PP P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPP-PXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P P P PP P Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTP 153 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPP---PPXPXXLPXXXPXXPPP 961 PPPPP PPP P P P P PPP Sbjct: 145 PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 878 PPPPXXXXPP---PPPXPXXLPXXXPXXPPPXXP 970 PPPP PP PPP P P P PP P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 33.5 bits (73), Expect = 0.22 Identities = 20/73 (27%), Positives = 21/73 (28%), Gaps = 3/73 (4%) Frame = +1 Query: 763 PPXPP---PPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSP 933 PP PP PPP P PPPP + P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Query: 934 XPXPXPPPPPXPP 972 P P P PP PP Sbjct: 157 TPTPEAPCPPPPP 169 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P P PP P Sbjct: 68 PPPPYIPCPPPPYTPKP-PTVKPPPPPYVKP 97 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXP-XXPPPXXP 971 PPPPP P PP P P PPP P Sbjct: 145 PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP + +P P P P P P PP Sbjct: 153 PPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPP---PPXPP 972 PPPP P P PPP PP PP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXP---PPPPXPXXLPXXXPXXPPPXXP 970 PP PP P P PP P P PPP P Sbjct: 48 PPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTP 82 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +2 Query: 875 PPPPPXXXXPP----PPPXPXXLPXXXPXXPPPXXP 970 P PP PP PPP P P P PP P Sbjct: 82 PKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +2 Query: 875 PPPP---PXXXXPPPPPXPXXLPXXXPXXP 955 PPPP P PPPPP P P P Sbjct: 153 PPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP P PPP P P P PPP Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP PPP P LP P PP P Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPPPPSHQP 42 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP S P PPPPP PP Sbjct: 30 PPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P PP S P P P PPP PP Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVPPP 36 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P PP P PPP P Sbjct: 22 PPPPPPSLP-PPVPPPPPSHQPYSYPPPPPPPP 53 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPP--PPPXPP 972 PP P S S P P PP PPP PP Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPP 35 Score = 28.7 bits (61), Expect = 6.2 Identities = 20/73 (27%), Positives = 22/73 (30%), Gaps = 7/73 (9%) Frame = +1 Query: 595 RPPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXP 774 RPP P S APPP + P P P + P P P Sbjct: 5 RPPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 Query: 775 -------PPPPXP 792 PPPP P Sbjct: 65 QFNQLQAPPPPPP 77 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +2 Query: 875 PPPP---PXXXXPPPPPXPXXLPXXXPXXP 955 PPPP P PPPPP P P P Sbjct: 35 PPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPP P P P P PPP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P P P PPPPP P P P PPP P Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P PPP P P P PPP P Sbjct: 65 PPPPPCPPPPSPPPCPPP-PSPPPSPPPPQLP 95 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPP-PPPXPP 972 PPPP SP P P PP PPP PP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P PPP P P LP P PPP P Sbjct: 76 PPPCPPPPSPPPSPPPPQLP-PPPQLPPPAPP 106 Score = 36.3 bits (80), Expect = 0.031 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 875 PPPPPXXXXPPPP--PXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P LP P P P P Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 35.9 bits (79), Expect = 0.041 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPP PP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPP 87 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P PPP P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 Score = 34.7 bits (76), Expect = 0.094 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P P PPP P Sbjct: 62 PPPPPPPPCPPPPSPP--PCPPPPSPPPSPP 90 Score = 33.5 bits (73), Expect = 0.22 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P P PPPPP PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPP 69 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P P P PPPP PP Sbjct: 72 PPPSPPPCPPPPSPPPSPPPPQLPP 96 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P P PPPPP P P P PPP P Sbjct: 56 PEPADCPPPPPPPPCPPP-PSPPPCPPPPSPP 86 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXP-PPPPXPP 972 PPP P P P P PPPP PP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PPP PPP P P P P P P Sbjct: 87 PSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P PP SP P P PP P PP Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P PP SP P PPPP PP Sbjct: 78 PCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 30.7 bits (66), Expect(2) = 0.008 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPP--PPPXPP 972 PPPP P P PP PPP PP Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P P P P P PPP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSP 76 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P P P P P PPPP PP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPP 78 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PP P P P PPPPP P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCP 71 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/26 (46%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXP-PPPPXPP 972 P P + P P P P PPPP PP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPP 77 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPP-PPPXPP 972 PPPP P P P PP PPP PP Sbjct: 62 PPPPP------PPPCPPPPSPPPCPP 81 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPPP P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLP 95 Score = 26.6 bits (56), Expect(2) = 0.008 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 676 PPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PP P P P SPP PPPP P Sbjct: 47 PPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 26.2 bits (55), Expect(2) = 1.5 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P P PPP P P Sbjct: 85 PPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P P PP Sbjct: 89 PPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 S +P P PP P P P PP PPPP P Sbjct: 49 SPSPEPEPEPADCPPPPPPPPCPP-----PPSPPPCPPPPSPPPSPPPPQLP 95 Score = 23.0 bits (47), Expect(2) = 1.5 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +1 Query: 646 PPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PPP P P P P PP PPP P P Sbjct: 46 PPPSPSPE---PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPP 91 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +1 Query: 583 RAXGRPPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXS 762 RA PP P PPP G + PP P P P G Sbjct: 531 RAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGP 590 Query: 763 PPXPPPPP 786 PP PPP P Sbjct: 591 PPPPPPMP 598 Score = 39.1 bits (87), Expect = 0.004 Identities = 35/156 (22%), Positives = 39/156 (25%) Frame = +1 Query: 493 PXXTPPPPXXXXXAXXXXXXXTXIFFLGXXRAXGRPPXXPXKXXXXFXSXAPPPXXGARX 672 P P PP T F + PP P PPP A Sbjct: 475 PPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAV 534 Query: 673 XPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXPXXXXLXXXXFXXXXXXXXXX 852 PP P P P G +PP PPPPP Sbjct: 535 APPPPPPPPGTAAAPPPPPPPPG---TQAAPPPPPPPPMQNRAP-SPPPMPMGNSGSGGP 590 Query: 853 XXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPP 960 PPPP + + P PPPP Sbjct: 591 PPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P P PPP Sbjct: 527 PPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P P PPP Sbjct: 540 PPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 36.3 bits (80), Expect = 0.031 Identities = 34/130 (26%), Positives = 36/130 (27%), Gaps = 5/130 (3%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 PP P APPP PP P F P +PP PP Sbjct: 458 PPPPPPPAVMPLKHFAPPPPP---PLPPAVMP--LKHFAPPPPTPPAFKPLKGSAPPPPP 512 Query: 778 PPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPX--- 948 PPP P PPPP + P P P Sbjct: 513 PPPLPTTIAAPPPP-------------PPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQ 559 Query: 949 --PPPPPXPP 972 PPPPP PP Sbjct: 560 AAPPPPPPPP 569 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P P PPP Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P P PPP Sbjct: 539 PPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 35.9 bits (79), Expect = 0.041 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = +1 Query: 763 PPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPX 942 PP PPPPP P + PPPP P Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAP- 474 Query: 943 PXPPPPPXPP 972 PPPPP PP Sbjct: 475 --PPPPPLPP 482 Score = 35.9 bits (79), Expect = 0.041 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPPP PPPP P + P PP Sbjct: 552 PPPPPGTQAAPPPPPPPPMQNRAPSPPP 579 Score = 35.1 bits (77), Expect = 0.071 Identities = 32/136 (23%), Positives = 32/136 (23%), Gaps = 11/136 (8%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGA-----RXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXS 762 PP F PPP A PP P P P Sbjct: 461 PPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTI 520 Query: 763 PPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPX 942 PPPPP P PPPP SP P Sbjct: 521 AAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPM 580 Query: 943 PXP------PPPPXPP 972 P PPPP PP Sbjct: 581 PMGNSGSGGPPPPPPP 596 Score = 34.7 bits (76), Expect = 0.094 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXX---PPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPP 542 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +2 Query: 875 PPPPPXXXXP-----PPPPXPXXLPXXXPXXPPPXXP 970 PPP P P PPPP P LP PPP P Sbjct: 493 PPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPP 529 Score = 33.5 bits (73), Expect = 0.22 Identities = 21/71 (29%), Positives = 23/71 (32%) Frame = +1 Query: 760 SPPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXP 939 S P PPPPP P + F PPPP + P Sbjct: 452 SMPPPPPPPPPPPAVMPLKHF------APPPPPPLPPAVMPLKHFAPPPPTPPA-FKPLK 504 Query: 940 XPXPPPPPXPP 972 PPPPP PP Sbjct: 505 GSAPPPPPPPP 515 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P P + P P PP P Sbjct: 454 PPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMP 486 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = +2 Query: 875 PPPPPXXXX------PPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P + PPP P Sbjct: 460 PPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTP 497 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 876 PPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPP P PP S P PPP P Sbjct: 416 PPPPPPPPPPPLSFIKTASLPL--PSPPPTPP 445 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXX-PXXPPPXXP 970 PPPP P PPP P P PPP P Sbjct: 566 PPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMP 598 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P P P + PPP P Sbjct: 564 PPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP 595 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXX---PPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P PPP P Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 873 PPPPPP---XXPXPPXXXXXLXSXPXXPXXPP 959 PPPPPP P PP + P P PP Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +3 Query: 873 PPPPPP---XXPXPPXXXXXLXSXPXXPXXPP 959 PPPPPP P PP + P P PP Sbjct: 538 PPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +2 Query: 875 PPPPPXXXXPP----PPPXPXXLPXXXPXXPPPXXP 970 PPPPP P PPP P P PPP P Sbjct: 508 PPPPPPPPLPTTIAAPPPPPP--PPRAAVAPPPPPP 541 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 34.7 bits (76), Expect(2) = 0.004 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPPP P Sbjct: 13 PPPPPRLLVLPPLPPPPPPPPPQLP 37 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP PP L P P PPP P Sbjct: 9 PPPPPP----PPPRLLVLPPLPPPPPPPPPQLP 37 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 884 PPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PPPPP P L P PPP P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPP 32 Score = 31.9 bits (69), Expect(2) = 0.028 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP P P PPPPP P Sbjct: 11 PPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 31.1 bits (67), Expect(2) = 0.063 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P PPPPP PP Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PP PP P P P P P Sbjct: 14 PPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 881 PPPXXXXPPPPPXP--XXLPXXXPXXPPP 961 P PPPPP P LP P PPP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPP 32 Score = 23.4 bits (48), Expect(2) = 0.004 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 763 PPXPPPPP 786 PP PPPPP Sbjct: 9 PPPPPPPP 16 Score = 23.4 bits (48), Expect(2) = 0.028 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 763 PPXPPPPP 786 PP PPPPP Sbjct: 10 PPPPPPPP 17 Score = 23.0 bits (47), Expect(2) = 0.063 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 9 PPPPPPPPP 17 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 35.5 bits (78), Expect(2) = 0.005 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXP 969 PPP S P P P PPPPP P Sbjct: 69 PPPPKKSSCPPSPLPPPPPPPPP 91 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PP P S P P PPPPP PP Sbjct: 66 PPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 33.5 bits (73), Expect = 0.22 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +1 Query: 898 PPPPXXXSXX-SPXPXPXPPPPP 963 PPPP S SP P P PPPPP Sbjct: 69 PPPPKKSSCPPSPLPPPPPPPPP 91 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P P P P Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP S P P PP PP P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPP 72 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 P PPPP P P P P PPP Sbjct: 62 PSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 876 PPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 P PPP P PP S P P PPP P Sbjct: 62 PSPPPPSPPPPKKS----SCPPSPLPPPPPPP 89 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP P PP P P PP P Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLP 83 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PPP P PPP P P P P Sbjct: 53 PSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPP 84 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPP PP Sbjct: 64 PPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 22.6 bits (46), Expect(2) = 0.005 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PP PP P Sbjct: 49 PPPPPSPPPP 58 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PP PP P P P PPP Sbjct: 265 PPPPPAAAPPPQPPPP---PPPKPQPPPP 290 Score = 35.1 bits (77), Expect = 0.071 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPP---PPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PP PPPPP P P PPP P Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPP PPP P P P P PP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP + P P P PPP P PP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPP 288 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P P P P PP Sbjct: 266 PPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P P Sbjct: 278 PPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 884 PPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PPPPP P P PP P Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQP 287 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP + P P PP P PP Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPP 289 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P P P P PP PP Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 29.5 bits (63), Expect(3) = 0.005 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPP PP Sbjct: 277 PPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 25.8 bits (54), Expect(3) = 0.005 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 274 PPQPPPPPPP 283 Score = 21.0 bits (42), Expect(3) = 0.005 Identities = 9/28 (32%), Positives = 10/28 (35%) Frame = +1 Query: 610 PXKXXXXFXSXAPPPXXGARXXPPXPXP 693 P K + PPP PP P P Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPP 282 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 34.7 bits (76), Expect(2) = 0.006 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXP--XPPPPPXPP 972 PPPP S SP P PPPPP PP Sbjct: 27 PPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P + PPP Sbjct: 640 PPPPSMSGGAPPPPPPPPMLVASRTAPPP 668 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP PPPP P Sbjct: 151 PPPPPMPRRSPPPPPP 166 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP P P P P PPP Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P P P PP P Sbjct: 25 PPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 23.0 bits (47), Expect(2) = 0.006 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 22 PLPPPPPPP 30 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPP P P P P P P P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P P P PPPP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPP 88 Score = 34.7 bits (76), Expect = 0.094 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP SP P PPP P PP Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P PP P P PPP P Sbjct: 64 PPPPPPTSPPPPSPP---PPSPPPPSPPPPSPP 93 Score = 33.1 bits (72), Expect(2) = 0.022 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P P P PPPP PP Sbjct: 72 PPPP---SPPPPSPPPPSPPPPSPP 93 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP SP P PPP P PP Sbjct: 72 PPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +3 Query: 873 PPPPPPXXPXP-PXXXXXLXSXPXXPXXPPP 962 PPPPP P P P P P PPP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 22.6 bits (46), Expect(2) = 0.022 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPP P Sbjct: 68 PPTSPPPPSP 77 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGGG GGGGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGGG GGGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGGGG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGG G GGGGG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 R GGG G G G GGGGG G GGG Sbjct: 66 RWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G GGGG Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G GGGG Sbjct: 76 GGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G GGGG Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G GGGG Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G GGGGG GGGGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGG 91 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGGG G GGG Sbjct: 81 GGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGGG G GG Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGGG Sbjct: 82 GGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GGGGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 R GG G GGGGG GGGGG Sbjct: 56 RSYNGGSGSYRWGWGGGGGGGGGGGGGGGGGGG 88 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PPP P Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P + PP P Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PPPPP P P P PPP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P PPPPP P P P PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 42 PPPPPPPPP--PPPPPPPPPPPPPP 64 Score = 34.7 bits (76), Expect = 0.094 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPPP P PP + P PPP Sbjct: 51 PPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PP S P P P PPPPP PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPP 58 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P P PPP Sbjct: 42 PPPPP----PPPPPPPP--PPPPPPPPPP 64 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP PPP P LP P PPP P Sbjct: 93 PPQPPPRSQPPPKPPQKNLPRRHP--PPPRSP 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/68 (27%), Positives = 19/68 (27%) Frame = +1 Query: 760 SPPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXP 939 SPP PPPPP P PPPP P Sbjct: 41 SPPPPPPPPPPPPPP-----------PPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLS 89 Query: 940 XPXPPPPP 963 P PP PP Sbjct: 90 SPPPPQPP 97 Score = 29.1 bits (62), Expect = 4.7 Identities = 19/70 (27%), Positives = 19/70 (27%) Frame = +1 Query: 763 PPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPX 942 PP PPPPP P PPPP P Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQ--------PP 97 Query: 943 PXPPPPPXPP 972 P PPP PP Sbjct: 98 PRSQPPPKPP 107 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP PP P P P PPP P Sbjct: 1092 PPPPPAALFPPLPPPPSQ-PPPPPLSPPPSPP 1122 Score = 35.1 bits (77), Expect = 0.071 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPPPP PP Sbjct: 1104 PPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPP P PPPP P P P PP Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP PP PPPPP P P PPP Sbjct: 1101 PPLPPPPSQPPPPPLSPP-PSPPPPPPPP 1128 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P PPPPP P P PP P Sbjct: 1084 PPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPPPP P Sbjct: 1093 PPPPAALFPPLPPPPSQPPPPPLSP 1117 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +1 Query: 643 APPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 +PPP P P F P PP PPPPP P Sbjct: 1078 SPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P PP PP P P P PP P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLP 1092 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PP P S P P PP PP PP Sbjct: 1101 PPLPPPPSQPPPPPLSPPPSPPPPP 1125 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP PP PPPP P LP PPP Sbjct: 1070 PPLPPLPPSPPPPSPP--LPPSSLPPPPP 1096 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 P PPPP P PP P PPP Sbjct: 1077 PSPPPPSPPLPPSSLPPPPPAALFPPLPPP 1106 Score = 29.1 bits (62), Expect = 4.7 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 PP P S PPP A PP P P P SPP PP Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAA-LFPPLPPPPSQPPPPPLSPPP---------SPPPPP 1125 Query: 778 PPP 786 PPP Sbjct: 1126 PPP 1128 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP P P P P PPP P Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQP 1110 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P P PPPP PP Sbjct: 1094 PPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP P PP P LP P P P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPPPPAALFPPLP 1104 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 3/33 (9%) Frame = +3 Query: 873 PPPPPPXXP---XPPXXXXXLXSXPXXPXXPPP 962 PPP PP P PP P P PPP Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPP 1112 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P L P PPP Sbjct: 98 PPPQ---PPPPPQPLNLFSPPPPPPPP 121 Score = 31.1 bits (67), Expect(2) = 0.010 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP + SP P PPPPP P Sbjct: 103 PPPPQPLNLFSPPP---PPPPPDP 123 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P PPPPP PP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPP 121 Score = 25.8 bits (54), Expect(2) = 0.010 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 99 PPQPPPPPQP 108 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G+ G GGGGG GGGGG Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 +G GGG + GGGGG GGGGG Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G GG G GGGGGG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGG 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G GG G GGGGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGG 134 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG + GG G GGGGGG Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG + GG G GGGGGG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 37.5 bits (83), Expect = 0.013 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G+ G GGGGG GGGGG Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGG 138 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 +G GGG + GGGGG GGGGG Sbjct: 104 KGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G GG G GGGGGG Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGG 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G GG G GGGGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGG 134 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG + GG G GGGGGG Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GGG G G G GG G GGGG Sbjct: 315 GGGGPGGKKGGPGGGGGNMGNQNQGGGG 342 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG + GG G GGGGGG Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PPP P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPP 546 Score = 35.9 bits (79), Expect = 0.041 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 527 PPPPPPVYSPPPPP-PVHSPPPPVHSPPP 554 Score = 35.9 bits (79), Expect = 0.041 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXPPP---PPXPXXLPXXXPXXPPPXXP 970 PPPPP PPP PP P P PPP P Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P PPP Sbjct: 519 PPPPPVYSPPPPPPVYSPPPPPPVHSPPP 547 Score = 34.7 bits (76), Expect = 0.094 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P P P PP P Sbjct: 493 PPPPPV--HSPPPPSPIHSPPPPPVYSPPPPP 522 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSP 559 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P PPP P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 878 PPPPXXXXPPP---PPXPXXLPXXXPXXPPPXXP 970 PPPP PPP PP P P P PP P Sbjct: 632 PPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPPP PPP PP P P PPP Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 568 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPPP PPP PP P P PPP Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPP 648 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P P P P Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 878 PPPPXXXXPP----PPPXPXXLPXXXPXXPPPXXP 970 PPPP PP PPP P P P PP P Sbjct: 639 PPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLP 673 Score = 31.9 bits (69), Expect = 0.66 Identities = 27/113 (23%), Positives = 29/113 (25%), Gaps = 3/113 (2%) Frame = +1 Query: 643 APPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXPXXXXLXXXXF 822 +PPP PP P H P SPP P P P + Sbjct: 526 SPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVY 585 Query: 823 XXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPP---PXPP 972 PPP S P P PPPP P PP Sbjct: 586 SPPPPPVHSPPPPVHSPPPPVHS---PPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P PP P Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSP 639 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +2 Query: 878 PPPPXXXXPPP---PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P P PP Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPP 596 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 878 PPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPP 604 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPP---PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 580 PPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPP 611 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP L PP P Sbjct: 653 PPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTP 684 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +1 Query: 898 PPPPXXXSXXSPXPX--PXPPP---PPXPP 972 PPPP S P P P PPP PP PP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPP 522 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +1 Query: 898 PPPPXXXSXXSPXPX--PXPPPP---PXPP 972 PPPP S P P P PPPP P PP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPP 539 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 5/30 (16%) Frame = +1 Query: 898 PPPPXXXSXXSPXPX--PXPPPP---PXPP 972 PPPP S P P P PPPP P PP Sbjct: 519 PPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP SP P P PPP PP Sbjct: 501 PPPPSPIH--SPPPPPVYSPPPPPP 523 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 529 PPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 5/33 (15%) Frame = +2 Query: 878 PPPPXXXXP-----PPPPXPXXLPXXXPXXPPP 961 PPPP P PPPP P P PPP Sbjct: 602 PPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPP 641 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPP P PP P PPP Sbjct: 519 PPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPP P P PP P Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSP 595 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPPP P PP P Sbjct: 580 PPPPVYSPPPPPVHSPPPPVHSPPPPVHSP 609 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP-XXPPPXXP 970 PPPPP P PP P P PPP P Sbjct: 661 PPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTP 693 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPP P PP P PPP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPP 539 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P PP P Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 566 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPP P P P PP Sbjct: 646 PPPPVYSPPPPPVKSPPPPPVYSPPLLPP 674 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPP---PPXPP 972 PPP S P P PPP PP PP Sbjct: 639 PPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPP PP Sbjct: 646 PPPPVYSPPPPPVKSPPPPPVYSPP 670 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 37.1 bits (82), Expect = 0.018 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P P PPP Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPP P P P PPP Sbjct: 535 PPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P P PPP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPP 552 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPPP PPP PP P P PPP Sbjct: 559 PPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPP 591 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPP---PPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PP PPPP P P PPP P Sbjct: 583 PPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPP---PPXPP 972 PPPP S P P PPP PP PP Sbjct: 535 PPPPPVHSPPPPVHSPPPPPVYSPPPPP 562 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPP P PP P PPP P Sbjct: 613 PPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P PP P Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSP 589 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP PP + S P P PP P Sbjct: 533 PPPPPPPVHSPP---PPVHSPPPPPVYSPPPPP 562 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P P PP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPP 569 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P P PPP Sbjct: 605 PPPPVHSPPPPP-PVYSPPPPVFSPPP 630 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP P P PPPPP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPP 554 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP P P PPPPP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPP 564 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPP 623 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPP---PXPP 972 PPPP P P PPPP P PP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPP---PXPP 972 PPPP P P PPPP P PP Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 4/34 (11%) Frame = +2 Query: 881 PPPXXXXPPP----PPXPXXLPXXXPXXPPPXXP 970 PPP PPP PP P P PPP P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPP---PPPXPXXLPXXXPXXPPP 961 PPPP PP PPP P P P PPP Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSP---PPPPPP 564 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP S P P PPPP Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPP 571 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 28.7 bits (61), Expect = 6.2 Identities = 30/116 (25%), Positives = 30/116 (25%), Gaps = 9/116 (7%) Frame = +1 Query: 652 PXXGARXXPPXPX--PHXXXXFXXXXPXXGXGXXXXXXSPPXPP----PPPXPXXXXLXX 813 P R PP P P P SPP PP PPP P Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPP 570 Query: 814 XXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPP---PXPP 972 F PPP S P P PPPP P PP Sbjct: 571 PVFSPPPPVYSPPPPVHSPPPPVHSP--PPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP P PPP P P PPP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPP 546 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPP P P PPP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 36.3 bits (80), Expect = 0.031 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP PP P P P P P Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 34.7 bits (76), Expect = 0.094 Identities = 31/125 (24%), Positives = 33/125 (26%), Gaps = 4/125 (3%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXX----GARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSP 765 PP K F + PPP R PP P F P + Sbjct: 441 PPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAY 500 Query: 766 PXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXP 945 P PPPPP PPPP S P P P Sbjct: 501 PPPPPPP-----EYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYS-SPPPPSP 554 Query: 946 XPPPP 960 PPPP Sbjct: 555 SPPPP 559 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P PPP Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPP 531 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPP----PPPXPXXLPXXXPXXPPP 961 PPPPP PP PPP P P PPP Sbjct: 675 PPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 707 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPPPP P PPPP P P PPP Sbjct: 704 PPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPP 736 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P P PPP Sbjct: 540 PPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPPXXP 970 PPP P P PPPP P P PPP P Sbjct: 719 PPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTP 754 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PPPPPXXXX--PPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P P PPP Sbjct: 607 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPP 637 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PPPPPX--XXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P P PPP Sbjct: 620 PPPPPTYYAVQSPPPPPPVYYPPVTASPPPP 650 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 873 PPPPP--PXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPP P P PP P P PPP Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPP 559 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 4/29 (13%) Frame = +1 Query: 898 PPPPXXXSXXS----PXPXPXPPPPPXPP 972 PPPP S P P P PPPP PP Sbjct: 513 PPPPSSEMSPSVRAYPPPPPLSPPPPSPP 541 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPP 958 PPPPP P PPPP P P PP Sbjct: 661 PPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPP 692 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPPPP P PPPP P PPP Sbjct: 633 PPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P PP S SP PPPPP P Sbjct: 511 PSPPPPSSEMSPSVRAYPPPPPLSP 535 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPPPP P PPPP P PPP Sbjct: 647 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPP 679 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 8/40 (20%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP--------XXLPXXXPXXPPPXXP 970 PPPPP P PP P P P PPP P Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSP 540 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPP P PP + PPP P Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSP 535 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP S SP PPPPP P Sbjct: 486 PPPPS--SKMSPSVKAYPPPPPPP 507 Score = 28.7 bits (61), Expect(2) = 0.021 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +1 Query: 610 PXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 P + S PPP A PP P P P SPP PP Sbjct: 596 PSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPP----PXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP P PPPPP P PPP Sbjct: 648 PPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 680 Score = 27.1 bits (57), Expect(2) = 0.021 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S + P P PPP PP Sbjct: 662 PPPPVYYSPVTQSP-PPPPPVYYPP 685 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 875 PPPPPX--XXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P PPP P Sbjct: 32 PPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +1 Query: 646 PPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PPP R P P P P +PP PPPPP P Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPX----XXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 6/31 (19%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPX------PPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 33 PPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P LP P PP Sbjct: 46 PPPPLMRRRAPPPPPPPPLP--RPCSRPP 72 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP +P P P PPP P P Sbjct: 45 PPPPPLMRRRAPPPPP-PPPLPRP 67 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGGG G GGG Sbjct: 98 GDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGG 129 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G G GG GG G GGG Sbjct: 114 GGGGGGGDTGAGAGGGGYGGGGDTGAGGG 142 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGG GGG G Sbjct: 113 GGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G G G G GGGG Sbjct: 105 GGYGGGTPGGGGGGGGDTGAGAGGGGYGGGG 135 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 P PPPP P PP S P P PPP P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLP--PPPPPPHLP 72 Score = 29.5 bits (63), Expect(2) = 0.028 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P PPPPP P Sbjct: 48 PPPPPPPLYFSYFSLPPPPPPPHLP 72 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 42 PHPPPPPPPPPP 53 Score = 28.3 bits (60), Expect(2) = 0.063 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S S P P PPPP PP Sbjct: 51 PPPPLYFSYFS-LPPP-PPPPHLPP 73 Score = 25.8 bits (54), Expect(2) = 0.028 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 44 PPPPPPPPPP 53 Score = 25.8 bits (54), Expect(2) = 0.063 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 45 PPPPPPPPPP 54 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 6/35 (17%) Frame = +2 Query: 875 PPPPPXXXXP------PPPPXPXXLPXXXPXXPPP 961 PPPPP P PPPP P L P PPP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPP 277 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 P P PPPPP P P PPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PP S P P PPPPP PP Sbjct: 226 PPHVKTDSFEFVKPDPTPPPPPPPP 250 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 905 PPPPXPXXLPXXXPXXPPPXXP 970 PPPP P +P PPP P Sbjct: 243 PPPPPPPPIPVKQSATPPPPPP 264 Score = 28.7 bits (61), Expect(2) = 0.036 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPP 960 PPPP + P P PPPP Sbjct: 259 PPPPPPPKLKNNGPSPPPPPP 279 Score = 27.5 bits (58), Expect(2) = 0.65 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP P PPPPP Sbjct: 244 PPPPPPPIPVKQSATPPPPPPP 265 Score = 26.2 bits (55), Expect(2) = 0.036 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 760 SPPXPPPPPXP 792 +PP PPPPP P Sbjct: 242 TPPPPPPPPIP 252 Score = 23.0 bits (47), Expect(2) = 0.65 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 241 PTPPPPPPP 249 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 35.9 bits (79), Expect = 0.041 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPPPP PP Sbjct: 54 PPPPACAITLKDSPPPPPPPPPPPP 78 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLP 934 PPPPP PPPPP P P Sbjct: 67 PPPPP----PPPPPPPLQQP 82 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 67 PPPPPPPPPPPP 78 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 35.9 bits (79), Expect = 0.041 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPPPP PP Sbjct: 681 PPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P PPPPP P P P PP P Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPP 702 Score = 33.9 bits (74), Expect = 0.16 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXL 931 PPPPP PPPPP P L Sbjct: 690 PPPPPGGGPPPPPPPPGAL 708 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP 946 PPPPP PPPPP P P Sbjct: 681 PPPPPPGGGPPPPPGGGPPPPPPP 704 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPP P P P PPP Sbjct: 679 PPPPPPPPGGGPPPPPGGGP--PPPPPPP 705 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P PPPPP P PPP P Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 35.9 bits (79), Expect = 0.041 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P PPP P Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P P PPP Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSPPP 540 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPP P P PPPP P P P PPP Sbjct: 583 PPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPP 615 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPP P P PPPP P P P PPP Sbjct: 613 PPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPP 645 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPP P P PPPP P P P PPP Sbjct: 628 PPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +2 Query: 875 PPPPPXXXXP-----PPPPXPXXLPXXXPXXPPP 961 PPPP P PPPP P P P PPP Sbjct: 597 PPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPP 630 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 31.5 bits (68), Expect = 0.87 Identities = 27/128 (21%), Positives = 33/128 (25%), Gaps = 3/128 (2%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 PP K + +PPP ++ P + P PP PP Sbjct: 408 PPPPSSKMSPTVRAYSPPPPPSSKMSPSV------RAYSPPPPPYSKMSPSVRAYPPPPP 461 Query: 778 P---PPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPX 948 P PP P + PPP S P Sbjct: 462 PSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSS 521 Query: 949 PPPPPXPP 972 PPPPP P Sbjct: 522 PPPPPPSP 529 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +2 Query: 875 PPPPPXXXXPPPPP-----XPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P P PPP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPP 530 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P P PPP Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPP P P PPPP P P PPP Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPP 675 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P PP P Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPP 488 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPPP P PPPP P P PPP Sbjct: 538 PPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPP P P PPPP P P PPP Sbjct: 553 PPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPP 585 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 475 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 506 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPP P P PPPP P P PPP Sbjct: 568 PPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPP 600 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPPP PP P PPP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPP 486 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P PPP Sbjct: 398 PPPIYVYSSPPPPPSSKMSPTVRAYSPPP 426 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P PPP P Sbjct: 529 PPPPCPESSPPPPVVYYAP--VTQSPPPPSP 557 Score = 27.1 bits (57), Expect(2) = 0.84 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPP---PXPP 972 PPP S P P P PP P P PP Sbjct: 514 PPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 23.0 bits (47), Expect(2) = 0.84 Identities = 19/73 (26%), Positives = 21/73 (28%), Gaps = 5/73 (6%) Frame = +1 Query: 583 RAXGRPPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXS 762 RA PP K + PPP PP + P S Sbjct: 437 RAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPP---PPYVYSS 493 Query: 763 PPXPP-----PPP 786 PP PP PPP Sbjct: 494 PPPPPYVYSSPPP 506 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 35.5 bits (78), Expect = 0.054 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P PPP Sbjct: 143 PPPPPVLLSPPPPPVLFSPPPPTVTRPPP 171 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P PP P Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P PPP Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPPPP 197 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P PP Sbjct: 134 PPPPPVNLSPPPPPVLLSPPPPPVLFSPP 162 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P PP P Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P PP P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPP 75 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PPPPPXXXXPPPP--PXPXXLPXXXPXXPPP 961 PPPPP PPPP P P PPP Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 875 PPPPPXXXXP--PPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P PPP P Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPP 227 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P PP P Sbjct: 143 PPPPPVLLSPPPPPVLFSPPPPTVTRPPPPP 173 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXP--XXPPP 961 PPPP PPPP P P PPP Sbjct: 134 PPPPPVNLSPPPPPVLLSPPPPPVLFSPPP 163 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPP 82 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 144 PPPPVLLSPPPPPVLFSPPPPTVTRPPPP 172 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPP PP P PPP P Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 35.5 bits (78), Expect = 0.054 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGGG GG GG Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGG 39 Score = 35.1 bits (77), Expect = 0.071 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGGGG Sbjct: 19 GGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 33.5 bits (73), Expect = 0.22 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G GR G GGGGG GGGG Sbjct: 12 GGKGGGGGGSGGGR--GGGGGGGAKGGCGGGG 41 Score = 33.1 bits (72), Expect = 0.29 Identities = 28/109 (25%), Positives = 28/109 (25%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGGXXXXXXXXXXXXXXXXXXXXXXXXEKXXXXRXXXX 792 GG G GGG G G G GGGG Sbjct: 17 GGGGSGGGRGGGGGGGAKGGCGGGG--KSGGGGGGGGYMVAPGSNRSSYISRDNFESDPK 74 Query: 791 GXGGGGGXGGEXXXXXXPXPXXGXXXXXXXXLCGXGXGGXXRAPXXGGG 645 G GGGG GG G G G GG GGG Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGG 123 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGG G Sbjct: 104 GKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSG 135 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGGG GGGGG Sbjct: 20 GSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G GG GGGGG Sbjct: 81 GKGGGGGGGISGGGAGGKSGCGGGKSGGGGGG 112 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGG--GXXXXGGGGG 874 G GG G G+ G GGGG G GGGGG Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGG 125 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G GGG G GGGGG Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGG 31 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -1 Query: 957 GGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GG G+ G GG GG GGGGG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGGG 32 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXG--XGGGGGXXXXGGGGG 874 +G GGG G G G GG GG GGGGG Sbjct: 14 KGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGG 48 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GG GGG Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGG 40 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGG 880 +G GGG G G GG GG GGG Sbjct: 74 KGGSGGGGKGGGGGGGISGGGAGGKSGCGGG 104 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -2 Query: 971 GGXG-GGGGXGXGXGXKXXXXXGGGG 897 GG G GGGG G G G GGGG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGG 30 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G G GGGGG Sbjct: 80 GGKGGGGGGGISGGGAGGKSGCGGGKSGGGGG 111 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG GGGGGG Sbjct: 81 GKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGG 113 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GG G G GGGG GGGGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGG 30 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GGG GG Sbjct: 89 GISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGG 121 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG GG G GGG Sbjct: 108 GGGGGGKNGGGCG--GGGGGKGGKSGGGSGGG 137 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GG G G G GGGG GGG Sbjct: 88 GGISGGGAGGKSGCGGGKSGGGGGGGKNGGG 118 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GG G G G GGG GGGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGG 32 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = -2 Query: 971 GGXGG--GGGXGXGXGXKXXXXXGGGG 897 GG GG GGG G G G K GG G Sbjct: 109 GGGGGKNGGGCGGGGGGKGGKSGGGSG 135 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 35.5 bits (78), Expect = 0.054 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 5/64 (7%) Frame = +2 Query: 341 PPXFFXGGGXGXTXPAGXXXXXXXSPPPXXX-GFFXHXXGGGGGGDXXSXSXXQXPP--- 508 PP GGG G P PPP G GGGGGG S + PP Sbjct: 40 PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPPVVV 99 Query: 509 -PPP 517 PPP Sbjct: 100 RPPP 103 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP P P P P PP P Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 873 PPPPPPXXPX-PPXXXXXLXSXPXXPXXPPPXXP 971 PP PPP P PP P P PPP P Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPP 67 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 35.1 bits (77), Expect = 0.071 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP P P P P PP P Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 873 PPPPPPXXPX-PPXXXXXLXSXPXXPXXPPPXXP 971 PP PPP P PP P P PPP P Sbjct: 34 PPVPPPTQPGGPPAWYSNQFHHPHSPSPPPPPPP 67 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 35.1 bits (77), Expect = 0.071 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PPPPPXXXXPPPPP--XPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPPP P PPP P Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSP 90 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PP P P P P PP Sbjct: 77 PPPPPDLTPPPSSPPPPDAPPPIPIVFPP 105 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P PPP P Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSP--PPPDAP 96 Score = 31.1 bits (67), Expect = 1.2 Identities = 29/115 (25%), Positives = 29/115 (25%), Gaps = 5/115 (4%) Frame = +1 Query: 643 APPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXXXL 807 APPP A PP P P S P PP PP P Sbjct: 36 APPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDA 95 Query: 808 XXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP SP P P PPP PP Sbjct: 96 PPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESP-PAP-PPPEQLPP 148 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 118 PPPPEVFEPPPPPADE--DESPPAPPPP 143 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP P PP P P PPP Sbjct: 78 PPPPDLTPPPSSPPPPDAPPPIPIVFPPP 106 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 875 PPPPPX--XXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP PP P LP P P P Sbjct: 126 PPPPPADEDESPPAPPPPEQLP--PPASSPQGGP 157 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 28.3 bits (60), Expect(2) = 0.078 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +1 Query: 664 ARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPP 786 +R PP P P P PP PPPPP Sbjct: 569 SRPPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPP 609 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 876 PPPPPXXPXPPXXXXXLXSXPXXPXXPP 959 PPPPP P L S P P PP Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLPP 628 Score = 26.2 bits (55), Expect(2) = 0.49 Identities = 12/39 (30%), Positives = 12/39 (30%) Frame = +1 Query: 676 PPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PP P P P P PPPPP P Sbjct: 571 PPPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPP 609 Score = 26.2 bits (55), Expect(2) = 0.82 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 8/33 (24%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPX--------PPPPPXPP 972 PPPP +P P PPPPP PP Sbjct: 576 PPPPISSLRSTPSPSSTSNSIATQGPPPPPPPP 608 Score = 25.4 bits (53), Expect(2) = 0.078 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S S P PPP PP Sbjct: 605 PPPPPLQSHRSALSSS-PLPPPLPP 628 Score = 24.6 bits (51), Expect(2) = 0.49 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPP 963 PPP P PPPPP Sbjct: 623 PPPLPPKKLLATTNPPPPPPP 643 Score = 23.8 bits (49), Expect(2) = 0.82 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 760 SPPXPPPPPXP 792 S P PPPPP P Sbjct: 569 SRPPPPPPPPP 579 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 34.7 bits (76), Expect = 0.094 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 RG GGG G GR G GGGGG GGGGG Sbjct: 39 RGASGGGSYG---GRG-GYGGGGGRGNRGGGGG 67 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGG 875 G GGG G G GG G GGGGG Sbjct: 27 GGYGGGDAGYGGRGASGGGSYGGRGGYGGGGG 58 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG GGGGG Sbjct: 27 GGYGGGDAGYGGRGASGGGSYGGRGGYGGGGG 58 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 34.7 bits (76), Expect = 0.094 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 RG GGG G GR G GGGGG GGGGG Sbjct: 39 RGASGGGSYG---GRG-GYGGGGGRGNRGGGGG 67 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGG 875 G GGG G G GG G GGGGG Sbjct: 27 GGYGGGDAGYGGRGASGGGSYGGRGGYGGGGG 58 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG GGGGG Sbjct: 27 GGYGGGDAGYGGRGASGGGSYGGRGGYGGGGG 58 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 34.7 bits (76), Expect = 0.094 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PPPPPXXXXPP--PPPXPXXLPXXXPXXPPP 961 PPPPP P PPP P P P PPP Sbjct: 54 PPPPPVYSRPVAFPPPPPIYSPPPPPIYPPP 84 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 876 PPPPPXX--PXPPXXXXXLXSXPXXPXXPPP 962 PPPPP P PP + S P P PPP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = +2 Query: 875 PPPPPX---XXXPPPPP---XPXXLPXXXPXXPPPXXP 970 PPPPP PPPPP P P P PP P Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPP 79 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 7/36 (19%) Frame = +2 Query: 875 PPPPPXXXXP---PPP----PXPXXLPXXXPXXPPP 961 PPPPP P PPP P P P P PPP Sbjct: 75 PPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 878 PPPPXXXXPP---PPPXPXXLPXXXPXXPPPXXP 970 PPPP PP PPP P P P P P Sbjct: 75 PPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISP 108 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 34.7 bits (76), Expect = 0.094 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPPPP PP Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP PPPPP P Sbjct: 32 PPPPPP---PPPPPPP 44 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 32 PPPPPPPPPPPP 43 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 33 PPPPPPPPPPPP 44 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 34.7 bits (76), Expect = 0.094 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G GR G GGGGG GGGGG Sbjct: 104 GSGSGGRSGSGRGR--GSGGGGGHGGGGGGGG 133 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G G GGG GGGGG Sbjct: 100 GSHAGSGSGGRSGSGRGRGSGGGGGHGGGGGG 131 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 RG GGG G G G GGGGG G G Sbjct: 117 RGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYG 148 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G GGGGG GGGG Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGG 139 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGG 900 GG GGGGG G G G GGG Sbjct: 133 GGRGGGGGSGNGEGYGEGGGYGGG 156 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 R G G G G GGGGG GGG G Sbjct: 110 RSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSG 142 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G G G GG GG Sbjct: 124 GHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGG 155 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 34.7 bits (76), Expect = 0.094 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP PPPPP P LP P P P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYP 91 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPP P P P P PPP Sbjct: 70 PPPPPPQSLPPPSPSPE--PEHYP--PPP 94 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +1 Query: 898 PPPPXXX--SXXSPXPXPXPPPPPXP 969 PPPP + P P P PPPPP P Sbjct: 91 PPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P P P P P PP Sbjct: 70 PPPPPPQSLPPPSPSPEPEHYPPPP 94 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 P PPP PPPPP P Sbjct: 101 PSPPPPRPLPPPPPPP 116 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP SP P PPPP PP Sbjct: 92 PPPYHHYITPSPPPPRPLPPPPPPP 116 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 34.7 bits (76), Expect = 0.094 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P L P PPP Sbjct: 232 PPPPPPHQAQPPPPPPSGL---FPPPPPP 257 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXP 955 PPPPP PPPP P P P Sbjct: 242 PPPPPPSGLFPPPPPPMANNGFRPMPP 268 Score = 28.7 bits (61), Expect(2) = 0.24 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP P P PPPP P Sbjct: 234 PPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 28.3 bits (60), Expect(2) = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 3/25 (12%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPX---PPPPP 963 PPPP P P P PPPPP Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPP 256 Score = 28.3 bits (60), Expect(2) = 2.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP + P P PPP PP Sbjct: 233 PPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 23.4 bits (48), Expect(2) = 0.24 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 763 PPXPPPPP 786 PP PPPPP Sbjct: 230 PPPPPPPP 237 Score = 20.6 bits (41), Expect(2) = 2.0 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 772 PPPPPXP 792 PPPPP P Sbjct: 230 PPPPPPP 236 Score = 20.6 bits (41), Expect(2) = 2.0 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 772 PPPPPXP 792 PPPPP P Sbjct: 231 PPPPPPP 237 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 34.7 bits (76), Expect = 0.094 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGG----GGGXXXXGGGGG 874 G GGG G GR G GG GGG GGGGG Sbjct: 94 GHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 129 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -1 Query: 972 RGXXGGGXXG--XXXGRXXGXGGGGGXXXXGGGGG 874 RG GG G G G G GGG GGGGG Sbjct: 124 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 31.5 bits (68), Expect(2) = 0.11 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP S P P PPPPP Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPP 243 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPP P P P PPP Sbjct: 222 PPP----PPPPSQPLPRPLLLPPPPPP 244 Score = 21.8 bits (44), Expect(2) = 0.11 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 P PPPPP P Sbjct: 219 PLQPPPPPPP 228 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP SP P PPPP PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPP 82 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP PPPP P P PP P Sbjct: 66 PPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPP P PPP P P PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 30.7 bits (66), Expect(2) = 0.12 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP P P PPPPP Sbjct: 64 PPPPSPPPPACPPPPALPPPPP 85 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PP PP P P PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPP--PPXPP 972 PPPP P P PPP PP PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPP P P P PPP Sbjct: 59 PPPPSP---PPPSPPPPACPPPPALPPPP 84 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPP P P PP + P P PPP Sbjct: 59 PPPPSPPPPSPPP-----PACPPPPALPPP 83 Score = 22.6 bits (46), Expect(2) = 0.12 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPP P Sbjct: 61 PPSPPPPSPP 70 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 RG GGG G G GGGGG GGGGG Sbjct: 94 RGGSGGGYRSGGGGGYSG-GGGGGYSGGGGGGG 125 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGGG GGGGG Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 RG GGG G GGGGG GGGG Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 958 GGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 GG G G GG G GGGGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGG-GXXXXGGGGG 874 G GGG G G G GGGG G GGGGG Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 RG GGG G G G GGGGG GGGG Sbjct: 94 RGGFGGGRGGGR-GSGGGYGGGGGGYGGRGGGG 125 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G G GG GG GGGGG Sbjct: 154 GGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G GR G G GGG GGG G Sbjct: 88 GGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYG 119 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G GGGG Sbjct: 156 GGYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 +G GGG G G G GGG G GGGG Sbjct: 83 QGNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGG 115 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GGG G G G G GGG GGGG Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGGG 175 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 961 GGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 GGG G G GG G GGGGGG Sbjct: 154 GGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G G GG GG GGGG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGG 175 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GGGG G Sbjct: 95 GGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRG 127 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G G GGGG G G Sbjct: 162 GGYGGGGGGYGGGGRGGGGGGGSCYSCGESG 192 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP P PPP P +P P PP P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 109 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PPP PP P P P P PP P Sbjct: 62 PVPPPACPPTPPKPQPKPAPPPEPKPAPPPAP 93 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P PPP P P P PP P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP-PXXP 970 PP P P PPP P P P PP P P Sbjct: 43 PPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PP P +P P P P PPP P Sbjct: 35 PPKPQPKPPPAPSPSPCPSPPPKP 58 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPP P P P P P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVP 64 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP P PPP P P P P P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P P P P P P PP Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPP 65 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PP P P P P PPP P P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PP P P P P P PPP P Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPPKP 38 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PP P P P P PPP P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSP 48 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P P PP P P P PP P Sbjct: 90 PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP P P P P P P PP P Sbjct: 40 PKPPPAPSPSPCPSPPPKPQPKPVPPPACPP 70 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P P P PP PP P P P P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 28.7 bits (61), Expect = 6.2 Identities = 26/111 (23%), Positives = 27/111 (24%), Gaps = 1/111 (0%) Frame = +1 Query: 643 APPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSP-PXPPPPPXPXXXXLXXXX 819 APP PP P P P SP P P PPP P + Sbjct: 14 APPGPSSKPVAPPGPSP------CPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPA 67 Query: 820 FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXPP 972 P P P P P P PP PP Sbjct: 68 CPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPP 118 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P PP P P P P PP P Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAP 46 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +2 Query: 875 PPPPPXXXXPPPP-PXPXXLPXXXP---XXPPPXXP 970 PPP P PP P P P P P PPP P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACP 69 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP P PPP P P P P P Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSP 101 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPP-PXPXXLPXXXPXXPPPXXP 970 P P P PP P P P P P PP P Sbjct: 73 PKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP 105 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPP-PXPXXLPXXXPXXPPPXXP 970 PPP P PP P P P P P P P Sbjct: 81 PPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP 113 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 32.3 bits (70), Expect(2) = 0.14 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PP +P P P PPPPP PP Sbjct: 14 PPRLELRRQRAPPPQPPPPPPPPPP 38 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P PP P P PPPPP PP Sbjct: 12 PLPPRLELRRQRAPPPQPPPPPPPP 36 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 P PPP PPPPP P P PP Sbjct: 27 PQPPPPPPPPPPPPPPRLGPRLRLRLLPP 55 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXL 931 PP PP PPPPP P L Sbjct: 26 PPQPPPPPPPPPPPPPPRL 44 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 931 PXPXPXPPPPPXPP 972 P P P PPPPP PP Sbjct: 27 PQPPPPPPPPPPPP 40 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 931 PXPXPXPPPPPXPP 972 P P P PPPPP PP Sbjct: 29 PPPPPPPPPPPPPP 42 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXP 946 PPP PPPPP P P P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPP P PPPPP P Sbjct: 25 PPPQPPPPPPPPPPPP 40 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 902 PPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P L PPP P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPP 30 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 P PPPP P PP L PPP Sbjct: 27 PQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 25.8 bits (54), Expect(2) = 0.39 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 26 PPQPPPPPPP 35 Score = 25.8 bits (54), Expect(2) = 3.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 33 PPPPPPPPPP 42 Score = 25.4 bits (53), Expect(2) = 0.39 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P PPPP P Sbjct: 29 PPPP-------PPPPPPPPPPRLGP 46 Score = 22.2 bits (45), Expect(2) = 3.1 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXP 693 PP P + APPP PP P P Sbjct: 10 PPPLPPRLELR-RQRAPPPQPPPPPPPPPPPP 40 Score = 20.6 bits (41), Expect(2) = 0.14 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 772 PPPPPXP 792 PPPPP P Sbjct: 8 PPPPPLP 14 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 29.9 bits (64), Expect(2) = 0.14 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP +P P PP PP PP Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPP 77 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP P P PPPP P Sbjct: 55 PPPPLPDFAPQPLLPPPSPPPPPP 78 Score = 23.0 bits (47), Expect(2) = 0.14 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 52 PYPPPPPLP 60 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP P PPP P + P PPP Sbjct: 30 PPPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXP-PPPPXPXXLPXXXPXXPPPXXP 970 PPPP P PPPP P P PPP P Sbjct: 44 PPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPX----XXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P P PPP Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 32.7 bits (71), Expect = 0.38 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP P P PPPPP P Sbjct: 55 PPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPPP PPPPP P P PP Sbjct: 24 PPPPP----PPPPPMRRRAPLPPPPPPP 47 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 902 PPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P + P PPP P Sbjct: 25 PPPPPPPPPMRRRAPLPPPPPPP 47 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 P PPP PPPPP P P PPP Sbjct: 22 PLPPP----PPPPPPPMRRRAPLPPPPPP 46 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP P P PPPPP Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPP 47 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 646 PPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PPP PP P P P PP PPPPP P Sbjct: 31 PPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPP-PPPPPLP 78 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 22 PLPPPPPPPPPP 33 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGGG GGGGG Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGG 123 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 RG GGG G GGGGG GGGG Sbjct: 85 RGSGGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 RG GGG G G GGGGG GGGG Sbjct: 94 RGGSGGGYRSGGGGGYSG-GGGGGYSGGGGGG 124 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGG-----GXXXXGGGGG 874 R GGG G G G GGGG G GGGGG Sbjct: 102 RSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGG 139 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXG-GGGGXXXXGGGGG 874 G GGG GR G G GGG GGGGG Sbjct: 135 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G GGG G GGGGG Sbjct: 137 GGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G R G G GGG G GGG Sbjct: 115 GGYSGGGGGGYERRSGGYGSGGGGGGRGYGGG 146 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 958 GGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 GG G G GG G GGGGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -1 Query: 969 GXXGGGXXGXXX-GRXXGXGGGGGXXXXGGGG 877 G GGG G G GGGGG GGGG Sbjct: 116 GYSGGGGGGYERRSGGYGSGGGGGGRGYGGGG 147 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 G GGGGG G G G + GGG Sbjct: 133 GSGGGGGGRGYGGGGRREGGGYGGG 157 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGGG Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 31.9 bits (69), Expect(2) = 0.18 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 968 GXGGGGGXGXGXGXKXXXXXGGGG 897 G GGGGG G G G + GGGG Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGG 421 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G GGGGG GGG G Sbjct: 385 GGGGAGAVTQVMQGCGGGGGGGDGGGGQG 413 Score = 20.6 bits (41), Expect(2) = 0.18 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 Query: 791 GXGGGGGXGGE 759 G G GGG GGE Sbjct: 413 GTGIGGGGGGE 423 >At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEAFY PETIOLE, putative nearly identical to AP2/EREBP-like transcription factor LEAFY PETIOLE [Arabidopsis thaliana] GI:6942018 Length = 211 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PP S SP P PPPPP PP Sbjct: 81 PPSSSVTSIVSPDDPPPPPPPPAPP 105 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P P P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSP 193 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P P P P P P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSP 189 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P PPP P P P P P P Sbjct: 167 PPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSP 198 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP P PP P P P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLP 191 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP-PXXP 970 PPPPP PPPP P P PP P P Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP-PXXP 970 PPPPP PPPP P P PP P P Sbjct: 219 PPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMP 251 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 RG GGG G G G GGG G GGG Sbjct: 108 RGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G G GGGG GGGG Sbjct: 352 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGG 382 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G G GGGG GGGG Sbjct: 434 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGG 464 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 RG GG G G G GG G GGG G Sbjct: 513 RGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAG 545 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 RG GG G G G GGG G GGG Sbjct: 163 RGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGG 194 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GG G G G GGGG GGGG Sbjct: 284 GGVGGSVGGAVGGAVGGAVGGGGGGSVGGGG 314 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 972 RGXXG-GGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 RG G GG G G G G GGG GG GG Sbjct: 465 RGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGG 498 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GG GG GGG G Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVG 429 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGGG G GGG Sbjct: 442 GAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGG 473 Score = 29.9 bits (64), Expect = 2.7 Identities = 29/113 (25%), Positives = 29/113 (25%), Gaps = 3/113 (2%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGGXXXXXXXXXXXXXXXXXXXXXXXXEKXXXXRXXXX 792 GG G GGG G G G G GG Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGG 118 Query: 791 GXGGGGGXGGEXXXXXXPXPXXG---XXXXXXXXLCGXGXGGXXRAPXXGGGA 642 G GGG G GG G G G GG R GGGA Sbjct: 119 GVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGA 171 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGG Sbjct: 83 GGVGGGAGGAIGGGASGGAGGGGKGRGRKGGG 114 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GG GG GGG G Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 196 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GGGG G Sbjct: 352 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 384 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GGGG G Sbjct: 434 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRG 466 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGG-GGXXXXGGGGG 874 G GG G G G GGG GG G GGG Sbjct: 52 GAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGG 84 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G GGG GG GG Sbjct: 62 GVGGGGGGGGGIGGSGGVGAGGG--VGGGAGG 91 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGG G GG G Sbjct: 123 GVGAGGGAGGSVGAGGGIGGGAGGAIGGGASG 154 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG G GG Sbjct: 138 GGIGGGAGGAIGGGASGGVGGGGKGRGGKSGG 169 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG GGGGG Sbjct: 276 GGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGG 307 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G G GGG G GG GG Sbjct: 411 GVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGG 442 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G GR G GGG G GGG Sbjct: 453 GGGGGGSVGGG-GRGSGGAGGGTGGSVGAGGG 483 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -1 Query: 969 GXXGGGXXGXXX-GRXXGXGGGGGXXXXGGGG 877 G GGG G G G GGGGG GGG Sbjct: 468 GGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGG 499 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GG GGG Sbjct: 91 GAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGG 123 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G GR G G GGG G GG Sbjct: 100 GAGGGGKGRGRKGGGGAGGGVGGGVGAGG 128 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGG-GGXXXXGGGGG 874 G GGG G G GGG GG GGG G Sbjct: 154 GGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAG 186 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG G G GG Sbjct: 300 GAVGGGGGGSVGGGGRGSGGASGGASGGASGG 331 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG GGGGG Sbjct: 344 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 375 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG G G GG Sbjct: 368 GAVGGGGGGSVGGGGRGSGGASGGASGGASGG 399 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG GGGGG Sbjct: 426 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 457 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G G G G G GGGGG G GG Sbjct: 48 GVGAGAGGGASGGIGVGGGGGGGGGIGGSGG 78 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G GGGGG GG GG Sbjct: 50 GAGAGGGASGGIGVGGGGGGGGGIGGSGG 78 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G G GGG GG G Sbjct: 178 GVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRG 209 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G G G G G G GGG GGGG Sbjct: 461 GGGGRGSGGAGGGTGGSVGAGGGVGVGGGGG 491 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G G GGG G GG GG Sbjct: 463 GGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGG 494 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 R G G G G G GG G GGGGG Sbjct: 39 RHKHGRGSVGVGAGAGGGASGGIGVGGGGGGGG 71 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G G G GGG GGG Sbjct: 66 GGGGGGGIGGSGGVGAGGGVGGGAGGAIGGG 96 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXX-GXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G GGG GG GG Sbjct: 100 GAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGG 132 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXX-GXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G GGG GG GG Sbjct: 155 GVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGG 187 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG G GGG G G GGGG Sbjct: 177 GGVGAGGGAGGSVGAGGGIGSGGGG 201 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXG-GGGGXXXXGGGGG 874 GGG G G G G G GG GG GG Sbjct: 237 GGGAGGSGGGSVGGGGRGSGGVGASGGAGG 266 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GG GG G GG Sbjct: 395 GASGGASGGASGGASGGVGGAGGAGGSVGAGG 426 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGG---GGXXXXGGGGG 874 G GG G G G GGG GG GG GG Sbjct: 438 GGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGG 472 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 968 GXGGGGGXGXGXGXKXXXXXGGG 900 G GGGGG G G G GGG Sbjct: 485 GVGGGGGIGGGAGGGVGGGVGGG 507 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG G G GG Sbjct: 506 GGVGGGVRGAVGGAVGGGVGGAGRGSGGASGG 537 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GG G GGG G Sbjct: 518 GAVGGGVGGAGRGSGGASGGAGAGGGAGGGVG 549 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGG-GGXXXXGGGGG 874 GGG G G G GGG GG GGGGG Sbjct: 99 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGG 128 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGG--GGGXXXXGGGGG 874 GGG G G G GG GGG GGGGG Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 108 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGG---GGGXXXXGGGGG 874 GGG G G G GG GGG GGGGG Sbjct: 85 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 116 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGGGG Sbjct: 108 GHYGGGGGGHGGGGHYGGGGGG----YGGGGG 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGG 875 G GGG G G GG G GGGGG Sbjct: 63 GHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGG--GGGXXXXGGGG 877 GGG G G G GG GGG GGGG Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGG 121 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GG G G GGGGG GGGG Sbjct: 86 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGG 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GG G G GG G GGGGGG Sbjct: 97 GGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G G G G G G GGGG GGGG Sbjct: 71 GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGG-GXXXXGGGGG 874 G GG G G GGGG G GGGGG Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGG 80 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGGG GGG G Sbjct: 112 GGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGG GGGGG Sbjct: 63 GHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGGG GGG G Sbjct: 100 GGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYG 131 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GG G G G GGGGG GGGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G G GG GG GGGGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGG 87 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 961 GGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 GGG G G GG G GGGGGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGG G G G G GGGG Sbjct: 64 GGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 Query: 961 GGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 GG G G + GG G GGGGGG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 33.5 bits (73), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PP PP P P P PP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPP 603 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +2 Query: 875 PPPPPXXXXP-----PPPPXPXXLPXXXPXXPPP 961 PPPPP P PPPP P P PPP Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPP 627 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP S P P PP PP P Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPP 590 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P PPP P P PPP P Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 878 PPPPXXXXPPPP----PXPXXLPXXXPXXPPP 961 PPPP PPPP P P P PPP Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +2 Query: 878 PPPPXXXXPPPP---PXPXXLPXXXPXXPPP 961 PPPP PPPP P P P PPP Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPP---PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPP 598 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 609 PPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPP P PPP P Sbjct: 559 PPPPVYSSPPPPHVYSPPPPVASPPPPSPP 588 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P PP P Sbjct: 609 PPPPSPVYSPPPPSHSPPPPVYSPPPPTFSP 639 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 5/36 (13%) Frame = +2 Query: 878 PPPPXXXXPPP----PPXPXXLPXXXP-XXPPPXXP 970 PPPP PPP PP P P PPP P Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSP 587 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPP---PXPP 972 PPP S P P PPPP P PP Sbjct: 602 PPPPVFSPPPPSPVYSPPPPSHSPPPP 628 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 5/35 (14%) Frame = +2 Query: 881 PPPXXXXPP-----PPPXPXXLPXXXPXXPPPXXP 970 PPP PP PPP P P P PPP P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPP 192 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P PPPPP PP Sbjct: 172 PPPSPPYFPPEPPSIPPPPPPSPP 195 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G GGG GGGG Sbjct: 170 GHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGG 201 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGG G GGGG Sbjct: 196 GAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGG 880 G GG G G G GGGGG GGG Sbjct: 192 GEGGGAGGGGSHGGAGGYGGGGGGGSGGGG 221 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGG GGGGG Sbjct: 226 GGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGG 257 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGG 900 GG GGGGG G G G GGG Sbjct: 249 GGYGGGGGGGEGGGGSYGGEHGGG 272 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGGGG Sbjct: 105 GEGGGGGYGGAAGGHAGGGGGGS----GGGGG 132 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGG 880 G GG G G G GGGGG GGG Sbjct: 234 GSGGGEGGGYGGGAAGGYGGGGGGGEGGGG 263 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GGG G G G GGGG GGGG Sbjct: 236 GGGEGGGYGGGAAGGYGGGGGGGEGGGG 263 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG G GGG G G G GGGG Sbjct: 231 GGYGSGGGEGGGYGGGAAGGYGGGG 255 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGG 880 G GGG G G G G GGG GGG Sbjct: 258 GEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G GG G GGG Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGG 200 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGG--GGGXXXXGGGGG 874 G GGG G G G GG GGG GG GG Sbjct: 208 GYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGG 241 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G G GGG G GG GG Sbjct: 225 GGGAHGGGYGSGGGEGGGYGGGAAGGYGG 253 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 961 GGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G G G G GG G GGGGGG Sbjct: 148 GAGEGGGAGASGYGGGAYGGGGGHGGGGGG 177 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGG-GGXXXXGGGGG 874 G GG G G G GG GG GGGGG Sbjct: 182 GAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGG 214 Score = 29.5 bits (63), Expect = 3.5 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 1/71 (1%) Frame = -2 Query: 971 GGXGGG-GGXGXGXGXKXXXXXGGGGXXXXXXXXXXXXXXXXXXXXXXXXEKXXXXRXXX 795 GG GGG GG G G GGGG Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGG 250 Query: 794 XGXGGGGGXGG 762 G GGGGG GG Sbjct: 251 YGGGGGGGEGG 261 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GG GGG Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGG 242 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GGGGG Sbjct: 250 GYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGG 880 G GG G G G GGGGG GG Sbjct: 110 GGYGGAAGGHAGGGGGGSGGGGGSAYGAGG 139 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GG G G G G GGG G GG Sbjct: 178 GSAGGAHGGSGYGGGEGGGAGGGGSHGGAGG 208 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGG Sbjct: 241 GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGG 272 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GG G G G GG G GGGGG Sbjct: 98 GGYASGAGEGGGGGYGGAAGGHAGGGGGG 126 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGG 900 GG GGGGG G G GGG Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGG 192 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 961 GGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G G G G GG G GGGGGG Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGG 215 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G G GGG GGG Sbjct: 216 GSGGGGAYGGGGAHGGGYGSGGGEGGGYGGG 246 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGGG G GG Sbjct: 237 GGEGGGYGGGAAGGYGG-GGGGGEGGGGSYGG 267 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGG--GXXXXGGGGG 874 G GG G G G GGGG G GG GG Sbjct: 242 GYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGG 275 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G GGG GGGGG Sbjct: 62 GGGSGEGAGGGYGGAEGYASGGGSGHGGGGGG 93 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G GGGGG GG G Sbjct: 154 GAGASGYGGGAYGGGGGHGGGGGGGSAGGAHG 185 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GGG G G G GGG GG G Sbjct: 161 GGGAYGGGGGHGGGGGGGSAGGAHGGSG 188 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGG 875 G GGG G G GG G GGGG Sbjct: 170 GHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGG 201 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPP 960 PPPP SP P P PPPP Sbjct: 38 PPPPVYSPPISPPPPPPPPPP 58 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP S P P PPPPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 875 PPPPPXXXXP--PPPPXPXXLP 934 PPPPP P PPPP P P Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP PPP Sbjct: 49 PPPPP----PPPPPQSHAAAYKRYSPPPP 73 Score = 26.2 bits (55), Expect(2) = 0.81 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP S + PPPPP Sbjct: 53 PPPPPPQSHAAAYKRYSPPPPP 74 Score = 24.2 bits (50), Expect(2) = 0.81 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 760 SPPXPPPPPXP 792 SPP PPPP P Sbjct: 44 SPPISPPPPPP 54 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPX---PPPPPXPP 972 PPPP P P P PPPPP PP Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPPPPSPP 437 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLP 934 P PPP PPPPP P P Sbjct: 421 PSPPPSPVQPPPPPSPPPQP 440 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP L P PP Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPP 132 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 8/40 (20%) Frame = +2 Query: 875 PPPPPXXXXPPP--------PPXPXXLPXXXPXXPPPXXP 970 PPPPP PPP PP P P P PP P Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPP 108 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPP P PP S P PPP Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPP 133 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P PP P P PP P Sbjct: 112 PPPPPAITPPLSPPPPAITPPPPLATTPPALP 143 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP P PP P P P PP P Sbjct: 131 PPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PP PP P PPP Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPPPP 72 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP +P P P P P P PP Sbjct: 31 PPPPPCICICNPGPPP-PQPDPQPP 54 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPP P P P PP P Sbjct: 94 PPPLSPPQTTPPPPPAITPPPPPAITPPLSP 124 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PPP P PP P P PP P Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP 73 Score = 29.1 bits (62), Expect = 4.7 Identities = 28/130 (21%), Positives = 31/130 (23%), Gaps = 3/130 (2%) Frame = +1 Query: 592 GRPPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPX 771 G PP P + P P + PP P P SPP Sbjct: 43 GPPPPQPDPQPPTPPTFQPAPPANDQPPPP-PQSTSPPPVATTPPALPPKPLPPPLSPPQ 101 Query: 772 PPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXP---PPPXXXSXXSPXPX 942 PPP P P PPP +P P Sbjct: 102 TTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Query: 943 PXPPPPPXPP 972 P PP PP Sbjct: 162 PAITPPLSPP 171 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 878 PPPPXXXXPPPPP---XPXXLPXXXPXXPPPXXP 970 P PP PPPPP P + P PP P Sbjct: 61 PAPPANDQPPPPPQSTSPPPVATTPPALPPKPLP 94 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P PPP P P P PP P Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPP 116 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P PPP P P P PP P Sbjct: 139 PPALPPKPLPPPLSPPQTTPPPPPAITPPLSP 170 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G GGGG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGG 36 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPPP PPP PP P P PPP Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPP 679 Score = 33.1 bits (72), Expect = 0.29 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPP----PPPXPXXLPXXXPXXPPP 961 PPPPP PP PPP P P PPP Sbjct: 751 PPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPP 783 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P P P PP Sbjct: 734 PPPPPV--FSPPPPAPIYSPPPPPVHSPP 760 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP S P P PPPPP Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPP 755 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = +2 Query: 878 PPPPXXXXPPP---PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P P PP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPP 693 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P PPPP P P PP P Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSP 774 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 878 PPPPXXXXPPPP--PXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P P P PP P Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSP 759 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 878 PPPPXXXXPP----PPPXPXXLPXXXPXXPPP 961 PPPP PP PPP P P PPP Sbjct: 670 PPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPP 701 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 878 PPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 677 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 708 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 878 PPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 715 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPP P P P P P Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P P PPP PP Sbjct: 751 PPPPPVHSPPPPVHSPPPPPVHSPP 775 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 878 PPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 759 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 790 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +2 Query: 878 PPPPXXXXPPP----PPXPXXLPXXXPXXPPP 961 PPPP PPP PP P P PPP Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 797 Score = 29.9 bits (64), Expect = 2.7 Identities = 27/113 (23%), Positives = 27/113 (23%), Gaps = 4/113 (3%) Frame = +1 Query: 646 PPPXXGARXXP---PXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-PPPXPXXXXLXX 813 PPP P P P H P SPP P PP P Sbjct: 678 PPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPP 737 Query: 814 XXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXPP 972 F PPPP S P P PP PP Sbjct: 738 PVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 790 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +2 Query: 875 PPPPPXXXXPP--PPPXPXXLPXXXPXXPPPXXP 970 PPPP PP PP P P PPP P Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXP----PPPPXPXXLPXXXPXXPPP 961 PPPP P PPPP P P PPP Sbjct: 788 PPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPP 820 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPP P P PP P Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSP 692 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPPP P PP P Sbjct: 677 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSP 706 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPP P P PP P Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSP 742 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPPP P PP P Sbjct: 759 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSP 788 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP PPPPP P PP P Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSP 670 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPP P PP P Sbjct: 802 PPPPSPIYSPPPPVFSPPPKPVTPLPPATSP 832 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 RG GGG G G G GGGGG GG GG Sbjct: 584 RGGYGGGGGGYGGG--GGYGGGGGYGGGGGYGG 614 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGG 900 GG GGGGG G G G GGG Sbjct: 592 GGYGGGGGYGGGGGYGGGGGYGGG 615 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 33.1 bits (72), Expect = 0.29 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP PPPPP P Sbjct: 108 PPPPPPSPSPPPPPGP 123 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP P P P PPPPP P Sbjct: 107 PPPP-------PPPSPSPPPPPGP 123 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 107 PPPPPPPSPSPP 118 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGG----GGGXXXXGGGGG 874 GGG G GR G GG GGG GGGGG Sbjct: 114 GGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 146 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGGG GGGGG Sbjct: 94 GHRGGGGGGYRSGGGGGYSGGGGSY--GGGGG 123 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXG---GGGGXXXXGGGG 877 RG GGG G G G GGGG GGGG Sbjct: 96 RGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG 130 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -1 Query: 972 RGXXGGGXXG--XXXGRXXGXGGGGGXXXXGGGGG 874 RG GG G G G G GGG GGGGG Sbjct: 141 RGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 29.1 bits (62), Expect = 4.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGG--GGG 874 RG GGG G GGGGG GG GGG Sbjct: 87 RGSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGG 121 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 904 PPXXXSXXSPXPXPXPPPPPXPP 972 PP S +P P P PPPPP P Sbjct: 57 PPPNPSQEAPVPSPYPPPPPPSP 79 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPP P P P PPPPP P Sbjct: 57 PPPNPSQEAPVPSPYP-PPPPPSP 79 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 33.1 bits (72), Expect = 0.29 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP--XXPPPXXP 970 P PPP PPP P LP P PPP P Sbjct: 870 PEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSP 903 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP PPPP LP P PP P Sbjct: 869 PPEPPPEMMPPPPQA---LPPPLPHSHPPLVP 897 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 33.1 bits (72), Expect = 0.29 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G+ GGGGG GGGG Sbjct: 68 GGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G GGGG GGGGG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGG 72 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGG GGGGG Sbjct: 56 GGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Score = 29.5 bits (63), Expect(2) = 0.81 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG G GGG G G K GGGG Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGG 73 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = -2 Query: 971 GGXGGG--GGXGXGXGXKXXXXXGGGG 897 GG GGG GG G G G + GGGG Sbjct: 46 GGEGGGGEGGGGEGGGGQKISKGGGGG 72 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGG GGGGG Sbjct: 57 GEGGGGQKISKGGGGGGSGGGQRSSSGGGGGG 88 Score = 21.0 bits (42), Expect(2) = 0.81 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 791 GXGGGGGXGGE 759 G GGGG GG+ Sbjct: 68 GGGGGGSGGGQ 78 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGG 880 GGG G G G GGGGG GG Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GG G G G GGGGG GGGG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGG----GGGG 233 Score = 28.7 bits (61), Expect(2) = 0.31 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 962 GGGGGXGXGXGXKXXXXXGGGG 897 GGGGG G G G GGGG Sbjct: 211 GGGGGLGGGNGSGGGGGGGGGG 232 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 945 GXXXGRXXGXGGGGGXXXXGGGGG 874 G G G GGG G GGGGG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGG 230 Score = 23.0 bits (47), Expect(2) = 0.31 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 Query: 791 GXGGGGGXGGEXXXXXXP 738 G GGGGG GG P Sbjct: 224 GGGGGGGGGGRISGGSSP 241 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 26.2 bits (55), Expect(2) = 0.32 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP S SP P P P P P Sbjct: 148 PPPPQPESPSSPS-YPEPAPVPAP 170 Score = 25.4 bits (53), Expect(2) = 0.32 Identities = 13/48 (27%), Positives = 13/48 (27%) Frame = +1 Query: 649 PPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PP P P P SP PPPPP P Sbjct: 106 PPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSPSPPPPPPQP 153 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPPP P PPP Sbjct: 105 PPPPPP--PPPPPPPSSTWDFWDPFIPPP 131 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 931 PXPXPXPPPPPXPP 972 P P P PPPPP PP Sbjct: 69 PSPSPPPPPPPRPP 82 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPPP P PP P P PPP Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIP--PPP 132 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 474 SPPPPPPXX*XKKPXXXGGGEXXXXXXKPAGXVXPXPPP 358 SPPPPPP P G E V P PPP Sbjct: 72 SPPPPPPPR-PPPPPLSPGSETTTWTTTTTSSVLPPPPP 109 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 13/45 (28%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP-------------XXLPXXXPXXPPPXXP 970 PPPPP PPPP P LP P PPP P Sbjct: 73 PPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 928 SPXPXPXPPPPPXPP 972 SP P P PPP P PP Sbjct: 70 SPSPPPPPPPRPPPP 84 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 928 SPXPXPXPPPPPXPP 972 S P P PPPPP PP Sbjct: 102 SVLPPPPPPPPPPPP 116 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 73 PPPPPPPRPPPP 84 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 74 PPPPPPRPPPPP 85 Score = 28.3 bits (60), Expect(2) = 0.51 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 106 PPPPPPPPPPPP 117 Score = 22.6 bits (46), Expect(2) = 0.51 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +1 Query: 904 PPXXXSXXSPXPXPXPPP 957 PP P P P PPP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P PP S P PPP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPV--FSPPPSPP 441 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP PPPPP LP PPP P Sbjct: 403 PSPPIVALPPPPPPSPPLPPPV-YSPPPSPP 432 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP PPP P P P PP P Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP PPPPP P P P PP P Sbjct: 403 PSPPIVALPPPPPPSP---PLPPPVYSPPPSP 431 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP PPPP P Sbjct: 456 PPPPPVHHSSPPPPSP 471 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPPXXP 970 PP PP PPPP P P PPP P Sbjct: 437 PPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P PPPP P P PPP P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTP 104 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P P P PPP P P P PPP P Sbjct: 91 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P P P PPP P P P PPP P Sbjct: 109 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P P P PPP P P P PPP P Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXP-XXPXXPPPXXP 971 P PPPP P PP + S P P P P P Sbjct: 175 PSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVP 208 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP S SP P PPPP P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTP 106 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP S SP P PPPP P Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTPTP 124 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP S SP P PPPP P Sbjct: 118 PPPTPTPSVPSPTPPVSPPPPTPTP 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP S SP P PPPP P Sbjct: 136 PPPTPTPSVPSPTPPVSPPPPTPTP 160 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP P PP P P P P P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 114 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP P P P P PPP P Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSP 183 Score = 28.7 bits (61), Expect = 6.2 Identities = 28/123 (22%), Positives = 30/123 (24%), Gaps = 1/123 (0%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXX-SPPXP 774 PP P S PP PP P P P +PP Sbjct: 79 PPVSPPPPTPSVPSPTPP----VSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVS 134 Query: 775 PPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPP 954 PPPP P + P PP S P P P P Sbjct: 135 PPPPTP-TPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVP 193 Query: 955 PPP 963 PP Sbjct: 194 SPP 196 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +3 Query: 873 PPPPPPXX----PXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPP P P PP + S P P PPP P Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPP-PVSPPPPTP 188 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PP PP P P PPP P Sbjct: 56 PPPFPALFPPEPPLPPRFELPPPLFPPPPLP 86 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPP P P P PPP Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLP-XXXPXXPPPXXP 970 PP PP PPP P LP P PPP P Sbjct: 67 PPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEP 99 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PP P P P P PPP Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 29.9 bits (64), Expect = 2.7 Identities = 19/72 (26%), Positives = 19/72 (26%), Gaps = 2/72 (2%) Frame = +1 Query: 763 PPXPPPPPX--PXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPX 936 PP PPP P P F PPP P Sbjct: 42 PPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPR 101 Query: 937 PXPXPPPPPXPP 972 P PPPPP P Sbjct: 102 EPPPPPPPPEEP 113 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P PP P P LP P PP P Sbjct: 41 PPPSP----PPSPSSPPRLPPPFPALFPPEPP 68 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 105 PPPPPPEEPPPP 116 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 32.7 bits (71), Expect = 0.38 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGG--GGGXXXXGGGGG 874 GGG G G G GG GGG GGGGG Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGGYGGGGG 108 Score = 31.5 bits (68), Expect = 0.87 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G G GGGG GGGGG Sbjct: 71 GLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGG 102 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGG 875 G GGG G G GG G GGGGG Sbjct: 63 GHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGG--GGGXXXXGGGG 877 GGG G G G GG GGG GGGG Sbjct: 85 GGGHYGGGGGHYGGGGGGYGGGGGHHGGGG 114 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGG-GXXXXGGGGG 874 G GG G G GGGG G GGGGG Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGG 80 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGG GGGGG Sbjct: 63 GHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGG 94 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP P PP P P P PPP P Sbjct: 70 PVTPPPAVTPTSPPAPKVAPVISPATPPPQPP 101 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXP--PPXXP 970 PPP PP P P P P P PP P Sbjct: 118 PPPAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 25.0 bits (52), Expect(2) = 7.4 Identities = 11/27 (40%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +1 Query: 898 PP--PPXXXSXXSPXPXPXPPPPPXPP 972 PP PP + P P PP P PP Sbjct: 114 PPVSPPPAPTSPPPTPASPPPAPASPP 140 Score = 21.8 bits (44), Expect(2) = 7.4 Identities = 15/54 (27%), Positives = 15/54 (27%), Gaps = 2/54 (3%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPX--PHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 S PP PP P P P SPP PPP P Sbjct: 69 SPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAP 122 >At1g55540.1 68414.m06356 proline-rich family protein contains proline rich extensin domain, INTERPRO:IPR002965 Length = 915 Score = 32.7 bits (71), Expect = 0.38 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G+ G GGGG GG G Sbjct: 870 GAAGGGGFGGFGGQAQGQAGGGGFSAFGGNSG 901 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 32.7 bits (71), Expect = 0.38 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP--XXPPPXXP 970 PPPP PPPPP P P PPP P Sbjct: 141 PPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Score = 31.9 bits (69), Expect = 0.66 Identities = 30/130 (23%), Positives = 32/130 (24%), Gaps = 6/130 (4%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 PP K S PPP PP P + SPP PP Sbjct: 55 PPPYVYKPPPYIYSSPPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPP 114 Query: 778 -----PPPXPXXXXLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXP 939 PPP P + PPPP S P P Sbjct: 115 YVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Query: 940 XPXPPPPPXP 969 PPP P Sbjct: 175 YVYQSPPPPP 184 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 71 PPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPP 102 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 81 PPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 91 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 122 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 101 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 121 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 152 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 131 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 162 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 161 PPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPP 192 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 171 PPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPP 202 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 181 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 212 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 191 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 222 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 201 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 232 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 211 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 242 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 221 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 252 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 231 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 262 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 241 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 272 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 251 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 282 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 261 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 292 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 302 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 281 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 312 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 291 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 322 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 301 PPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPP 332 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 311 PPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPP 342 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 148 SSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 207 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 208 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 264 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 188 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 247 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 248 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPP 304 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 208 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 267 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 268 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPP 324 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPPPPP----XPXXLPXXXPXXPPP 961 PPPP PPPPP P P PPP Sbjct: 321 PPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPP 353 Score = 28.7 bits (61), Expect = 6.2 Identities = 26/127 (20%), Positives = 31/127 (24%), Gaps = 3/127 (2%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPX-- 771 P P + +PPP PP P + + P PP Sbjct: 29 PTPTPYSPLPPYVYNSPPPYVYNSPSPP-PYVYKPPPYIYSSPPPPPYVYSSPPPPPYVY 87 Query: 772 -PPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPX 948 PPPP + PPPP S P P Sbjct: 88 NSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 147 Query: 949 PPPPPXP 969 PPP P Sbjct: 148 SSPPPPP 154 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXL-PXXXPXXPPP 961 PPPPP PPP P P PPP Sbjct: 340 PPPPPYVDSYSPPPAPYVYKPPPYVYKPPP 369 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 32.7 bits (71), Expect = 0.38 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP P P P PP P Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPPPPESPP 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 24/109 (22%), Positives = 25/109 (22%) Frame = +1 Query: 646 PPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXPXXXXLXXXXFX 825 PPP PP P P P SPP PPP P + Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPP 144 Query: 826 XXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXPP 972 PP S P P PP PP Sbjct: 145 TNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPP 193 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPP P P PPP Sbjct: 100 PPPPLPTEAPPPANPVSSPPPESSPPPP 127 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP PPP P P LP PP P Sbjct: 257 PPSPPEETLPPPKPSPDPLP-SNSSSPPTLLP 287 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +2 Query: 881 PPPXXXXPPPPP--XPXXLPXXXPXXP--PPXXP 970 PPP PPPPP P P P P PP P Sbjct: 118 PPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPP P P PPP P Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPANP 114 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP P PP P P P PPP Sbjct: 101 PPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP P P P P P PP Sbjct: 147 PPPPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P P PPPP P LP P P P Sbjct: 141 PSPPTNPPPPPESPPSLPAPDPPSNPLPPP 170 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 904 PPXXXSXXSPXPXPXPPPPPXPP 972 PP S P P PPPPP PP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 931 PXPXPXPPPPPXPP 972 P P P PPPPP PP Sbjct: 296 PPPSPPPPPPPPPP 309 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPP P PPPPP P Sbjct: 296 PPPSPPPPPPPPPPQP 311 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXP 969 PP P P P PPPPP P Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 29.9 bits (64), Expect = 2.7 Identities = 22/98 (22%), Positives = 27/98 (27%) Frame = +1 Query: 493 PXXTPPPPXXXXXAXXXXXXXTXIFFLGXXRAXGRPPXXPXKXXXXFXSXAPPPXXGARX 672 P PPPP + + + PP P F PP + Sbjct: 388 PPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPPRYTQFDPQTPPRRVKSGR 447 Query: 673 XPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPP 786 P P G G +PP PPPPP Sbjct: 448 PPRPTKPKNFNE-----ENNGQGSPLIQITPPPPPPPP 480 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 631 FXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 + S PPP PP P G S P PPPPP P Sbjct: 376 YQSLIPPPSPPPPPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPP 429 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLP 934 P PP PPPPP P +P Sbjct: 245 PQQPPATPPPPPPPPPVEVP 264 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXP 946 PPP PPPPP P L P Sbjct: 296 PPPSPPPPPPPPPPQPLIAATP 317 Score = 27.5 bits (58), Expect(2) = 0.86 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 Query: 881 PPPXXXXPPPPPXP 922 PPP PPPPP P Sbjct: 381 PPPSPPPPPPPPPP 394 Score = 22.6 bits (46), Expect(2) = 0.86 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 905 PPPPXPXXLPXXXPXXPP 958 PPPP P P PP Sbjct: 423 PPPPPPPRYTQFDPQTPP 440 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPPPP P PP P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQP 55 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P P P P P PP Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 32.3 bits (70), Expect = 0.50 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXP---PPXXP 970 PPP P PPPP P P P P PP P Sbjct: 55 PPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 878 PPPPXXXXPPPPPXP 922 PPPP PPPPP P Sbjct: 77 PPPPPHVLPPPPPTP 91 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPP P PPP P LP P P Sbjct: 66 PPPSPYPHPHQPPPPPHVLPPPPPTPAP 93 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP P PP P P P PPP Sbjct: 33 PPPPPFSPPHHPPPPHFSP---PHQPPP 57 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +2 Query: 875 PPP--PPXXXXPP---PPPXPXXLPXXXPXXPPP 961 PPP PP PP PP P P P PPP Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 878 PPPPXXXXP-PPPPXPXXLPXXXPXXPPP 961 PPPP P PPP P P P P P Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPPSPYP 72 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPP P P P P Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQPPPSPYP 61 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 2/26 (7%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPX--PPPPPXP 969 PPP P P P PPPPP P Sbjct: 66 PPPSPYPHPHQPPPPPHVLPPPPPTP 91 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP PP PPPPP P PP P Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPTTTNPPPKP 137 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPP P P P P P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPP 118 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP PP P P PP P Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPGETP 146 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPP PPP P P PP Sbjct: 56 PPPPVVSSPPPSSSPPPSPPVITSPPP 82 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPP PP PP P PPP P Sbjct: 70 PPPSPPVITSPPPTVASSPPPPVVIASPPPSTP 102 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPPP P P PP P Sbjct: 80 PPPTVASSPPPPVVIASPPPSTPATTPPAPP 110 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPP---PXPP 972 PPPP S P P PPP P PP Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPP 142 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 32.3 bits (70), Expect = 0.50 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP 946 PPPPP PPPPP P P Sbjct: 107 PPPPPPKPQPPPPPPRSQKPMQPP 130 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 366 PPPPYVYNSPPPPPYYSPFPKVEYKSPPP 394 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 150 PPPPYIYSSPPPPPYYSPSPKVDYKSPPP 178 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 176 PPPPYVYSSPPPPPYYSPSPKVEYKSPPP 204 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 392 PPPPYIYNSPPPPPYYSPSPKITYKSPPP 420 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP PPP Sbjct: 254 PPPPYVYSSPPPPPYSPSPKVEFKSPPPP 282 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPP PPPPP P PP Sbjct: 202 PPPPYVYSFPPPPPYYSPSPKVGYKSPP 229 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P PPP Sbjct: 341 PPPYVYNSPPPPPYYSPSPTVNYKSPPP 368 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P PPPPP P PPP Sbjct: 228 PPAPYVYSSPPPPPYYSPSPKVNYKSPPP 256 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 279 PPPPYIYNSPPPPSYYSPSPKIDYKSPPP 307 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 305 PPPPYVYSSPPPPTYYSPSPRVDYKSPPP 333 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P PPP Sbjct: 475 PPPPPYVYSSPPPPYYSPSPKVDYKSPPP 503 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 201 PPPPYVYSSPPPPYYSPTPKVDYKSPPP 228 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 151 PPPPYVYSSPPPPYYSPSPKGDYKSPPP 178 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 176 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 203 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 226 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 253 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 251 PPPPYVYSSPPPPYYSPSPKVNYKSPPP 278 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 276 PPPPYVYGSPPPPYYSPSPKVDYKSPPP 303 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 301 PPPPYVYSSPPPPYYSPSPKVNYKSPPP 328 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 326 PPPPYVYGSPPPPYYSPSPKVDYKSPPP 353 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 351 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 378 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 401 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 428 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 451 PPPPYVYSSPPPPYYSPSPKVDYKPPPP 478 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 526 PPPPYVYSSPPPPYYSPSPKVNYKSPPP 553 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 551 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 578 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 576 PPPPYIYSSPPPPYYAPSPKVDYKSPPP 603 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 601 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 628 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 626 PPPPYVYSSPPPPYYSPSPKVNYKSPPP 653 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 501 PPPPYVYSFPPPPYYSPSPKVDYKSPPP 528 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 32.3 bits (70), Expect = 0.50 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = -1 Query: 957 GGXXGXXXGRXXGXGG--GGGXXXXGGGGG 874 GG G GR G GG GGG GGGGG Sbjct: 15 GGRDGGGGGRFGGGGGRFGGGGGRFGGGGG 44 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGG--GGGXXXXGGGGG 874 GGG GR G GG GGG GGGGG Sbjct: 7 GGGGFRGRGGRDGGGGGRFGGGGGRFGGGGG 37 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 32.3 bits (70), Expect = 0.50 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXL--PXXXPXXPPP 961 PPPP PPPPP P + P PPP Sbjct: 224 PPPPGRAALPPPPPLPMAVRKGVAAPPLPPP 254 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P PPP Sbjct: 252 PPPGTAALPPPPPLPMAAGKGVAAPPPP 279 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPPXXP 971 PPPPPP P P L S P P PP P Sbjct: 193 PPPPPP--PPTPRPPRLLSSQPAPPPTPPVSLP 223 Score = 25.8 bits (54), Expect(2) = 0.54 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 193 PPPPPPPPTP 202 Score = 25.0 bits (52), Expect(2) = 0.54 Identities = 11/26 (42%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +1 Query: 898 PPPPXXXSXXSP-XPXPXPPPPPXPP 972 PPPP + P P PPP PP Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTPP 219 Score = 23.8 bits (49), Expect(2) = 9.5 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PP P S P P P PP P Sbjct: 199 PPTPRPPRLLSSQPAPPPTPPVSLP 223 Score = 22.6 bits (46), Expect(2) = 9.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPP P P Sbjct: 195 PPPPPPTPRP 204 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPP---PPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PP PPPPP P P P PP P Sbjct: 367 PPPRRSPPPLQTPPPPPPP---PPLAPPPPPQKRP 398 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP SP P PPPPP PP Sbjct: 367 PPPRR----SPPPLQTPPPPPPPP 386 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 P PP PPP P P P PPP Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPP 392 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P P PPPP PP Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPP 391 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 382 PPPPPPLAPPPP 393 Score = 23.8 bits (49), Expect(2) = 6.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 +PP PPPPP Sbjct: 378 TPPPPPPPP 386 Score = 23.0 bits (47), Expect(2) = 6.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 379 PPPPPPPPP 387 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 31.9 bits (69), Expect = 0.66 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXS-XPXXPXXPPPXXP 971 PPPPPP PP + P P PPP P Sbjct: 356 PPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPP 389 Score = 24.6 bits (51), Expect(2) = 4.1 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P PPPP P Sbjct: 220 PPPPGPPPKEQDFVRPPLPPPPQLP 244 Score = 23.0 bits (47), Expect(2) = 4.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 217 PFPPPPPGP 225 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGG-GGGXXXXGGGGG 874 G GGG G G G GG GGG GG GG Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGG 155 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G G GG GG GGG G Sbjct: 133 GGGGYGGSGGYGGGAGGYGGSGGYGGGAG 161 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 961 GGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 GGG G G GG G GGG GG Sbjct: 133 GGGGYGGSGGYGGGAGGYGGSGGYGGGAGG 162 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P PPPPP PP Sbjct: 118 PPPPSTAVEYQPHHRHHPPPPPPPP 142 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP + SP P PPP PP Sbjct: 143 PPPPASTAIWSPSPPSPQHPPPPPP 167 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 31.9 bits (69), Expect = 0.66 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPP P PPP P + P PP Sbjct: 135 PPPPSTDIPIPPPPPAPVSASPPLTPP 161 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 4/28 (14%) Frame = +1 Query: 898 PPPPXXXSXXSPXP----XPXPPPPPXP 969 PPPP + +P P P PPPPP P Sbjct: 124 PPPPDLDTTTAPPPPSTDIPIPPPPPAP 151 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P PPPP P P P PPP Sbjct: 101 PPAPIVNPNPPPPSTPNPPPEFSP--PPP 127 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 31.9 bits (69), Expect = 0.66 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G G GGGGG GGGGG Sbjct: 155 GGGYSGGGGGGRYGSGGGGG----GGGGG 179 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGGXXXXXXXXXXXXXXXXXXXXXXXXEKXXXXRXXXX 792 GG GGG G G G + GGGG Sbjct: 109 GGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGGGRYG 168 Query: 791 GXGGGGGXGG 762 GGGGG GG Sbjct: 169 SGGGGGGGGG 178 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXG-GGGGXXXXGGGGG 874 GGG G G G G GG G GGGGG Sbjct: 105 GGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 28.3 bits (60), Expect = 8.1 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGG-GXXXXGGGGG 874 RG GGG G GR G GGG G GG GG Sbjct: 99 RGGFGGGG-GRGGGRGGGSYGGGYGGRGSGGRGG 131 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GG GG G GGG Sbjct: 101 GFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGG 132 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 31.9 bits (69), Expect = 0.66 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 P PPP PPPP P P PPP Sbjct: 99 PSPPPPSQACPPPPLPPSPPKKSYCPPPP 127 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 PPP P P PPPP PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPP 115 Score = 26.2 bits (55), Expect(2) = 2.1 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPP-PPXPP 972 PP P S P PPP PP PP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 22.6 bits (46), Expect(2) = 2.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPP P Sbjct: 92 PPPSPPPPSP 101 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 31.9 bits (69), Expect = 0.66 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGGG GG GG Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGG 136 Score = 31.9 bits (69), Expect = 0.66 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGGXXXXXXXXXXXXXXXXXXXXXXXXEKXXXXRXXXX 792 GG GGG G G G G GGGG Sbjct: 132 GGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSG 191 Query: 791 GXGGGGGXG 765 G GGGGG G Sbjct: 192 GGGGGGGYG 200 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G G GGG GG GG Sbjct: 123 GGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGG 154 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 23.8 bits (49), Expect(3) = 0.82 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 +PP PPPPP Sbjct: 37 TPPPPPPPP 45 Score = 23.0 bits (47), Expect(3) = 0.82 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 38 PPPPPPPPP 46 Score = 21.8 bits (44), Expect(3) = 0.82 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXP 945 PPPP SP P P Sbjct: 40 PPPPPPPLSLSPPPSP 55 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 676 PPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PP P P F +PP PPPPP P Sbjct: 365 PPPPPPPPPPFFQGLFSSKKGKSKKNNSNPPPPPPPPPP 403 Score = 25.8 bits (54), Expect(2) = 0.86 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 943 PXPPPPPXPP 972 P PPPPP PP Sbjct: 394 PPPPPPPPPP 403 Score = 24.2 bits (50), Expect(2) = 0.86 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 928 SPXPXPXPPPP 960 SP P P PPPP Sbjct: 364 SPPPPPPPPPP 374 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 31.5 bits (68), Expect = 0.87 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GG GG GGGGG Sbjct: 378 GGVGGGGAG---GYGAGGGGNGGGSFYGGGGG 406 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGG GGGG Sbjct: 363 GAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGG 394 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGG G GGG Sbjct: 362 GGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGG 393 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G G G G G GGGGG GGGG Sbjct: 384 GAGGYGAGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G G G G G G GGG G GG G Sbjct: 386 GGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 248 PPPPYVYSSPPPPPYYSPSPEVSYKSPPP 276 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 98 PPPPYVYNSPPPPYYSPSPKVDYKSPPP 125 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 123 PPPPYVYNSPPPPYYSPSPKVEYKSPPP 150 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 148 PPPPYVYNSPPPPYYSLSPKVDYKSPPP 175 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 223 PPPPYVYNSPPPPYFSPSPKVDYKSPPP 250 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G G GGG GGGGG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGG 47 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 5/34 (14%) Frame = -1 Query: 960 GGGXXGXXXGRXXGX-----GGGGGXXXXGGGGG 874 GGG G G G GGGGG GGGGG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGG 49 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 676 PPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PP P P G SPP PPPPP P Sbjct: 122 PPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPP 160 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXPPP---PPXPXXLPXXXPXXPPPXXP 970 PPPPP PPP PP PPP P Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPPP PP P PPP Sbjct: 156 PPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 10/43 (23%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXS----------XPXXPXXPPPXXP 971 PPPPPP P PP + + P P PPP P Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPP 162 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 8/33 (24%) Frame = +1 Query: 898 PPPPXXXSXXSPX--------PXPXPPPPPXPP 972 PPPP S + P P PPPPP PP Sbjct: 99 PPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPP 131 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 151 PPPPPPPPPPPP 162 >At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 489 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP SP P P P P P P Sbjct: 35 PPPPTYAPAPSPAPAPAPVPAPSP 58 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PP P P P P PP Sbjct: 93 PPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPP P + P PPP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPP---PPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PP PP P P P PPP P Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PP P P P PP P Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASP 100 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PP P P P P PP Sbjct: 93 PPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PPP P + P PPP P Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPP---PPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PP PP P P P PPP P Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PP P P P PP P Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASP 100 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 4/28 (14%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPP----PPPXPP 972 PPP S P P P PP PPP PP Sbjct: 158 PPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 2/30 (6%) Frame = +2 Query: 878 PPPPXXXXPP--PPPXPXXLPXXXPXXPPP 961 PPPP P PPP P P PPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPPP 175 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 734 PPPPYVYSSPPPPPYYSPSPKVEYKSPPP 762 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPPP P PPP Sbjct: 785 PPPPYVYSSPPPPPYYSPSPKVEYKSPPP 813 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 634 PPPPYVYSSPPPPYYSPTPKPTYKSPPP 661 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 684 PPPPYVYSSPPPPYYSPAPKPTYKSPPP 711 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 57 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 84 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 82 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 109 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 107 PPPPYVYSSPPPPYYSPSPKPTYKSPPP 134 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 132 PPPPYVYNSPPPPYYSPSPKVEYKSPPP 159 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 157 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 184 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 182 PPPPYVYNSPPPPYYSPSPKPTYKSPPP 209 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 207 PPPPYIYSSPPPPYYSPSPKPVYKSPPP 234 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 232 PPPPYVYSSPPPPYYSPSPKPAYKSPPP 259 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 257 PPPPYVYSSPPPPYYSPSPKPIYKSPPP 284 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 282 PPPPYVYNSPPPPYYSPSPKPAYKSPPP 309 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 332 PPPPYVYNSPPPPYYSPSPKPAYKSPPP 359 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 357 PPPPYVYSSPPPPYYSPSPKPTYKSPPP 384 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 382 PPPPYVYSSPPPPYYSPSPKPVYKSPPP 409 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 407 PPPPYIYNSPPPPYYSPSPKPSYKSPPP 434 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 482 PPPPYVYSSPPPPYYSPSPKPSYKSPPP 509 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 609 PPPPYVYNSPPPPYYSPSPKPTYKSPPP 636 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 659 PPPPYVYSSPPPPYYSPSPKPTYKSPPP 686 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 709 PPPPYVYSSPPPPYYSPSPKPTYKSPPP 736 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 760 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 787 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 863 PPPPYVYSSPPPPSYSPSPKAEYKSPPP 890 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 307 PPPPYVYSFPPPPYYSPSPKPVYKSPPP 334 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 811 PPPPYVYSSPPPPTYYSPSPKVEYKSPPP 839 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 837 PPPPYVYNSPPPPAYYSPSPKIEYKSPPP 865 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G GGGGG GGG G Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGDG 67 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G GGG G GGGGG Sbjct: 29 GGGGEGKKKNGGGEGGGGEGTSGEGGGGG 57 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G GGGG GGGGG Sbjct: 186 GGGGGSFGGGGGGGAGSYGGGGAGAGSGGGGG 217 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGG G G GGGG Sbjct: 193 GGGGGGGAGSYGGGGAGAGSGGGGG 217 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G GGGG Sbjct: 65 GGGGGGGGRGGGGARSGGRSRGGGG 89 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP P PPP P Sbjct: 268 PPPPPGSWQPSPPPPP 283 Score = 23.8 bits (49), Expect(3) = 1.1 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S SP P P P Sbjct: 43 PPPPDDSSNGSPQPPSSDSQSPPSP 67 Score = 22.2 bits (45), Expect(3) = 1.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 760 SPPXPPPP 783 SPP PPPP Sbjct: 39 SPPAPPPP 46 Score = 21.8 bits (44), Expect(3) = 1.1 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +1 Query: 643 APPPXXGARXXPPXPXP 693 +PPP + PP P P Sbjct: 29 SPPPSDSSSPSPPAPPP 45 >At1g12380.1 68414.m01431 expressed protein Length = 793 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 16 PPPPPPPAPAPP 27 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 15 PPPPPPPPAP 24 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 +PP PPPPP Sbjct: 13 TPPPPPPPP 21 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PP--PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP PPP PP PP P P P P Sbjct: 82 PPSSPPPSITPPPSPPQPQPPPQSTPTGDSP 112 Score = 25.0 bits (52), Expect(2) = 1.1 Identities = 18/72 (25%), Positives = 22/72 (30%) Frame = +1 Query: 571 LGXXRAXGRPPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXX 750 +G P P +PPP A+ PP P+ P Sbjct: 35 IGGSETTQPPATSPPSPPSPDTQTSPPPATAAQP-PPNQPPNTTPP--PTPPSSPPPSIT 91 Query: 751 XXXSPPXPPPPP 786 SPP P PPP Sbjct: 92 PPPSPPQPQPPP 103 Score = 24.6 bits (51), Expect(2) = 1.1 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPP + SP P P P PP Sbjct: 101 PPPQSTPTGDSPVVIPFPKPQLPPP 125 >At5g08530.1 68418.m01013 NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial, putative similar to NADH-ubiquinone oxidoreductase 51 kDa subunit, mitochondrial precursor (EC 1.6.5.3) (EC 1.6.99.3) from {Homo sapiens} SP|P49821, {Bos taurus} SP|P25708, {Aspergillus niger} SP|Q92406; contains Pfam profile PF01512: Respiratory-chain NADH dehydrogenase 51 Kd subunit Length = 486 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 943 PXPPPPPXPP 972 P PPPPP PP Sbjct: 41 PQPPPPPPPP 50 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 928 SPXPXPXPPPPP 963 S P P PPPPP Sbjct: 38 STTPQPPPPPPP 49 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GGG G G G GGG G GGGG Sbjct: 130 GGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GGG G G G GGGGG GGGG Sbjct: 122 GGG--GGYSGGGGGYGGGGGGYGGGGGG 147 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGG-GGGXXXXGGGG 877 GGG G G G GG GGG GGGG Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGGYGGGG 152 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G GGGGG G GGG Sbjct: 125 GGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 G GGGGG G G G GGGG Sbjct: 133 GYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 R GGG G G GGG G G GGG Sbjct: 119 RAYGGGGGYSGGGGGYGGGGGGYGGGGGGYGGG 151 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGG GGGG Sbjct: 126 GYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 919 SXXSPXPXPXPPPPPXPP 972 S P P P PPPPP PP Sbjct: 423 SMLMPPPPPPPPPPPPPP 440 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 875 PPPPPXXXXPPPPP 916 PPPPP PPPPP Sbjct: 427 PPPPPPPPPPPPPP 440 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 427 PPPPPPPPPPPP 438 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 428 PPPPPPPPPPPP 439 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 429 PPPPPPPPPPPP 440 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGG 880 +G GGG G GR GGGG GGG Sbjct: 23 KGGGGGGHGGGGHGRGGHGRGGGGIFFFGGG 53 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP 946 PPPPP P PP P LP P Sbjct: 79 PPPPPPHLLPLSPPLPPLLPLPPP 102 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 928 SPXPXPXPPPPPXPP 972 +P P P PPPPP PP Sbjct: 246 APPPPPPPPPPPPPP 260 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXL 931 PPPP PPPPP P L Sbjct: 247 PPPPPPPPPPPPPPPQRL 264 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 875 PPPPPXXXXPPPPP 916 PPPPP PPPPP Sbjct: 247 PPPPPPPPPPPPPP 260 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 875 PPPPPXXXXPPPPP 916 PPPPP PPPPP Sbjct: 248 PPPPPPPPPPPPPP 261 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 931 PXPXPXPPPPPXPP 972 P P P PPPPP PP Sbjct: 248 PPPPPPPPPPPPPP 261 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 247 PPPPPPPPPPPP 258 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 248 PPPPPPPPPPPP 259 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 249 PPPPPPPPPPPP 260 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 250 PPPPPPPPPPPP 261 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P P P P P Sbjct: 641 PPPMAEMPPPPP-PGEAPPPLPEEPEP 666 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 +G GG G G G GGG G GG GG Sbjct: 165 KGFDGGAGKGVDGGAIGGIGGGAGKEIGGGIGG 197 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GG G G G GGG G GGG G Sbjct: 69 GAGGGWIGGSVGGFGGGIGGGFGGGGFGGGAG 100 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 875 PPPPPXXXXPPPPP 916 PPPPP PPPPP Sbjct: 91 PPPPPIENLPPPPP 104 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLP 934 PPPP PPPPP P P Sbjct: 92 PPPPIENLPPPPPPLPKFSP 111 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP 946 PPPPP PPPP P LP P Sbjct: 90 PPPPPPIENLPPPPPP--LPKFSP 111 Score = 25.8 bits (54), Expect(2) = 4.0 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP P P P P P P Sbjct: 90 PPPPPPIENLPPPPPPLPKFSPSP 113 Score = 21.8 bits (44), Expect(2) = 4.0 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 760 SPPXPPPPP 786 SP PPPPP Sbjct: 87 SPQPPPPPP 95 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG GR G G GGG GGGG Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGG 102 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G GGG G GGGGG Sbjct: 73 GGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 G GGGGG G G G + GGG Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGG 93 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G GGGGG GG GG Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGG 150 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 R GGG G GGGGG G GGG Sbjct: 119 RAYGGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GG G G G GGG G GGGG Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 875 PPPPPXXXXPPPPP 916 PPPPP PPPPP Sbjct: 70 PPPPPPPLSPPPPP 83 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 71 PPPPPPLSPPPP 82 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 875 PPPPPXXXXPPPPP 916 PPPPP PPPPP Sbjct: 44 PPPPPPPRPPPPPP 57 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 44 PPPPPPPRPPPP 55 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 45 PPPPPPRPPPPP 56 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 30.7 bits (66), Expect = 1.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 931 PXPXPXPPPPPXPP 972 P P P PPPPP PP Sbjct: 202 PQPPPHPPPPPPPP 215 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GGG G G G GGG GG GG Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 89 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGG 883 G GGG G G GGGGG GG Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFGGSGG 89 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLP 934 PPPPP PPPP P P Sbjct: 24 PPPPPYYYLDPPPPPPPFPP 43 >At4g19920.1 68417.m02918 disease resistance protein (TIR class), putative domain signature TIR exists, suggestive of a disease resistance protein. Length = 274 Score = 25.8 bits (54), Expect(2) = 2.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPPP P Sbjct: 3 PPSPPPPPIP 12 Score = 23.0 bits (47), Expect(2) = 2.0 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP S P P P PP Sbjct: 7 PPPPIPESRPRPLTPPVLLTRPRPP 31 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 30.3 bits (65), Expect = 2.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 878 PPPPXXXXPPPPPXP 922 PPPP PPPPP P Sbjct: 266 PPPPSSPPPPPPPPP 280 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P P PPPPP PP Sbjct: 266 PPPPSS-------PPPPPPPPPTPP 283 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 875 PP--PPPXXXXPPPPPXPXXLP 934 PP PPP PPPPP P P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 272 PPPPPPPPPTPP 283 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/79 (27%), Positives = 25/79 (31%) Frame = -1 Query: 474 SPPPPPPXX*XKKPXXXGGGEXXXXXXKPAGXVXPXPPPXKKXGGXKXXXXXPGGGQNFX 295 SPPPP P G PPP + GG K GGGQ Sbjct: 49 SPPPPSPPP--PSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQG-- 104 Query: 294 KKIFXXVXPFXGGXPQPXP 238 + P+ G P P P Sbjct: 105 ---YYYPPPYSGNYPTPPP 120 Score = 25.0 bits (52), Expect(2) = 7.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP +P PPPP PP Sbjct: 50 PPPPSPPPPSTPTTAC--PPPPSPP 72 Score = 21.8 bits (44), Expect(2) = 7.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 760 SPPXPPPPP 786 SPP P PPP Sbjct: 49 SPPPPSPPP 57 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPPXXP 970 PPP P PPP P P P PPP P Sbjct: 1136 PPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PP P P PPP P P P PP P Sbjct: 1126 PPLPHESPPSPPPQPPSSP-PPPSSPPQLAP 1155 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPP PPPPP P P PP Sbjct: 759 PPPPTVHYNPPPPPSPAH--YSPPPSPP 784 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPPP PPP P P PP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPP 795 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXP 955 PPPPP PPP P + P P Sbjct: 715 PPPPPHYSLPPPTPTYHYISPPPPPTP 741 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPP---PPPXP 969 PPPP SP P P P PPP P Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTP 728 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%) Frame = +1 Query: 898 PPPPXXXSXXSPXP---XPXPPPPPXP 969 PPPP S P P PPPPP P Sbjct: 715 PPPPPHYSLPPPTPTYHYISPPPPPTP 741 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P PPP Sbjct: 791 PPPPPAVHYSPPPP-----PVIHHSQPPP 814 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 P P S P P P PPPPP P Sbjct: 270 PIPNLASEFHPSPPPPPPPPPPLP 293 Score = 25.4 bits (53), Expect(2) = 9.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 P PPP PPPPP P Sbjct: 280 PSPPPP--PPPPPPLP 293 Score = 21.0 bits (42), Expect(2) = 9.0 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 905 PPPPXPXXLPXXXPXXPP 958 PPPP P P PP Sbjct: 329 PPPPPPPPPPVEYYKSPP 346 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PPPPP PPPP P P PP Sbjct: 65 PPPPPYVYNSPPPPPPYI--YNSPPRPP 90 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGG-GXXXXGGGG 877 GGG G G G GGGG G GGGG Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGG 172 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 972 RGXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 +G GGG G G GGGG GGGG Sbjct: 72 KGGGGGGRGGGGFGGGGRSFGGGGSSSRGGGG 103 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 876 PPPPPXXPXPPXXXXXLXSXPXXPXXPP 959 PPPPP P L S P P PP Sbjct: 12 PPPPPPPPLLQPHHSALSSSPLPPPLPP 39 Score = 25.0 bits (52), Expect(2) = 2.5 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P PPP PP Sbjct: 15 PPPPPLLQPHHSALSSSPLPPPLPP 39 Score = 23.4 bits (48), Expect(2) = 2.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 763 PPXPPPPP 786 PP PPPPP Sbjct: 12 PPPPPPPP 19 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P P PP P P P P P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKP 55 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P P PP P P P P P Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKP 77 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P P PP P P P P P Sbjct: 61 PPKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P P PP P P P P P Sbjct: 83 PPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Score = 27.5 bits (58), Expect(2) = 2.5 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 P PP +P P P P P P P Sbjct: 103 PTPPKPKPAPAPAPTPAPKPKPAP 126 Score = 21.0 bits (42), Expect(2) = 2.5 Identities = 11/48 (22%), Positives = 12/48 (25%) Frame = +1 Query: 649 PPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 PP + P P P P P P PP P Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNP 97 >At5g65410.1 68418.m08226 zinc finger homeobox family protein / ZF-HD homeobox family protein similar to hypothetical proteins (GP|4220524)(GP|3184285|)(Arabidopsis); ZP-HD homeobox family protein GP|13374061 (Flaveria bidentis);GP:5091602 {Oryza sativa} Length = 279 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 884 PPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP PPPPP LP PPP Sbjct: 132 PPQHQPPPPPPGFYRLPAPVSYRPPP 157 >At5g58540.1 68418.m07330 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 484 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P PP +P P PP P Sbjct: 86 PPPPPEGNETPSPPR-SGVPTQTPETPPAITP 116 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 148 PPPPYVYSSPPPPYYSPTPKVDYKSPPP 175 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 223 PPPPYVYSSPPPPYYSPTPKVDYKSPPP 250 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 348 PPPPYVYSSPPPPYYSPTPKVDYKSPPP 375 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 73 PPPPYVYSSPPPPYYTPSPKVDYKSPPP 100 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 98 PPPPYEYSSPPPPYYSPSPKIDYKSPPP 125 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 173 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 200 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 198 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 225 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 298 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 325 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 323 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 350 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 373 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 400 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 398 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 425 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 423 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 450 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 448 PPPPYVYNSPPPPYYSPSPKVDYKSPPP 475 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 473 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 500 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 498 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 525 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 523 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 550 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 548 PPPPYVYNSPPPPYYSPSPKVDYKSPPP 575 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 503 PPPPYVYSSPPPPYHSPSPKVNYKSPPP 530 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 103 PPPPNVYNSPPPPYYSPSPKVDYKSPPP 130 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 128 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 155 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 153 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 180 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 178 PPPPYVYNSPPPPYYSPSPKIEYKSPPP 205 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 203 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 230 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 228 PPPPYVYNSPPPPYYSPSPKVDYKSPPP 255 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 278 PPPPYVYNSPPPPYYSPSPKVEYKSPPP 305 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 303 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 330 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 328 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 355 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 353 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 380 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 403 PPPPYVYSSPPPPYYSPSPKVAYKSPPP 430 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 428 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 455 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 453 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 480 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 478 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 505 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 553 PPPPYVYSSPPPPYYSPSPKVNYKSPPP 580 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 653 PPPPYVYNSPPPPYYSPSPKVTYKSPPP 680 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 253 PPPPYVYSSPPPPYFSPSPKVEYKSPPP 280 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 183 PPPPYVYSSPPPPYYSPTPKVDYKSPPP 210 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 307 PPPPYVYSSPPPPYYSPTPKVDYKSPPP 334 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 133 PPPPYVYSSPPPPYYSPSPKGDYKSPPP 160 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 158 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 185 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 208 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 235 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 233 PPPPYVYSSPPPPYYSPSPKVNYKSPPP 260 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 282 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 309 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 332 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 359 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 357 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 384 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 382 PPPPYVYNSPPPPYYSPSPKVDYKSPPP 409 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 407 PPPPYIYNSPPPPYYSPSPKVNYKTPPP 434 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 432 PPPPYVYSSPPPPYYSPSPKVNYKSPPP 459 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 457 PPPPYVYSSPPPPYYSPSPNVDYKSPPP 484 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 957 GGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G GGGGG GGGGG Sbjct: 51 GSKPNKKWGGGMGGGGGGGGGSGGGGGG 78 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 587 PPPPYVYSSPPPPYHSPSPKVQYKSPPP 614 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 71 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 98 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 96 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 123 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 121 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 148 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 146 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 173 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 171 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 198 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 196 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 223 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 221 PPPPYVYSSPPPPTYSPSPKVDYKSPPP 248 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 246 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 273 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 271 PPPPYVYSSPPPPTYSPSPKVDYKSPPP 298 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 296 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 323 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 321 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 348 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 346 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 373 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 371 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 398 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 396 PPPPYVYSSPPPPTYSPSPKVEYKSPPP 423 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 421 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 448 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 446 PPPPYVYSSPPPPTYSPSPKVDYKSPPP 473 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 471 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 498 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 496 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 523 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 521 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 548 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 562 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 589 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 612 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 639 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 637 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 664 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 713 PPPPYVYSSPPPPHYSPSPKVYYKSPPP 740 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 738 PPPPYVYSSPPPPYYSPSPKVHYKSPPP 765 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 779 PPPPYVYSSPPPPYYSPSPKVHYKSPPP 806 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 804 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 831 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 829 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 856 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 854 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 881 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 879 PPPPYVYSSPPPPYYSPSPVVDYKSPPP 906 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 904 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 931 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P PPPPP P PPP Sbjct: 687 PPHPHVCVCPPPPPCYSPSPKVVYKSPPP 715 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 313 PPPPYVYSSPPPPYYSPTPKVDYKSPPP 340 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 930 PPPPYVYSSPPPPYYSPAPKVDYKSPPP 957 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 88 PPPPYVYNSPPPPYYSPSPKVDYKSPPP 115 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 113 PPPPYVYSSPPPPIYSPSPKVDYKSPPP 140 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 188 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 215 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 213 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 240 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 238 PPPPYVYSSPPPPYYSPSPKIVYKSPPP 265 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 263 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 290 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 288 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 315 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 338 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 365 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 363 PPPPYVYSSPPPPYYSPSPKIVYKSPPP 390 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 388 PPPPYVYSSPPPPYYTPSPKVVYKSPPP 415 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 413 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 440 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 438 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 465 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 463 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 490 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 488 PPPPYVYSSPPPPYYSPSPKVLYKSPPP 515 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 513 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 540 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 538 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 565 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 563 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 590 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 680 PPPPYVYSSPPPPYYSPSPKVHYKSPPP 707 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 705 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 732 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 730 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 757 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 755 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 782 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 780 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 807 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 805 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 832 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 830 PPPPYVYSSPPPPYYSPSPKVVYKSPPP 857 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 855 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 882 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 880 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 907 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 905 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 932 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 955 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 982 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 954 GXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G GGGG GGGGG Sbjct: 187 GRQGRYSGDGGGFGGGGSGFGGGGGGG 213 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPPP P P P P PPP P Sbjct: 87 PPPPPPSPPHPNPFFPSSDPTSTASHPPPAPP 118 Score = 24.6 bits (51), Expect(2) = 6.6 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 7/57 (12%) Frame = +1 Query: 643 APPPXXG-ARXXPPXPXPHXXXXFXXXX-----PXXGXGXXXXXXSPPXPPP-PPXP 792 APPP PP P PH P +PP PPP PP P Sbjct: 41 APPPYQPPVSSQPPSPSPHTHHHHKKHLTTTTPPPHEKHLFSSVANPPPPPPSPPHP 97 Score = 22.2 bits (45), Expect(2) = 6.6 Identities = 11/30 (36%), Positives = 12/30 (40%), Gaps = 5/30 (16%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPX-----PPPPPXPP 972 PP P + P P PPP P PP Sbjct: 91 PPSPPHPNPFFPSSDPTSTASHPPPAPPPP 120 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPP 63 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 52 PPPPYEYKSPPPPVKSPPPPYYYHSPPP 79 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 68 PPPPYYYHSPPPPVKSPPPPYVYSSPPP 95 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 84 PPPPYVYSSPPPPVKSPPPPYYYHSPPP 111 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 100 PPPPYYYHSPPPPVKSPPPPYYYHSPPP 127 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 116 PPPPYYYHSPPPPVKSPPPPYYYHSPPP 143 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 132 PPPPYYYHSPPPPVKSPPPPYYYHSPPP 159 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 148 PPPPYYYHSPPPPVKSPPPPYYYHSPPP 175 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 164 PPPPYYYHSPPPPVKSPPPPYLYSSPPP 191 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPP 64 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 68 PPPPYYYHSPPPPVKSPPPPYVYSSPPPP 96 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 164 PPPPYYYHSPPPPVKSPPPPYLYSSPPPP 192 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 52 PPPPYEYKSPPPPVKSPPPPYYYHSPPPP 80 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 84 PPPPYVYSSPPPPVKSPPPPYYYHSPPPP 112 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 100 PPPPYYYHSPPPPVKSPPPPYYYHSPPPP 128 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 116 PPPPYYYHSPPPPVKSPPPPYYYHSPPPP 144 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 132 PPPPYYYHSPPPPVKSPPPPYYYHSPPPP 160 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 148 PPPPYYYHSPPPPVKSPPPPYYYHSPPPP 176 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 180 PPPPYLYSSPPPPVKSPPPPVYIYASPPP 208 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G GGGGG GG G Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGGAWGGEG 65 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 961 GGGXXGXXGXEXXXXXXXGGXGXXGGGG 878 GGG G G E GG G GGGG Sbjct: 54 GGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GGG G G G G GG GGGG Sbjct: 54 GGGGGGAWGGEGEGGGEWGGGGEGGGGG 81 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G GGG GG GG Sbjct: 49 GAWGGG--GGGGGAWGGEGEGGGEWGGGGEGG 78 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGG GGGGG Sbjct: 53 GGGGGGGAWGGEGEGGGEWGGGG---EGGGGG 81 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G G G G G GGGGG GGG G Sbjct: 68 GGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHG 99 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGG G GGG Sbjct: 49 GHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGG 80 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 970 GXXGGGXXGXXGXEXXXXXXXGGXGXXGGGGGG 872 G GGG G G GG G GGGGG Sbjct: 65 GHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGG 97 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXG--GGGG 874 GGG G G GGGGG G GGGG Sbjct: 78 GGGHGGHYGGGGGHYGGGGGHGGGGHYGGGG 108 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 94 PPPPVYKSPPPPVKHYSPPPVYKSPPPP 121 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 94 PPPPVYKSPPPPVKHYSPPPVYKSPPPP 121 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G G GGGG GGG Sbjct: 785 GGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GG G G GGGGG GGGG Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGG 806 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 29.9 bits (64), Expect = 2.7 Identities = 32/131 (24%), Positives = 33/131 (25%), Gaps = 9/131 (6%) Frame = +1 Query: 598 PPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP 777 PP K S PPP PP P + SPP PP Sbjct: 35 PPSYVYKPPTHIYSSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPP 94 Query: 778 -----PPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPX 942 PPP P PPPP SP P Sbjct: 95 YVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYV-YKSPPPP 153 Query: 943 P----XPPPPP 963 P PPPPP Sbjct: 154 PYVYSSPPPPP 164 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 61 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 92 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 81 PPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 112 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 101 PPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 121 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 152 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 162 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 141 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 172 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 151 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 182 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 161 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 192 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 171 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 202 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 181 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 212 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 222 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 201 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 232 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 211 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 242 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 221 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 252 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 231 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 262 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 241 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 272 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 251 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 282 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 261 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 292 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 271 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 302 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 281 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 312 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 291 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 322 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 332 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 311 PPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 342 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 321 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPP 352 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 331 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 362 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 341 PPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPP 372 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 371 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 402 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 381 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 412 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 391 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 422 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 401 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 432 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 411 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 442 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 431 PPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPP 462 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 51 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 82 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 71 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 102 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP---XXPPP 961 PPPP PPPPP P P PPP Sbjct: 91 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 118 SSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 177 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 178 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 234 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 158 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 217 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 218 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 274 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 178 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 237 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 238 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 294 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 198 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 257 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 258 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 314 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 218 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 277 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 278 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 334 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 258 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 317 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 318 SSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPP 374 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 278 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVY 337 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 338 NSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 394 Score = 29.5 bits (63), Expect = 3.5 Identities = 27/117 (23%), Positives = 30/117 (25%), Gaps = 6/117 (5%) Frame = +1 Query: 637 SXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPP-----PPPXPXXX 801 S PPP + PP P + SPP PP PPP P Sbjct: 298 SSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVY 357 Query: 802 XLXXXX-FXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPXPXPPPPPXP 969 + PPPP S P P PPP P Sbjct: 358 SSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPP 414 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP SP P PPP P Sbjct: 441 PPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP S P P PPP P Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPP 134 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP S P P PPP P Sbjct: 411 PPPPYVYSSPPPPPYVYKSPPPPP 434 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXP 946 PPPP PPPPP P P Sbjct: 421 PPPPYVYKSPPPPPYVYSSPPPPP 444 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 24.6 bits (51), Expect(2) = 3.3 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 P P + +P P PP P PP Sbjct: 180 PTPPVITPPTPTPPVVTPPTPTPP 203 Score = 23.4 bits (48), Expect(2) = 3.3 Identities = 15/66 (22%), Positives = 17/66 (25%) Frame = +1 Query: 595 RPPXXPXKXXXXFXSXAPPPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXP 774 +PP P P + PP P P PP P Sbjct: 103 KPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTP 162 Query: 775 PPPPXP 792 PPP P Sbjct: 163 CPPPTP 168 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 79 PPPPYVYNSPPPPYYSPSPKVYYKSPPP 106 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 104 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 131 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 154 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 181 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 179 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 206 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 204 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 231 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 229 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 256 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 254 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 281 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 279 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 306 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 304 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 331 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 329 PPPPYVYSSPPPPYYSPSPNVYYKSPPP 356 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 354 PPPPYVYSSPPPPYYSPSPKVHYKSPPP 381 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 379 PPPPYVYSSPPPPYYSPSPKVHYKSPPP 406 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 404 PPPPYVYSSPPPPYYSPSPKVTYKSPPP 431 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPP----PPPXPXXLPXXXPXXPPP 961 PPP P PP PPP P P PPP Sbjct: 208 PPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPP 240 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPP----PPPXPXXLPXXXPXXPPP 961 PPP P PP PPP P P PPP Sbjct: 193 PPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPP 225 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 875 PPPPPXXXXPP----PPPXPXXLPXXXPXXPPP 961 PPP P PP PPP P P PPP Sbjct: 256 PPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPP 288 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP P PP PP P PPP Sbjct: 238 PPPIPKKPCPPKPPKIEHPPPVPVYKPPP 266 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 71 PPPPYVYSSPPPPTYSPSPKVDYKSPPP 98 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 96 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 123 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 121 PPPPYVYNSPPPPYYSPSPKVDYKSPPP 148 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 146 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 173 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 171 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 198 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 196 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 223 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 221 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 248 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 246 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 273 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 271 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 298 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 296 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 323 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 321 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 348 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 346 PPPPYVYSSPPPPTYSPSPKVDYKSPPP 373 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 371 PPPPYVYSSPPPPYYSPSPKVEYKSPPP 398 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 396 PPPPYVYSSPPPPTYSPSPKVYYKSPPP 423 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 421 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 448 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 446 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 473 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 471 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 498 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 496 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 523 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 521 PPPPYVYSSPPPPYYSPSPKVHYKSPPP 548 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 546 PPPPYVYSSPPPPYYSPSPKVHYKSPPP 573 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 571 PPPPYVYNSPPPPYYSPSPKVYYKSPPP 598 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 596 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 623 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 621 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 648 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 688 PPPPYVYNSPPPPYYSPSPKVYYKSPPP 715 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP P PPPPP P PPP Sbjct: 662 PPHPHVCVCPPPPPCYSPSPKVVYKSPPP 690 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPP--PPPXPP 972 PP P S P P PP PPP PP Sbjct: 44 PPSPSTNSTSPPPSSPLPPSLPPPSPP 70 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P PP P P P P P P Sbjct: 65 PPPSPPGSLTPPLPQPSPSAPITPSPPSPTTP 96 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 73 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 100 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 98 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 125 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 123 PPPPYVYSSPPPPYYSPSPKVDYKSPPP 150 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 148 PPPPYVYNSPPPPYYSPSPKVDYKSPPP 175 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 173 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 200 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 198 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 225 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 223 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 250 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 248 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 275 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 273 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 300 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 298 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 325 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 323 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 350 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 348 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 375 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 373 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 400 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 398 PPPPYVYNSPPPPYYSPSPKVYYKSPPP 425 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 423 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 450 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 448 PPPPYVYSSPPPPYYSPSPKVYYKSPPP 475 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPP PPPP P PPP Sbjct: 523 PPPPYVYSSPPPPYYSPSPKVTYKSPPP 550 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GG G G G G GGG GGGGG Sbjct: 60 GGLGIGAGIGAGAGLGLGGGGGGLGGGGG 88 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 945 GXXXGRXXGXGGGGGXXXXGGGG 877 G G G GGGGG GGGG Sbjct: 67 GIGAGAGLGLGGGGGGLGGGGGG 89 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 32 PPPPPPALPKPP 43 Score = 25.0 bits (52), Expect(2) = 4.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 SPP PPPPP Sbjct: 29 SPPPPPPPP 37 Score = 22.6 bits (46), Expect(2) = 4.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPP P Sbjct: 31 PPPPPPPALP 40 >At3g50190.1 68416.m05488 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 463 Score = 25.0 bits (52), Expect(2) = 4.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 SPP PPPPP Sbjct: 9 SPPPPPPPP 17 Score = 22.6 bits (46), Expect(2) = 4.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 PP PPPP P Sbjct: 11 PPPPPPPQLP 20 >At1g45688.1 68414.m05202 expressed protein Length = 342 Score = 27.1 bits (57), Expect(2) = 4.3 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 P P +P P P PP PP P Sbjct: 265 PLPKPKKKKGAPVPIPDPPAPPAP 288 Score = 20.6 bits (41), Expect(2) = 4.3 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +1 Query: 724 PXXGXGXXXXXXSPPXPPPPP 786 P G G +PP P P P Sbjct: 249 PLYGSGSTLLPPAPPAPLPKP 269 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 25.8 bits (54), Expect(2) = 4.3 Identities = 12/25 (48%), Positives = 12/25 (48%), Gaps = 2/25 (8%) Frame = +1 Query: 904 PPXXXSXXSPXPXPXPP--PPPXPP 972 PP S SP P P PPP PP Sbjct: 98 PPSSLSPSSPPPLSLSPSSPPPPPP 122 Score = 21.8 bits (44), Expect(2) = 4.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 760 SPPXPPPPP 786 SP PPPPP Sbjct: 64 SPSSPPPPP 72 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPP 963 PPPP S P PPPPP Sbjct: 140 PPPPSKTHEPSRPNTPPPPPPP 161 Score = 25.4 bits (53), Expect(2) = 4.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPP 960 PPPP S P PPPP Sbjct: 158 PPPPSKTHEPSRRITPSPPPP 178 Score = 22.2 bits (45), Expect(2) = 4.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 763 PPXPPPPPXP 792 P PPPPP P Sbjct: 152 PNTPPPPPPP 161 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 29.1 bits (62), Expect = 4.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 875 PPPPPXXXXPPP---PPXPXXLPXXXPXXPPP 961 PPPPP PP PP P P PPP Sbjct: 74 PPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPP 105 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P PPPP PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPP 394 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 7/39 (17%) Frame = +2 Query: 875 PPPP------PXXXXPPPPPXPXXLP-XXXPXXPPPXXP 970 PPPP P PP PP P P P PPP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGP 408 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P P PPP Sbjct: 393 PPPGSGGPKPPPPPGP-----KGPRPPPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P PPPP PP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPP 394 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 7/39 (17%) Frame = +2 Query: 875 PPPP------PXXXXPPPPPXPXXLP-XXXPXXPPPXXP 970 PPPP P PP PP P P P PPP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGP 408 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPPP P P PPP Sbjct: 393 PPPGSGGPKPPPPPGP-----KGPRPPPP 416 >At3g56990.1 68416.m06344 glycine-rich protein conserved hypothetical protein SPCC330.09 - Schizosaccharomyces pombe, PIR:T41319 Length = 711 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 957 GGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GG G G G GGGG G GGG Sbjct: 678 GGFRGRGGGGFRGRGGGGSRGKGGRGGG 705 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 957 GGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GG R G GGGG GGGGG Sbjct: 82 GGRGQSSSDRRGGYGGGGSGYGGGGGGG 109 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 29.1 bits (62), Expect = 4.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G GGGGG GG GG Sbjct: 528 GRSGGGSYGGYGGSSGRSGGGGGS--YGGSGG 557 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP PPPP P Sbjct: 25 PPPPPPSSSLPPPPLP 40 Score = 23.8 bits (49), Expect(2) = 7.2 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 +PP PPPPP Sbjct: 22 APPPPPPPP 30 Score = 23.0 bits (47), Expect(2) = 7.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP P P PPPP P Sbjct: 23 PPPPP------PPPSSSLPPPPLP 40 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP PPPP P Sbjct: 25 PPPPPPSSSLPPPPLP 40 Score = 23.8 bits (49), Expect(2) = 7.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 +PP PPPPP Sbjct: 22 APPPPPPPP 30 Score = 23.0 bits (47), Expect(2) = 7.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP P P PPPP P Sbjct: 23 PPPPP------PPPSSSLPPPPLP 40 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP P PPP P Sbjct: 59 PPPPPSPPQPLPPPAP 74 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G GGG GGGG Sbjct: 100 GKAGGGGGGNNNNNKKGQKNGGGGGGGGGGG 130 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P P P PP P P P PPP P Sbjct: 141 PVQPSSFCPKPPTAPVMPPPQVPVMPPPQVP 171 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 P PP PPP P P P P P P Sbjct: 149 PKPPTAPVMPPPQVPVMPPPQVPVKPHPKVP 179 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGG G G GGGG Sbjct: 49 GGYNGGGGYNGGGGHNGGGYNGGGG 73 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPP 960 PPPP + P P PPPP Sbjct: 239 PPPPPSIAVKQSAPTPSPPPP 259 Score = 25.8 bits (54), Expect(2) = 6.7 Identities = 13/46 (28%), Positives = 14/46 (30%) Frame = +1 Query: 649 PPXXGARXXPPXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPP 786 PP + P P P P S P PPPPP Sbjct: 227 PPPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPP 272 Score = 21.0 bits (42), Expect(2) = 6.7 Identities = 8/24 (33%), Positives = 8/24 (33%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPPP PPP P Sbjct: 268 PPPPPPVKKVGALSSSASKPPPAP 291 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G G G Sbjct: 98 GGGGGGGGGGGGSGGSNGSFFNGSG 122 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 G GGG G G G G G G GG G Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 921 GXGGGGGXXXXGGGGG 874 G GGGGG GGGGG Sbjct: 191 GGGGGGGGGGGGGGGG 206 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G G G Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSGSG 217 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 971 GGXGGGGGXGXGXGXKXXXXXGGGG 897 GG GGGGG G G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSG 215 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 29.1 bits (62), Expect = 4.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 928 SPXPXPXPPPPPXPP 972 SP P PPPPP PP Sbjct: 254 SPFAPPTPPPPPPPP 268 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPP 958 PP P PPPPP P PP Sbjct: 258 PPTPPPPPPPPPPRPLAKAARAQKSPP 284 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 259 PTPPPPPPPPPP 270 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 29.1 bits (62), Expect = 4.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXP 969 PPP SP P PP PP P Sbjct: 21 PPPAPPPESSSPPTPPEPPDPPDP 44 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PPPP P P PPP Sbjct: 201 PPPGGMMRGPPPPHGMQGPPPSRPGMPPP 229 >At5g22560.1 68418.m02635 hypothetical protein contains Pfam profile PF03140: Plant protein of unknown function Length = 517 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 875 PPPPPXXXXP-PPPPXPXXLPXXXPXXPPP 961 PPP P PPPP P P PPP Sbjct: 299 PPPIETKTPPLPPPPPTLTQPHPKPLTPPP 328 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP P PP P P PPP P Sbjct: 306 PPPTIQPPYQPPPPTQSLHQPPYQPPPQQP 335 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXPXXPPP 962 PPPPPP PP L P PP Sbjct: 67 PPPPPPHKHSPPPLSQSLSPPPLITVIHPP 96 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 875 PPP--PPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPP PP PPP P P PPP Sbjct: 32 PPPATPPPVATPPPVATPPPAATPAPATPPP 62 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPP PP +P P PPP P Sbjct: 174 PPPQNIGASPPTETQVIPNPSPVPPPPAQP 203 >At4g32285.1 68417.m04593 epsin N-terminal homology (ENTH) domain-containing protein / clathrin assembly protein-related Aux22d, Vigna radiata, PID:D1021691; contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to clathrin assembly protein AP180 (GI:6492344) [Xenopus laevis] Length = 635 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLP 934 PPP PPPPP P P Sbjct: 391 PPPENHTPPPPPAPEPKP 408 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGG--GGG 874 GGG G G G GGGG GG GGG Sbjct: 347 GGGMPGMGGGMPAGMGGGGMPGAGGGMPGGG 377 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPPP P PPP Sbjct: 47 PPPPPSNPSPPPPS-----PTTTACPPPP 70 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 28.7 bits (61), Expect = 6.2 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +2 Query: 875 PPPPPXXXXPPPP-----PXPXXLPXXXPXXPPPXXP 970 PPPPP PPPP P + PPP P Sbjct: 28 PPPPPPQSQPPPPQTQQQTYPPVMGYPGYHQPPPPYP 64 >At3g52400.1 68416.m05763 syntaxin, putative (SYP122) similar to SP|Q9ZSD4 Syntaxin 121 (AtSYP121) (Syntaxin-related protein At-Syr1) {Arabidopsis thaliana} Length = 341 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 455 GGGGGGDXXSXSXXQXPPPPP 517 GGGGGG + Q PPPP Sbjct: 312 GGGGGGAPRQATPVQAQPPPP 332 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXP 955 PPPP PPPP P P P Sbjct: 90 PPPPAPKKSPPPPTPKKSPSPPSLTP 115 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +2 Query: 875 PPPPPXXXXPPP----PPXPXXLPXXXPXXPPPXXP 970 P PPP PPP P LP P PP P Sbjct: 126 PSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 >At2g25430.1 68415.m03046 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; Length = 653 Score = 28.7 bits (61), Expect = 6.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 881 PPPXXXXPPPPPXPXXLP 934 PPP PPPPP P P Sbjct: 411 PPPENYTPPPPPEPEPQP 428 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 921 GXGGGGGXXXXGGGGG 874 G GGGGG GGGGG Sbjct: 611 GGGGGGGGGPGGGGGG 626 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -1 Query: 921 GXGGGGGXXXXGGGGG 874 G GGGGG GGGGG Sbjct: 612 GGGGGGGGPGGGGGGG 627 >At1g67035.1 68414.m07623 expressed protein ; expression supported by MPSS Length = 229 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 933 GRXXGXGGGGGXXXXGGGGG 874 G+ GGGGG GGGGG Sbjct: 199 GKRRSIGGGGGRKSLGGGGG 218 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 28.7 bits (61), Expect = 6.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 Query: 945 GXXXGRXXGXGGGGGXXXXGGGGG 874 G G GGGGG GGGGG Sbjct: 419 GGGSGSPPSTGGGGGSPSKGGGGG 442 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 P P +P P P P PPP PP Sbjct: 16 PYSPHLHPPSAPLPPPPPLPPPPPP 40 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 23.8 bits (49), Expect(2) = 6.6 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPP 963 PPP SP P PPP Sbjct: 37 PPPSPEKPTSPEQPSSPEPPP 57 Score = 23.4 bits (48), Expect(2) = 6.6 Identities = 11/38 (28%), Positives = 11/38 (28%) Frame = +1 Query: 679 PXPXPHXXXXFXXXXPXXGXGXXXXXXSPPXPPPPPXP 792 P P PH PP P PPP P Sbjct: 4 PEPPPHCRGFHCHRSNHRPPEKPPSPEPPPSPEPPPSP 41 >At4g23890.1 68417.m03436 expressed protein hypothetical protein, Synechocystis sp., PIR:S76577 Length = 250 Score = 23.8 bits (49), Expect(2) = 7.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 Query: 760 SPPXPPPPP 786 +PP PPPPP Sbjct: 136 NPPPPPPPP 144 Score = 23.0 bits (47), Expect(2) = 7.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PXPPPPPXP 792 P PPPPP P Sbjct: 137 PPPPPPPPP 145 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G G GG GGGGG Sbjct: 90 GSGGGGARGGGYGYGSGNGRSGG---GGGGGG 118 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXP 947 PPPPPP P PP + S P P Sbjct: 101 PPPPPP--PPPPVQSVPIASEPVQP 123 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 873 PPPPPPXXPXPPXXXXXLXSXPXXP 947 PPPPPP P PP + S P P Sbjct: 101 PPPPPP--PPPPVQSVPIASEPVQP 123 >At5g41460.1 68418.m05035 fringe-related protein strong similarity to unknown protein (pir||T13026) similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 524 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 97 PPPSPPPPPPPP 108 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 957 GGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 GG G G G GGGGG GGG G Sbjct: 78 GGNSGGSGG-LGGSGGGGGGSGGGGGDG 104 >At5g11550.1 68418.m01347 expressed protein Length = 314 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 919 SXXSPXPXPXPPPPPXP 969 S P P P PPPPP P Sbjct: 77 STAPPPPHPPPPPPPLP 93 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 969 GXXGGGXXGXXXGRXXGXGGGGGXXXXGGGGG 874 G GGG G G G GGG GG G Sbjct: 174 GASGGGPGGASGGGPGGASGGGPGGASGGASG 205 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 898 PPPPXXXSXXSPXPXPXPPPPPXPP 972 PPPP P PPPPP P Sbjct: 566 PPPPLAKPPHVVERLPLPPPPPIAP 590 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PP P P P P P P Sbjct: 213 PPPPPSSAYPPQPYPPQ--PSYYPQGPYP 239 >At4g12880.1 68417.m02016 plastocyanin-like domain-containing protein Length = 141 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 128 PPPPPPFTPPPP 139 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 878 PPPPXXXXPPPPPXPXXLPXXXPXXPPPXXP 970 PPPP PPP P PPP P Sbjct: 391 PPPPCPDVYKPPPYVYSSPPPYVYNPPPSSP 421 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 9/38 (23%) Frame = +2 Query: 875 PPPPPXXXXPP----PPPXP-----XXLPXXXPXXPPP 961 PPP P PP PPP P LP P PPP Sbjct: 56 PPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXPXXLPXXXPXXPPP 961 PPPPP PPP P PPP Sbjct: 243 PPPPPSASNLYPPPYYSTSPPQHQSYPPP 271 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 66 PPPPPPLPPPPP 77 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +1 Query: 898 PPPPXXXSXXSPXPX-PXPPPPPXPP 972 PPP P P P PPP P PP Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 28.3 bits (60), Expect = 8.1 Identities = 16/66 (24%), Positives = 16/66 (24%) Frame = +1 Query: 763 PPXPPPPPXPXXXXLXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXPPPPXXXSXXSPXPX 942 PP PPPPP P P P P Sbjct: 370 PPPPPPPPLPQFSNKRIHTLSSPETANLQTLSSQLCEKLCASSSKTSFPINVPNSQPRPP 429 Query: 943 PXPPPP 960 P PPPP Sbjct: 430 PPPPPP 435 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 1232 PHPHPPPPPPPP 1243 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 55 PPPPPPPPPPPP 66 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 55 PPPPPPPPPPPP 66 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 Query: 875 PPPPPXXXXPPPPPXP 922 PPPPP PPPPP P Sbjct: 6 PPPPPP---PPPPPPP 18 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 6 PPPPPPPPPPPP 17 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 6 PPPPPPPPPPPP 17 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 873 PPPPPPXXPXPP 908 PPPPPP P PP Sbjct: 7 PPPPPPPPPPPP 18 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 7 PPPPPPPPPPPP 18 >At1g68390.1 68414.m07813 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266; expression supported by MPSS Length = 408 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 80 PSPPPPPPPSPP 91 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 P P S P P P P P P PP Sbjct: 311 PSPAPASAPVPAPAPTPAPAPAPP 334 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 901 PPPXXXSXXSPXPXPXPPPPPXPP 972 P P S P P P P P P PP Sbjct: 311 PSPAPASAPVPAPAPTPAPAPAPP 334 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 884 PPXXXXPPPPPXPXXLPXXXPXXPPP 961 PP PPP P P P PPP Sbjct: 30 PPARPTTPPPARPTTPPPVWPTTPPP 55 >At1g35830.1 68414.m04452 VQ motif-containing protein contains PF05678: VQ motif Length = 302 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 82 PQPPPPPPPPPP 93 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 28.3 bits (60), Expect = 8.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 937 PXPXPPPPPXPP 972 P P PPPPP PP Sbjct: 235 PGPPPPPPPPPP 246 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 960 GGGXXGXXXGRXXGXGGGGGXXXXGGGG 877 GGG G R G GGG G GG G Sbjct: 115 GGGGGGGGFARRGGYGGGRGGYARGGFG 142 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,848,450 Number of Sequences: 28952 Number of extensions: 422278 Number of successful extensions: 21655 Number of sequences better than 10.0: 241 Number of HSP's better than 10.0 without gapping: 1246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11373 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2353558416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -