BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F13 (1110 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 58 3e-09 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 56 1e-08 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 52 1e-07 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 47 4e-06 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 47 4e-06 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 42 1e-04 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 41 4e-04 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 39 0.001 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 38 0.003 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 37 0.004 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 36 0.010 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 34 0.041 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 28 0.069 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 33 0.094 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 31 0.22 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 31 0.38 SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyc... 30 0.67 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 29 0.88 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 29 1.5 SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|S... 27 1.7 SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 28 2.0 SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces... 28 2.0 SPAP32A8.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces... 23 2.8 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 27 3.6 SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe... 27 3.6 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 27 3.6 SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosacc... 27 6.2 SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosacchar... 26 8.2 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 57.6 bits (133), Expect = 3e-09 Identities = 48/195 (24%), Positives = 48/195 (24%), Gaps = 4/195 (2%) Frame = +1 Query: 391 PXXPXGXSPXXXPXSXFXKXXXXPXGXPPPPXXPXPPXXXXXXXXXXXXXXXXXPXPXXX 570 P P S P S P P P P P P Sbjct: 1041 PPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVA 1100 Query: 571 XXXXPXPX---PPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXP 741 P P PP P P P P P P P P P P PP P P Sbjct: 1101 APPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPV---PAPSG 1157 Query: 742 XPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXP-PXXPXXPPXPPPXXXXPPXPPPPXPX 918 PP P P P PP P P PP PPP Sbjct: 1158 APPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAP 1217 Query: 919 XXPXPPPPXXPPPPP 963 P P P P P Sbjct: 1218 PVPTPSAGLPPVPVP 1232 Score = 54.8 bits (126), Expect = 2e-08 Identities = 53/231 (22%), Positives = 55/231 (23%), Gaps = 9/231 (3%) Frame = +1 Query: 292 PPLPPPPXXXFFFSPXXXXXPPXFXXFSXXFPPPXXPXGXSPXXXPXSXFXKXXXXPXGX 471 PP+P P P P + PPP P P G Sbjct: 1032 PPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGI 1091 Query: 472 PPPPXX-----PXPPXXXXXXXXXXXXXXXXXPXPXXXXXXXPXPXPPPPXP-PXXXPPP 633 PP P P P P P P P PP P P PP Sbjct: 1092 PPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPP 1151 Query: 634 PPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPX---PPXPXXXXXXXXXXXXXXXX 804 P P P P P PP P P P P PP P Sbjct: 1152 VPA---PSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVP 1208 Query: 805 XXXXXXXXXXXPPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXPPP 957 P PP P P PP P P P P P Sbjct: 1209 PVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVPSP 1259 Score = 53.6 bits (123), Expect = 5e-08 Identities = 55/232 (23%), Positives = 55/232 (23%), Gaps = 11/232 (4%) Frame = +3 Query: 384 PPPXAXXXXXPPXXPXFPXXXXXXXPXXXPPPPXXP--PPPPXXGGXAXRXPPPPXPPPX 557 PP PP P PP P PP P A PPP P Sbjct: 1012 PPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSS 1071 Query: 558 PPXXXXXXXXXXXXXXXXXXGXXPXPPXXXPPXPXSPXXXXXXPPP---PXXXXPPXXXP 728 P P PP P P P P P P Sbjct: 1072 EIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAP 1131 Query: 729 PPXXPXXXPPXXXXXXXXXXXXXXXXXXXXXXXXXXPPXXXXPPPXXPP-PXPXXPXXP- 902 P P PP P P PP P P P Sbjct: 1132 PVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPV 1191 Query: 903 PPXXXXXPXPPP----PPXPPPXPXAXRGXPXGGXXXXXPXPXPXXXXPPPP 1046 PP P P P PP PPP P G P P P PP P Sbjct: 1192 PPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAG---LPPVPVPTAKAPPVP 1240 Score = 48.8 bits (111), Expect = 1e-06 Identities = 46/203 (22%), Positives = 47/203 (23%), Gaps = 7/203 (3%) Frame = +3 Query: 471 PPPPXXPPPPPXXGGXAXRXPPPPXPPPXPPXXXXXXXXXXXXXXXXXXGXXPXPPXXXP 650 PP P P + PP P P PP P P Sbjct: 1012 PPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSS 1071 Query: 651 PXPXSPXXXXXXPPPPXXXXPPXXXPPPXXPXXXPPXXXXXXXXXXXXXXXXXXXXXXXX 830 P P P P PP P P P Sbjct: 1072 EIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAP 1131 Query: 831 XXPPXXXXPPPXXP----PPXPXXPXXPP---PXXXXXPXPPPPPXPPPXPXAXRGXPXG 989 P PP P PP P PP P P P P PP P G P Sbjct: 1132 PVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPV 1191 Query: 990 GXXXXXPXPXPXXXXPPPPXXPP 1058 P P P PP PP Sbjct: 1192 PPPSEAP-PVPKPSVGVPPVPPP 1213 Score = 44.8 bits (101), Expect = 2e-05 Identities = 53/229 (23%), Positives = 53/229 (23%), Gaps = 14/229 (6%) Frame = +3 Query: 414 PPXXPXFPXXXXXXXPXXXPP---PPXXPPPPPXXGGXAX---RXPPPPXPPPXPPXXXX 575 P P P P PP PP P P A R PP P P Sbjct: 967 PSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPL 1026 Query: 576 XXXXXXXXXXXXXXGXXPXPPXXXPPXPXSPXXXXXXPPP---PXXXXP----PXXXPPP 734 P P PP P S PPP P P P PP Sbjct: 1027 PSADAPPIPVPSTAPPVPIPTST-PPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPV 1085 Query: 735 XXPXXXPPXXXXXXXXXXXXXXXXXXXXXXXXXXPPXXXXPPPXXPP-PXPXXPXXPPPX 911 P PP P P PP P P P Sbjct: 1086 PAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKP 1145 Query: 912 XXXXPXPPPPPXPPPXPXAXRGXPXGGXXXXXPXPXPXXXXPPPPXXPP 1058 P P P PP P P P P PP PP Sbjct: 1146 SVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPP 1194 Score = 40.7 bits (91), Expect = 4e-04 Identities = 44/198 (22%), Positives = 45/198 (22%), Gaps = 8/198 (4%) Frame = +3 Query: 477 PPXXPPPPPXXG--GXAXRXPPPPXPPPXPPXXXXXXXXXXXXXXXXXXGXXPXPPXXXP 650 PP PPP P PP PP P P P Sbjct: 966 PPSIPPPLPVSNILSSPTSEPPKDHPPSAP------LSKPVSTSPAAPLARVPPVPKLSS 1019 Query: 651 PXPXSPXXXXXXPPPPXXXXPPXXXPPPXXPXXXPPXXXXXXXXXXXXXXXXXXXXXXXX 830 P P PP P P PP P PP Sbjct: 1020 KAPPVPLPSADAPPIPV----PSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPS 1075 Query: 831 XXPPXXXXPP------PXXPPPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXPXGG 992 P P P P P P P P P P P PP + P Sbjct: 1076 IPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPV 1135 Query: 993 XXXXXPXPXPXXXXPPPP 1046 P P P PP P Sbjct: 1136 PSGAPPVPKPSVAAPPVP 1153 Score = 33.9 bits (74), Expect = 0.041 Identities = 23/84 (27%), Positives = 23/84 (27%), Gaps = 5/84 (5%) Frame = +2 Query: 521 PXXPPPPX--PPXXXPXXXXXXXPXPPPPPPXPXXXX---PXPPXXXPPPPXFXXXXXXX 685 P P P PP P P P PP P P PP PP Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPP 1228 Query: 686 XPPPXXXXPPXXPPPPPXPXXPXP 757 P P PP P P P Sbjct: 1229 VPVPTAKAPPVPAPSSEAPSVSTP 1252 Score = 33.5 bits (73), Expect = 0.054 Identities = 35/141 (24%), Positives = 35/141 (24%), Gaps = 8/141 (5%) Frame = +2 Query: 512 GXRPXXPPPPXPPXXXPXXXXXXXPXPPPP---PP-----XPXXXXPXPPXXXPPPPXFX 667 G RP PP PP P P PP PP P P P PP Sbjct: 960 GPRPAAPPSIPPP--LPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKL 1017 Query: 668 XXXXXXXPPPXXXXPPXXPPPPPXPXXPXPXPXXXXXXXXXXXXXXXXXXXXXXXXXPPP 847 P P PP P P P P P P Sbjct: 1018 SSKAPPVPLPSADAPPI---PVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIP 1074 Query: 848 XPPXPXXPPPXXXXPXXPPPP 910 P P PP PP P Sbjct: 1075 SIPAPSGAPPVPAPSGIPPVP 1095 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 55.6 bits (128), Expect = 1e-08 Identities = 56/235 (23%), Positives = 56/235 (23%), Gaps = 10/235 (4%) Frame = +3 Query: 384 PPPXAXXXXXPPXXPXFPXXXXXXXPXXXPPPPXXPPPPPXXGGXAXRXPPPPXPPPXPP 563 PPP PP P P P PPP A PPP PP Sbjct: 257 PPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPP 316 Query: 564 XXXXXXXXXXXXXXXXXXGXXPXPPXXXP----PXPXSPXXXXXXPPPPXXXXPPXXXPP 731 P PP P P PPPP P P Sbjct: 317 PSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQP 376 Query: 732 PXXPXXXP---PXXXXXXXXXXXXXXXXXXXXXXXXXXPPXXXXP--PPXXPPPXPXXPX 896 P P PP P PP PP P P Sbjct: 377 PPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLP--PS 434 Query: 897 XPPPXXXXXPXPPP-PPXPPPXPXAXRGXPXGGXXXXXPXPXPXXXXPPPPXXPP 1058 PP P PP PP P P G P P P PPP P Sbjct: 435 APPSLPMGAPAAPPLPPSAPIAPPLPAGMPAA-------PPLPPAAPAPPPAPAP 482 Score = 55.2 bits (127), Expect = 2e-08 Identities = 55/236 (23%), Positives = 56/236 (23%), Gaps = 13/236 (5%) Frame = +1 Query: 289 PPPLPPPPXXXFFFSPXXXXXPPXFXXFSXXFPPPXXPXGXSPXXXPXSXFXKXXXXP-X 465 PPP+PPP P P P P P S Sbjct: 253 PPPIPPPSNGTVSSPPNSPPRP----IAPVSMNPAINSTSKPPLPPPSSRVSAAALAANK 308 Query: 466 GXPPPPXXPXPPXXXXXXXXXXXXXXXXXPXPXXXXXXXPXPXPPPPXPPXXXPPPPPXX 645 PPPP P P P P PP PPPPP Sbjct: 309 KRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRS 368 Query: 646 XPPXXFXPXPXP-----XXPPPPXXXPPXXXXP--PPXPXPPXPXXXXXXXXXXXXXXXX 804 P P P PP P P P PP Sbjct: 369 APSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAP 428 Query: 805 XXXXXXXXXXXPPXXPXXPPXPPPXXXXPPXP-----PPPXPXXXPXPPPPXXPPP 957 P P PP PP PP P PP P P PPP P P Sbjct: 429 PSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAP 484 Score = 50.4 bits (115), Expect = 4e-07 Identities = 44/180 (24%), Positives = 45/180 (25%), Gaps = 9/180 (5%) Frame = +3 Query: 471 PPPPXXPPP-------PPXXGGXAXRXPPPPXPPPXPPXXXXXXXXXXXXXXXXXXGXXP 629 PPPP PPP PP G + PPP PPP Sbjct: 311 PPPP--PPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRS 368 Query: 630 XPPXXXPPXPXSPXXXXXXPPPPXXXXPPXXXP--PPXXPXXXPPXXXXXXXXXXXXXXX 803 P P P S PP P P P PP Sbjct: 369 APSTGRQPPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAP 428 Query: 804 XXXXXXXXXXXPPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXP 983 P PP PP P P P P PP P PPP P P Sbjct: 429 PSLPPSAPPSLPMGAPAAPPL-PPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 39.9 bits (89), Expect = 6e-04 Identities = 32/144 (22%), Positives = 32/144 (22%) Frame = +3 Query: 627 PXPPXXXPPXPXSPXXXXXXPPPPXXXXPPXXXPPPXXPXXXPPXXXXXXXXXXXXXXXX 806 P P PP PP P PP P P Sbjct: 234 PSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLP 293 Query: 807 XXXXXXXXXXPPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXPX 986 PP PPP PP PPP PPP A P Sbjct: 294 PPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPL 353 Query: 987 GGXXXXXPXPXPXXXXPPPPXXPP 1058 P P P P PP Sbjct: 354 PPQGRSAPPPPPPRSAPSTGRQPP 377 Score = 39.5 bits (88), Expect = 8e-04 Identities = 38/146 (26%), Positives = 38/146 (26%), Gaps = 16/146 (10%) Frame = +1 Query: 583 PXPXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXPXX 762 P PP PP PP P P P P PPP PP P P Sbjct: 224 PTSTSAPPIPPSIPSSRPPERVPSLS-APAP-PPIPPPSNGTVSSPPNSPPRPIAPVSMN 281 Query: 763 XXXXXXXXXXXXXXXXXXXXXXXXXPPXXPXXPPXP-------PP------XXXXPPXPP 903 P PP P PP PP PP Sbjct: 282 PAINSTSKPPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPP 341 Query: 904 PP---XPXXXPXPPPPXXPPPPPXRR 972 PP P PP PPPP R Sbjct: 342 PPRSNAAGSIPLPPQGRSAPPPPPPR 367 Score = 36.3 bits (80), Expect = 0.008 Identities = 50/223 (22%), Positives = 50/223 (22%), Gaps = 8/223 (3%) Frame = +3 Query: 414 PPXXPXFPXXXXXXX--PXXXPPPPXXPPPPPXXGGXAXRXPPPPXPP-PXPPXXXXXXX 584 PP P P P PP PPP PP P P P Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSK 289 Query: 585 XXXXXXXXXXXGXXPXPPXXXPPXPXSPXXXXXXPPPPXXXXPPXXXPPPXXPXXXPPXX 764 PP P P PP PPP P Sbjct: 290 PPLPPPSSRVSAAALAANKKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPP------- 342 Query: 765 XXXXXXXXXXXXXXXXXXXXXXXXPPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPP 944 P PPP P P PPP PP Sbjct: 343 ------------PRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPA 390 Query: 945 XPPPXP--XAXRGXPXG--GXXXXXPXPXPXXXXP-PPPXXPP 1058 PP P A P G P P P P PP PP Sbjct: 391 PPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSLPP 433 Score = 28.3 bits (60), Expect = 2.0 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 533 PPPXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPPPXXXXP 712 PP P P PPP P P P PP P P Sbjct: 233 PPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRP---IAPVSMNPAINSTSK 289 Query: 713 PXXPPP 730 P PPP Sbjct: 290 PPLPPP 295 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 52.4 bits (120), Expect = 1e-07 Identities = 36/92 (39%), Positives = 36/92 (39%), Gaps = 1/92 (1%) Frame = -1 Query: 762 GXGXGXXGXGGGGGXXGGXXXXGGGXXXXXXXXKXGGGGXXXGGXGXXXXGXGGGGGGXG 583 G G G G GG GG G GG GG G GG G G GG GGG G Sbjct: 187 GGGFGGFG-GGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPG 245 Query: 582 XXXXXXXGXXXGGXGGG-GXXGRXPPXXGGXG 490 G GG GGG G G P GG G Sbjct: 246 -----GFGGGLGGFGGGPGGFGGGPGGHGGPG 272 Score = 50.4 bits (115), Expect = 4e-07 Identities = 42/119 (35%), Positives = 42/119 (35%), Gaps = 2/119 (1%) Frame = -1 Query: 735 GGGGGXXGGXXXXGGGXXXXXXXXKXGGGGXXXGGXGXXXXGXGGGGGGXGXXXXXXXGX 556 G GG GG G GG G GG G G GG GG G G Sbjct: 162 GLGGLALGGLASHALGNLFHHRGHNGGGFGGFGGGSGGPPPGPGGFGGFGG---FGGEGH 218 Query: 555 XXGGXGG-GGXXGRXPPXXGGXGXXRGGGGPXGXXGXFXEXGXG-AXXGGXPXGXPGGG 385 GG GG GG G GG GGGP G G G G GG P G G G Sbjct: 219 HHGGHGGFGGGPGGFEGGPGGF-----GGGPGGFGGGLGGFGGGPGGFGGGPGGHGGPG 272 Score = 49.6 bits (113), Expect = 8e-07 Identities = 36/98 (36%), Positives = 36/98 (36%), Gaps = 1/98 (1%) Frame = -1 Query: 756 GXGXXGXGGGGGXXGGXXXXGGGXXXXXXXXKXGGGGXXXGGXGXXXXGXGGGGGGXGXX 577 G G GG GG GG GG GG GG G G GG GGG G Sbjct: 184 GHNGGGFGGFGGGSGGPPPGPGGF----------GGFGGFGGEGHHHGGHGGFGGGPGGF 233 Query: 576 XXXXXGXXXGGXGGGGXXGRXPPXXGGXGXXRGG-GGP 466 G G G GG G GG G GG GGP Sbjct: 234 EGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGGP 271 Score = 44.4 bits (100), Expect = 3e-05 Identities = 41/122 (33%), Positives = 41/122 (33%) Frame = -2 Query: 959 GGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGGXXGXXGGXXXXXXXXXXXXXXXXXXX 780 GG G G GGG GG GGG GG GG Sbjct: 169 GGLASHALGNLFHHRGHNGGGFGG---FGGGSGGPPPGPGG------------FGGFGGF 213 Query: 779 XXXXGXXXGXGGXGXGGGXXXXGGXXXGGGGXXGXGXGXXXXGGXXXGGGGGXXXGGXGG 600 G GG G GG GG GGG G G G GG G GGG GG GG Sbjct: 214 GGEGHHHGGHGGFG-GGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGG--PGGHGG 270 Query: 599 GG 594 G Sbjct: 271 PG 272 Score = 43.2 bits (97), Expect = 7e-05 Identities = 35/99 (35%), Positives = 35/99 (35%), Gaps = 2/99 (2%) Frame = -2 Query: 962 GGGGGXXGGGGXGXXXGXGG-GGXGGXXXXGGGXGGXXGXXGGXXXXXXXXXXXXXXXXX 786 GGG G GGG G G GG GG GG G GG G GG Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGG----------------P 230 Query: 785 XXXXXXGXXXGXGGXGXGGGXXXXGGXXXG-GGGXXGXG 672 G G G GGG GG G GGG G G Sbjct: 231 GGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGGHG 269 Score = 40.3 bits (90), Expect = 5e-04 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = -3 Query: 1057 GGXXGGGGXXXXGXGXGXXXXXPPXGXPRXAXGXGGGXGG-GGGXGXXXXXGGGXXGXXG 881 GG G GG G G P G G GGG GG GGG G GGG G G Sbjct: 208 GGFGGFGGEGHHHGGHGGFGGGP-GGFEGGPGGFGGGPGGFGGGLG---GFGGGPGGFGG 263 Query: 880 XGGGXXGGG 854 GG G G Sbjct: 264 GPGGHGGPG 272 Score = 37.5 bits (83), Expect = 0.003 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 962 GGGGGXXGG-GGXGXXXGXGGGGXGGXXXXGGGXGGXXG 849 GG GG GG GG G G GGG GG GGG GG G Sbjct: 235 GGPGGFGGGPGGFGGGLGGFGGGPGGF---GGGPGGHGG 270 Score = 35.5 bits (78), Expect = 0.013 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 3/73 (4%) Frame = -3 Query: 1045 GGGGXXXXGXGXGXXXXXPPXGXPRXAXGXGG-GXGGGGGXGXXXXXGGGXXGXXGXGG- 872 G G G G G P G G GG G GG G GG G G GG Sbjct: 184 GHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGG 243 Query: 871 -GXXGGGXXXXGG 836 G GGG GG Sbjct: 244 PGGFGGGLGGFGG 256 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 47.2 bits (107), Expect = 4e-06 Identities = 26/62 (41%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = -1 Query: 657 GGGGXXXGGXGXXXXGXGGGGGGXGXXXXXXXGXXXGGXGG-GGXXGRXPPXXGGXGXXR 481 GG G GG G G GG GGG G G GG GG GG G GG G + Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAK 68 Query: 480 GG 475 GG Sbjct: 69 GG 70 Score = 41.5 bits (93), Expect = 2e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -2 Query: 977 PPRRXGGGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGGXXGXXGG 837 P R G GG G GG G GGG GG GGG GG G GG Sbjct: 5 PGSRGGRGGSRGGRGGFNGGRGGFGGGRGG--ARGGGRGGARGGRGG 49 Score = 40.7 bits (91), Expect = 4e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 959 GGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGGXXGXXGG 837 GG G GGG G G GG GG GG GG G GG Sbjct: 23 GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGG 63 Score = 39.9 bits (89), Expect = 6e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 962 GGGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGGXXGXXGG 837 GGG G GGG G G GG G GG GG G GG Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 38.3 bits (85), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 962 GGGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGGXXGXXGG 837 GG GG GG G G G GG GG GG GG G GG Sbjct: 16 GGRGGFNGGRG-GFGGGRGGARGGGRGGARGGRGGRGGARGG 56 Score = 37.5 bits (83), Expect = 0.003 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = -1 Query: 735 GGGGGXXGGXXXXGGGXXXXXXXXKXGGGGXXXGGXGXXXXGXGGGGGGXG 583 GG GG GG GGG + GG GG G G GG GG G Sbjct: 16 GGRGGFNGGRGGFGGGRGGARGGGR-GGARGGRGGRGGARGGRGGSSGGRG 65 Score = 35.5 bits (78), Expect = 0.013 Identities = 23/58 (39%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = -2 Query: 755 GXGGX--GXGGGXXXXGGXXXGGGGXXGXGXGXXXXGGXXXGGGGGXXXGGXGGGGXG 588 G GG G GG GG G GG G G G G GG G GG GG G Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGR-GGSSGGRGG 66 Score = 35.1 bits (77), Expect = 0.018 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -2 Query: 749 GGXGXGGGXXXXGGXXXGGGGXXGXGXGXXXXGGXXXGGGGGXXXGGXGGGGXGXG 582 G G GG G GG G G G G GG GG GG GG G G Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGG---RGGRGGARGGRG 58 Score = 35.1 bits (77), Expect = 0.018 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 734 GGGXXXXGGXXXGGGGXXGXGXGXXXXGGXXXGGGGGXXXGGXGGGGXGXGXXXXXXXGX 555 GG GG GG G G G G GGG G GG GG G G G Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGR----GGARGGGRGGARGGRGGRGGARGGRGGSSGGR 64 Query: 554 G 552 G Sbjct: 65 G 65 Score = 35.1 bits (77), Expect = 0.018 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -2 Query: 755 GXGGXGXGGGXXXXGGXXXGGGGXXGXGXGXXXXGGXXXGGGGGXXXGGXGGGGXG 588 G GG G G G GGG G G GG G GG GG GG G Sbjct: 17 GRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGS--SGGRGGAKGG 70 Score = 33.1 bits (72), Expect = 0.071 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -3 Query: 961 GXGGGXGGGGGXGXXXXXGGGXXGXXGXGG--GXXGGGXXXXGG 836 G GG GGG G GG G G GG G GG GG Sbjct: 23 GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGG 66 Score = 32.7 bits (71), Expect = 0.094 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 741 GXGGGGGXXGGXXXXGGGXXXXXXXXKXGGGGXXXGGXGXXXXGXGGGGGG 589 G GG G GG GG + GG G GG G G GG GG Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRG-GARGGRGG 59 Score = 32.3 bits (70), Expect = 0.12 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Frame = -1 Query: 612 GXGGGGGGXGXXXXXXXGXXXGGXGGG--GXXGRXPPXXGGXGXXRGG-GGPXGXXG 451 G GG GG G G GG GG G G GG G RGG GG G G Sbjct: 10 GRGGSRGGRGGFNGGRGGFG-GGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRG 65 Score = 31.9 bits (69), Expect = 0.17 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 2/66 (3%) Frame = -1 Query: 603 GGGGGXGXXXXXXXGXXXGGXG-GGGXXGRXPPXXGGXGXXRGG-GGPXGXXGXFXEXGX 430 G GG G G G G GGG G GG RGG GG G G G Sbjct: 6 GSRGGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGG-SSGGR 64 Query: 429 GAXXGG 412 G GG Sbjct: 65 GGAKGG 70 Score = 31.1 bits (67), Expect = 0.29 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = -1 Query: 561 GXXXGGXGG-GGXXGRXPPXXGGXGXXRGGGGPXGXXGXFXEXGXGAXXGGXPXGXPGGG 385 G G GG GG G GG G RGGG G G GG G GG Sbjct: 9 GGRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGR-GGA 67 Query: 384 EXXGK 370 + K Sbjct: 68 KGGAK 72 Score = 31.1 bits (67), Expect = 0.29 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 971 RRXGGGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGG 858 R G GG G GG G G GG GG GG GG Sbjct: 36 RGGGRGGARGGRGGRGGARGGRGGSSGG---RGGAKGG 70 Score = 28.7 bits (61), Expect = 1.5 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 1/61 (1%) Frame = -1 Query: 762 GXGXGXXGXGGGGGXXGGXXXXGGGXXXXXXXXKXGGGGXXXGGXGXXXXG-XGGGGGGX 586 G G G GG G GG GG GG G G G G GG Sbjct: 10 GRGGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKG 69 Query: 585 G 583 G Sbjct: 70 G 70 Score = 26.6 bits (56), Expect = 6.2 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = -3 Query: 1057 GGXXG-GGGXXXXGXGXGXXXXXPPXGXPRXAXGXGGGXGG-GGGXGXXXXXGGG 899 GG G GG G G G G G GG GG GG G GG Sbjct: 16 GGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 47.2 bits (107), Expect = 4e-06 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +1 Query: 595 PPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXP 756 PPPP P P P P P P P PPPP P PP P PP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVP--PPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 47.2 bits (107), Expect = 4e-06 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +1 Query: 838 PPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXPPPPPXRRGG 978 P P P P P PP PPPP PPPP PPPP GG Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPP-PPPPPAVSAGG 789 Score = 46.4 bits (105), Expect = 7e-06 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = +2 Query: 590 PPPPPPXPXXXXPXP-PXXXPPPPXFXXXXXXXXPPPXXXXPPXXPPPPPXP 742 PPPPPP P P P PPP PPP PPPPP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 44.0 bits (99), Expect = 4e-05 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 3/50 (6%) Frame = +3 Query: 414 PPXXPXFPXXXXXXXPXXXPPPPXX---PPPPPXXGGXAXRXPPPPXPPP 554 PP P P PPP PPPPP G A PPPP PPP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 43.6 bits (98), Expect = 5e-05 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +1 Query: 553 PXPXXXXXXXPXPXP---PPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPP 699 P P P P P PPP P PPPPP PP P P PPPP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPP--PPPGVAGAGPPPPPPPPP 783 Score = 42.3 bits (95), Expect = 1e-04 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = +3 Query: 384 PPPXAXXXXXPPXXPXFPXXXXXXXPXXXPPPPXXPPPPPXXGGXAXRXPPPPXPPP 554 PPP P P P P PPP PPPPP G PPPP PPP Sbjct: 732 PPPPPPAVIVPTPAPA-PIPVPPPAPIMGGPPP--PPPPPGVAGAGP--PPPPPPPP 783 Score = 41.1 bits (92), Expect = 3e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 891 PXXPPPXXXXXPXPPPPPXPPPXPXAXRGXPXGGXXXXXPXPXPXXXXPPPPXXPP 1058 P PP P P P P PPP P GG P P PPPP PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIM------GGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 40.7 bits (91), Expect = 4e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = +2 Query: 530 PPPPXPPXXXPXXXXXXXPXP-PPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPPP 697 PPPP P P P P P PPP P P PP PPPP PPP Sbjct: 732 PPPPPPAVIVP----TPAPAPIPVPPPAPIMGGPPPP---PPPPGVAGAGPPPPPPP 781 Score = 40.7 bits (91), Expect = 4e-04 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 5/65 (7%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPP-----XPPPXPXAXRGXPXGGXXX 1001 PP P P P P P P P P PPPPP PPP P GG Sbjct: 735 PPPAVIVPTPAPAPIPVPP--PAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRY 792 Query: 1002 XXPXP 1016 P P Sbjct: 793 YAPAP 797 Score = 40.3 bits (90), Expect = 5e-04 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +1 Query: 859 PPXPPPXXXXPPXPPPPXPXXXPXP----PPPXXPPPPPXRRG 975 PP PPP P P P P P P PPP PPPPP G Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPP--PPPPPGVAG 772 Score = 39.5 bits (88), Expect = 8e-04 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 533 PPPXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPP 658 P P P P P PPPPPP P PP PPPP Sbjct: 744 PAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPP--PPPPP 783 Score = 39.1 bits (87), Expect = 0.001 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +3 Query: 870 PPPXPXXPXXPPPXXXXXPXPPPPP---XPPPXPXAXRGXPXGGXXXXXPXPXPXXXXPP 1040 PPP P P P P PPP P PPP P P G P P P PP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPP------PPPGVAGAGPPPPP----PP 781 Query: 1041 PP 1046 PP Sbjct: 782 PP 783 Score = 37.5 bits (83), Expect = 0.003 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 6/41 (14%) Frame = +3 Query: 459 PXXXPPPPXXPPPPPXXGGXAXRXPPP------PXPPPXPP 563 P P P PPP P GG PPP P PPP PP Sbjct: 742 PTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 37.1 bits (82), Expect = 0.004 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +1 Query: 838 PPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPP------XXPPPPP 963 PP P P P P PPP P PPPP PPPPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPP 779 Score = 34.7 bits (76), Expect = 0.023 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = +3 Query: 384 PPPXAXXXXXPPXXPXFPXXXXXXXPXXXPPPPXXPPPPPXXGGXAXRXPPPPXPPPXP 560 PPP PP P P P PPPP PPPP G + P P P P Sbjct: 752 PPPAPIMGGPPPPPP--PPGVAGAGP---PPPP--PPPPAVSAGGSRYYAPAPQAEPEP 803 Score = 31.1 bits (67), Expect = 0.29 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 589 PXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXP 711 P PPPP P PPP PP P P P Sbjct: 761 PPPPPPPPGVAGAGPPPPPPPPPAVSAGGSRYYAPAPQAEP 801 Score = 30.3 bits (65), Expect = 0.50 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 521 PXXPPPPX---PPXXXPXXXXXXXPXPPPPPPXP 613 P PP P PP P PPPPPP P Sbjct: 750 PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 28.3 bits (60), Expect = 2.0 Identities = 19/75 (25%), Positives = 19/75 (25%) Frame = +3 Query: 492 PPPPXXGGXAXRXPPPPXPPPXPPXXXXXXXXXXXXXXXXXXGXXPXPPXXXPPXPXSPX 671 PPPP P P P P P G P PP PP S Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP---PPPAVSAG 788 Query: 672 XXXXXPPPPXXXXPP 716 P P P Sbjct: 789 GSRYYAPAPQAEPEP 803 Score = 27.5 bits (58), Expect = 3.6 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +1 Query: 289 PPPLPPPPXXXFFFSPXXXXXPPXFXXFSXXFPPPXXP 402 P P+P PP P PP PPP P Sbjct: 746 PAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 26.2 bits (55), Expect = 8.2 Identities = 19/75 (25%), Positives = 20/75 (26%) Frame = +3 Query: 489 PPPPPXXGGXAXRXPPPPXPPPXPPXXXXXXXXXXXXXXXXXXGXXPXPPXXXPPXPXSP 668 PPPPP P P PP P G P PP PP + Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAP---IMGGPPPPPPPPGVAGAGPPPPPPPPPAVSAG 788 Query: 669 XXXXXXPPPPXXXXP 713 P P P Sbjct: 789 GSRYYAPAPQAEPEP 803 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +3 Query: 471 PPPPXXPPPPPXXGGXAXRXPPP--PXPPPXPP 563 PPPP P P P P PPP PP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPP 766 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 42.3 bits (95), Expect = 1e-04 Identities = 25/95 (26%), Positives = 25/95 (26%) Frame = +1 Query: 472 PPPPXXPXPPXXXXXXXXXXXXXXXXXPXPXXXXXXXPXPXPPPPXPPXXXPPPPPXXXP 651 PPPP P P P P PP P PPPP Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE 267 Query: 652 PXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXP 756 P P P P PP P PP P Sbjct: 268 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 302 Score = 42.3 bits (95), Expect = 1e-04 Identities = 25/95 (26%), Positives = 25/95 (26%) Frame = +1 Query: 472 PPPPXXPXPPXXXXXXXXXXXXXXXXXPXPXXXXXXXPXPXPPPPXPPXXXPPPPPXXXP 651 PPPP P P P P PP P PPPP Sbjct: 221 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE 280 Query: 652 PXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXP 756 P P P P PP P PP P Sbjct: 281 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 315 Score = 42.3 bits (95), Expect = 1e-04 Identities = 25/95 (26%), Positives = 25/95 (26%) Frame = +1 Query: 472 PPPPXXPXPPXXXXXXXXXXXXXXXXXPXPXXXXXXXPXPXPPPPXPPXXXPPPPPXXXP 651 PPPP P P P P PP P PPPP Sbjct: 234 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE 293 Query: 652 PXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXP 756 P P P P PP P PP P Sbjct: 294 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 328 Score = 42.3 bits (95), Expect = 1e-04 Identities = 25/95 (26%), Positives = 25/95 (26%) Frame = +1 Query: 472 PPPPXXPXPPXXXXXXXXXXXXXXXXXPXPXXXXXXXPXPXPPPPXPPXXXPPPPPXXXP 651 PPPP P P P P PP P PPPP Sbjct: 247 PPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE 306 Query: 652 PXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXP 756 P P P P PP P PP P Sbjct: 307 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 Score = 37.1 bits (82), Expect = 0.004 Identities = 33/134 (24%), Positives = 33/134 (24%), Gaps = 6/134 (4%) Frame = +1 Query: 595 PPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPP----XPXPPXPXX 762 P PP P PP P PPPP P PPP P P Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 262 Query: 763 XXXXXXXXXXXXXXXXXXXXXXXXXPP--XXPXXPPXPPPXXXXPPXPPPPXPXXXPXPP 936 PP P PPP P PP P P Sbjct: 263 PMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMH--HEP 320 Query: 937 PPXXPPPPPXRRGG 978 PPPP G Sbjct: 321 GEHMPPPPMHHEPG 334 Score = 34.7 bits (76), Expect = 0.023 Identities = 26/118 (22%), Positives = 26/118 (22%) Frame = +3 Query: 381 FPPPXAXXXXXPPXXPXFPXXXXXXXPXXXPPPPXXPPPPPXXGGXAXRXPPPPXPPPXP 560 FP PP P P PPPP PPPP Sbjct: 197 FPAHHEPGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPG 256 Query: 561 PXXXXXXXXXXXXXXXXXXGXXPXPPXXXPPXPXSPXXXXXXPPPPXXXXPPXXXPPP 734 P PP P PPPP P PPP Sbjct: 257 EHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP 314 Score = 31.9 bits (69), Expect = 0.17 Identities = 34/146 (23%), Positives = 34/146 (23%), Gaps = 4/146 (2%) Frame = +3 Query: 633 PPXXXPPXPXSPXXXXXXPPPPXXXXPPXXXPPPXXPXXXPPXXXXXXXXXXXXXXXXXX 812 P PP P PPPP P PPP P P Sbjct: 203 PGEHMPPPPMHHKPGEHMPPPPMHHEPGEHMPPP--PMHHEPGEHMPPPPMHHEPGEHMP 260 Query: 813 XXXXXXXXPPXXXXPPPXXPPPX----PXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGX 980 PP P PPP P PPP PPP P Sbjct: 261 P-------PPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPP 313 Query: 981 PXGGXXXXXPXPXPXXXXPPPPXXPP 1058 P P P P PP Sbjct: 314 PPMHHEPGEHMPPPPMHHEPGEHMPP 339 Score = 31.5 bits (68), Expect = 0.22 Identities = 25/103 (24%), Positives = 25/103 (24%) Frame = +3 Query: 633 PPXXXPPXPXSPXXXXXXPPPPXXXXPPXXXPPPXXPXXXPPXXXXXXXXXXXXXXXXXX 812 P PP P PPPP P PPP P P Sbjct: 242 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP--PMHHEPGEHMPPPPMHHEPGEHMP 299 Query: 813 XXXXXXXXPPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPP 941 P PPP P P P PPPP Sbjct: 300 PPPMHHE-PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 341 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 40.7 bits (91), Expect = 4e-04 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 604 PXPPXXXPPPPPXXXPPXXFX---PXPXPXXPPPPXXXPPXXXXPPPXPXPPXP 756 P P PP P P P P P PPP PP PP P PP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 40.3 bits (90), Expect = 5e-04 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 838 PPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXP 951 PP P PPP PP PP P P PPP P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 37.9 bits (84), Expect = 0.003 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 6/56 (10%) Frame = +2 Query: 509 GGXRPXXP---PPPXPPXXXPXXXXXXXPXPPP---PPPXPXXXXPXPPXXXPPPP 658 GG P P PP P P P PPP PPP P P PPPP Sbjct: 1679 GGMAPAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 36.3 bits (80), Expect = 0.008 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXP 950 PP P P PP P PP P PPPP P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 Score = 35.9 bits (79), Expect = 0.010 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 414 PPXXPXFPXXXXXXXPXXXPPPPXXPPPP--PXXGGXAXRXPPPPXPPPXPP 563 PP P P PPP PPPP P PPPP P P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 35.9 bits (79), Expect = 0.010 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 840 PXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXP 983 P PP P P P PP P P PP PP P P Sbjct: 1694 PQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 35.5 bits (78), Expect = 0.013 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +1 Query: 838 PPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXPP--PPP 963 PP P P PP PP P PP P PP PPP Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 35.1 bits (77), Expect = 0.018 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +3 Query: 882 PXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXPXGGXXXXXPXPXPXXXXPPPP 1046 P P P P PPPPP P P + P G P P P P P Sbjct: 1691 PVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMP-AGPPSAPPPPLPASSAPSVP 1744 Score = 35.1 bits (77), Expect = 0.018 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +1 Query: 583 PXPXPPPPXPPXXXPPPPPXXXPPXXFXPXP--XPXXPPPPXXXPPXXXXPPP 735 P PP PPPP PP P P P PPPP P P Sbjct: 1694 PQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 33.5 bits (73), Expect = 0.054 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXP 950 PP PPP PP P P PP P P P Sbjct: 1709 PPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 33.1 bits (72), Expect = 0.071 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +1 Query: 850 PXXPPXPPPXXXXPPXPPPPXPXXXPXPP--------PPXXPPPP 960 P P P P PPPP P P PP PP PPPP Sbjct: 1691 PVRPQSAAPPQMSAPTPPPP-PMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 32.7 bits (71), Expect = 0.094 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 841 PXXPXXPPXPPPXXXXPPXP--PPPXPXXXPXPPPPXXPPPP 960 P P P P PP P P P PPPP PP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMP 1724 Score = 32.3 bits (70), Expect = 0.12 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 838 PPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXPPP 957 PP P P PP P PP P P P P P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 31.5 bits (68), Expect = 0.22 Identities = 18/61 (29%), Positives = 18/61 (29%), Gaps = 1/61 (1%) Frame = +2 Query: 584 PXPPPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPPPXXXXPPXXPPPPPXPXXP-XPX 760 P PP P PPPP PP P PPP P P P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPN 1745 Query: 761 P 763 P Sbjct: 1746 P 1746 Score = 29.5 bits (63), Expect = 0.88 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 426 PXFPXXXXXXXPXXXPPPPXXPPPPPXXGGXAXRXPPPPXPPPXP 560 P P P PP P PP PPPP PP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPP---PPMSVPPPPSAPPMP 1724 Score = 29.5 bits (63), Expect = 0.88 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 841 PXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXPPPPP 963 P P P PP PP P P P P P P P P Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGP-PSAPPPPLPASSAPSVP 1744 Score = 29.1 bits (62), Expect = 1.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 521 PXXPPPPX---PPXXXPXXXXXXXPXPPPPPPXPXXXXPXPP 637 P PPPP PP P P PPPP P P P Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAG--PPSAPPPPLPASSAPSVP 1744 Score = 27.9 bits (59), Expect = 2.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 553 PXPXXXXXXXPXPXPPPPXPPXXXPPPPPXXXPP 654 P P P P P PP PPP P P Sbjct: 1708 PPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 27.1 bits (57), Expect = 4.7 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +3 Query: 882 PXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXPXGGXXXXXPXPXPXXXXPPPP 1046 P P PP PP P P P P P P PPPP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPP---PPSAPPMPAGPPSAPPPP 1734 Score = 26.6 bits (56), Expect = 6.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 530 PPPPXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPP 658 P PP PP P P P PP P P P P Sbjct: 1705 PTPPPPPMSVPPPPSAP-PMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 26.2 bits (55), Expect = 8.2 Identities = 14/51 (27%), Positives = 14/51 (27%) Frame = +1 Query: 604 PXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXP 756 P P PP P P P P P PP P P P Sbjct: 1470 PAPSSAPAPPAPVSQLPPAVPNVPVPSMIPSVAQQPPSSVAPATAPSSTLP 1520 Score = 26.2 bits (55), Expect = 8.2 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 11/69 (15%) Frame = +1 Query: 583 PXPXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXP---PXXXXPP------- 732 P P PP P PP P P P PP P P PP Sbjct: 1472 PSSAPAPPAPVSQLPPAVPNVPVPSMI---PSVAQQPPSSVAPATAPSSTLPPSQSSFAH 1528 Query: 733 -PXPXPPXP 756 P P PP P Sbjct: 1529 VPSPAPPAP 1537 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 39.1 bits (87), Expect = 0.001 Identities = 22/74 (29%), Positives = 23/74 (31%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXPXGGXXXXXPXP 1016 PP P P PPP P P P PPP P P + P P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP--VKSPPSAPSLPSAVPP 196 Query: 1017 XPXXXXPPPPXXPP 1058 P PPP P Sbjct: 197 MPPKVPPPPLSQAP 210 Score = 38.3 bits (85), Expect = 0.002 Identities = 25/106 (23%), Positives = 25/106 (23%) Frame = +3 Query: 414 PPXXPXFPXXXXXXXPXXXPPPPXXPPPPPXXGGXAXRXPPPPXPPPXPPXXXXXXXXXX 593 PP P P P PP PPP PP P PP Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 594 XXXXXXXXGXXPXPPXXXPPXPXSPXXXXXXPPPPXXXXPPXXXPP 731 P P PP P S P PP P Sbjct: 184 PPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAP 229 Score = 38.3 bits (85), Expect = 0.002 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 7/86 (8%) Frame = +2 Query: 521 PXXPPPPXP------PXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPP-PPXFXXXXX 679 P P PP P P P P P PP P P P PP P Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSP 184 Query: 680 XXXPPPXXXXPPXXPPPPPXPXXPXP 757 P PP P PP P P Sbjct: 185 PSAPSLPSAVPPMPPKVPPPPLSQAP 210 Score = 38.3 bits (85), Expect = 0.002 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +1 Query: 553 PXPXXXXXXXPXPXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPP 732 P P P PP P PPP P PP P P PPP PP Sbjct: 128 PAPPTPQSELRPPTSAPPRPSI--PPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPP 185 Query: 733 PXPXPP 750 P P Sbjct: 186 SAPSLP 191 Score = 37.9 bits (84), Expect = 0.003 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +1 Query: 583 PXPXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPP-PXXXPPXXXXPPPXPXPPXP 756 P P PP P PP PP P P P PP P PP PP P P Sbjct: 124 PPSAPAPPTPQSEL--RPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAP 180 Score = 34.3 bits (75), Expect = 0.031 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 2/79 (2%) Frame = +2 Query: 533 PPPXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPPPXXXXP 712 PP P P PP P P P P PP P PPP Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIP----PPSPASAPPIPSKAPPIPSSLPPPAQPAA 179 Query: 713 PXXPPP--PPXPXXPXPXP 763 P PP P P P P Sbjct: 180 PVKSPPSAPSLPSAVPPMP 198 Score = 34.3 bits (75), Expect = 0.031 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 4/73 (5%) Frame = +3 Query: 840 PXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPP-P---XPPPXPXAXRGXPXGGXXXXX 1007 P PP PP P P P P PP P PP P A P Sbjct: 133 PQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPS 192 Query: 1008 PXPXPXXXXPPPP 1046 P PPPP Sbjct: 193 AVPPMPPKVPPPP 205 Score = 33.1 bits (72), Expect = 0.071 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 583 PXPXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPP 714 P PPP P PP P P P P PPPP P Sbjct: 168 PSSLPPPAQPAAPVKSPPSAPSLPSAVPPMP-PKVPPPPLSQAP 210 Score = 32.7 bits (71), Expect = 0.094 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = +3 Query: 855 PPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXPXGGXXXXXPXPXPXXXX 1034 PP PP P PP PP P PPP P + P P P Sbjct: 124 PPSAPAPPTPQSELRPP-----TSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPA 178 Query: 1035 PP---PPXXP 1055 P PP P Sbjct: 179 APVKSPPSAP 188 Score = 31.9 bits (69), Expect = 0.17 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +1 Query: 838 PPXXPXXPPXPP----PXXXXPPXPPPPXPXXXPXPPPPXXPPPPP 963 PP P PP P P PP P P P PP P PP P Sbjct: 124 PPSAPA-PPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIP 168 Score = 31.5 bits (68), Expect = 0.22 Identities = 21/87 (24%), Positives = 21/87 (24%) Frame = +2 Query: 632 PPXXXPPPPXFXXXXXXXXPPPXXXXPPXXPPPPPXPXXPXPXPXXXXXXXXXXXXXXXX 811 P PP P PP PP PP P P P Sbjct: 125 PSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSP 184 Query: 812 XXXXXXXXXPPPXPPXPXXPPPXXXXP 892 PP PP PPP P Sbjct: 185 PSAPSLPSAVPPMPP-KVPPPPLSQAP 210 Score = 31.5 bits (68), Expect = 0.22 Identities = 22/80 (27%), Positives = 22/80 (27%), Gaps = 2/80 (2%) Frame = +2 Query: 518 RPXXPPPPXPPXXXPXXXXXXXPXPP--PPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXP 691 RP PPP P P P P PPP P PP P P Sbjct: 146 RPSIPPPS--PASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPP 203 Query: 692 PPXXXXPPXXPPPPPXPXXP 751 PP P P P Sbjct: 204 PPLSQAPVANTSSRPSSFAP 223 Score = 31.1 bits (67), Expect = 0.29 Identities = 22/80 (27%), Positives = 22/80 (27%), Gaps = 6/80 (7%) Frame = +3 Query: 837 PPXXXXPPP-----XXPPPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXPXGGXXX 1001 PP PP P P P PPP P P P P P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 1002 XXPXP-XPXXXXPPPPXXPP 1058 P P P PP PP Sbjct: 184 PPSAPSLPSAVPPMPPKVPP 203 Score = 29.1 bits (62), Expect = 1.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 584 PXPPPPPPXPXXXXPXPP 637 P PPPP P P P PP Sbjct: 5 PPPPPPAPAPAAAAPAPP 22 Score = 27.5 bits (58), Expect = 3.6 Identities = 11/20 (55%), Positives = 11/20 (55%), Gaps = 1/20 (5%) Frame = +1 Query: 583 PXPXPPPPXP-PXXXPPPPP 639 P P PPPP P P P PP Sbjct: 3 PAPPPPPPAPAPAAAAPAPP 22 Score = 26.6 bits (56), Expect = 6.2 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +3 Query: 384 PPPXAXXXXXPPXXPXFPXXXXXXXPXXXPPPPXXPPPPPXXGGXAXRXPP--PPXPPPX 557 PP + P P P PPP P P A P PP PP Sbjct: 144 PPRPSIPPPSPASAPPIPSKAPPIPSSL--PPPAQPAAPVKSPPSAPSLPSAVPPMPPKV 201 Query: 558 PP 563 PP Sbjct: 202 PP 203 Score = 26.6 bits (56), Expect = 6.2 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +3 Query: 384 PPPXAXXXXXPPXXPXFPXXXXXXXPXXXPPPPXXPPPPPXXGGXAXRXPPPPXPPP 554 PP A P P P P P PP P PP PPP Sbjct: 151 PPSPASAPPIPSKAPPIPSSLPP--PAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPP 205 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 37.5 bits (83), Expect = 0.003 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 477 PPXXPPPPPXXGGXAXRXPPPPXPPP 554 PP PPPPP G PPP PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 37.1 bits (82), Expect = 0.004 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 474 PPPXXPPPPPXXGGXAXRXPPPPXPP 551 PP PPPPP G PPPP PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 35.9 bits (79), Expect = 0.010 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 858 PPXXPPPXPXXPXXPPPXXXXXPXPPPPP 944 PP PPP P P PP P PPPPP Sbjct: 5 PPGNPPPPPPPPGFEPP---SQPPPPPPP 30 Score = 35.5 bits (78), Expect = 0.013 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +1 Query: 613 PXXXPPPPPXXXPPXXFXPXPXPXXPPPP 699 P PPPPP PP F P P PPPP Sbjct: 5 PPGNPPPPP---PPPGFEPPSQPPPPPPP 30 Score = 35.1 bits (77), Expect = 0.018 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 889 PPXPPPPXPXXXPXPPPPXXPPPPP 963 PP PPP P PP PPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 35.1 bits (77), Expect = 0.018 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 892 PXPPPPXPXXXPXPPPPXXPPPPP 963 P PPPP P P PP PPPPP Sbjct: 9 PPPPPPPPGFEPPSQPP--PPPPP 30 Score = 34.7 bits (76), Expect = 0.023 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 838 PPXXPXXPPXPPPXXXXPPXPPPPXP 915 PP P PP PPP P PPPP P Sbjct: 5 PPGNPPPPP-PPPGFEPPSQPPPPPP 29 Score = 34.7 bits (76), Expect = 0.023 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +1 Query: 889 PPXPPPPXPXXXPXPPPPXXPPPP 960 PP PPPP P PPP PPPP Sbjct: 9 PPPPPPPPGFEPPSQPPP--PPPP 30 Score = 33.9 bits (74), Expect = 0.041 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 590 PPPPPPXPXXXXPXPPXXXPPP 655 PPPPPP P P P PPP Sbjct: 9 PPPPPPPPGFEPPSQPPPPPPP 30 Score = 33.1 bits (72), Expect = 0.071 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 842 PPXPPXPXXPPPXXXXPXXPPPP 910 PP P P PPP P PPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPP 27 Score = 33.1 bits (72), Expect = 0.071 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 583 PXPXPPPPXPPXXXPPPPPXXXPPXXF 663 P PPPP PP PP P PP + Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPPGY 32 Score = 33.1 bits (72), Expect = 0.071 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 521 PXXPPPPXPPXXXPXXXXXXXPXPPPPP 604 P PPPP PP P P PPPPP Sbjct: 6 PGNPPPPPPP---PGFEPPSQPPPPPPP 30 Score = 32.7 bits (71), Expect = 0.094 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 882 PXXPXXPPPXXXXXPXPPPPPXPPP 956 P P PPP P PPP PPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 32.3 bits (70), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 855 PPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXPP 953 PP PPP PPP P PPPP PP Sbjct: 5 PPGNPPPP-------PPPPGFEPPSQPPPPPPP 30 Score = 32.3 bits (70), Expect = 0.12 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 667 PXPXPXXPPPPXXXPPXXXXPPPXP 741 P P PPPP PP PPP P Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 31.9 bits (69), Expect = 0.17 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 839 PPPXPPXPXXPPPXXXXPXXPPPP 910 PPP PP P PP P PPPP Sbjct: 9 PPPPPPPPGFEPP--SQPPPPPPP 30 Score = 31.5 bits (68), Expect = 0.22 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 530 PPPPXPPXXXPXXXXXXXPXPPPPPPXP 613 PPPP PP P P PPPPP P Sbjct: 10 PPPPPPPGFEP-------PSQPPPPPPP 30 Score = 29.5 bits (63), Expect = 0.88 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPP 941 PP PPP PPP P PPP PPPP Sbjct: 5 PPGNPPPPP--PPPGFEPPSQPPP-------PPPP 30 Score = 28.7 bits (61), Expect = 1.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 679 PXXPPPPXXXPPXXXXPPPXPXPPXP 756 P PPP PP P P PP P Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 26.2 bits (55), Expect = 8.2 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 3/31 (9%) Frame = +3 Query: 459 PXXXPP---PPXXPPPPPXXGGXAXRXPPPP 542 P PP PP PPPPP G R P Sbjct: 11 PPPPPPGFEPPSQPPPPPPPGYVKKRKNKTP 41 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 37.1 bits (82), Expect = 0.004 Identities = 24/98 (24%), Positives = 25/98 (25%), Gaps = 3/98 (3%) Frame = +1 Query: 589 PXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXX---PPPXPXPPXPX 759 P PPPP PP P + PP P PPP P P P Sbjct: 189 PPPPPPPPPAVEDQAADANEPDDYYSSGRAVSPEIPPTYTPKQADPLPAPPPPPPPTLPP 248 Query: 760 XXXXXXXXXXXXXXXXXXXXXXXXXXPPXXPXXPPXPP 873 PP P PP PP Sbjct: 249 QSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPPRPP 286 Score = 34.7 bits (76), Expect = 0.023 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 14/88 (15%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXP---XGGXXXXX 1007 P PPP PP P P P PPPPP A P Sbjct: 161 PNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGRAVS 220 Query: 1008 P-----------XPXPXXXXPPPPXXPP 1058 P P P PPPP PP Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPP 248 Score = 31.9 bits (69), Expect = 0.17 Identities = 31/133 (23%), Positives = 31/133 (23%), Gaps = 11/133 (8%) Frame = +1 Query: 598 PPPXPPXXXPPPPPXXXPPXXFXPX---PXPXXPPPPXXXPPXXXXPPPXPXPPXPXXXX 768 P P PPP PP P P PPPP PP P Sbjct: 156 PTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSS 215 Query: 769 XXXXXXXXXXXXXXXXXXXXXXXPPXXPXXPPXPPPXXXXPPXPPPPXPXXX-------- 924 PP P P PP P P Sbjct: 216 GRAVSPEIPPTYTPKQADPLPAPPPPPP--PTLPPQSTNTSQLPMPSRNVNNLGSQVNIP 273 Query: 925 PXPPPPXXPPPPP 963 P P P PP PP Sbjct: 274 PPPATPSQPPRPP 286 Score = 30.7 bits (66), Expect = 0.38 Identities = 29/114 (25%), Positives = 29/114 (25%), Gaps = 1/114 (0%) Frame = +1 Query: 631 PPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXPXXXXXXXXXXXXXXXXXX 810 P PP F P P P P PPP P PP Sbjct: 161 PNSMVSPPPSFQP---PSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYSSGR 217 Query: 811 XXXXXXXXXPPXXPXXPPXPPPXXXXP-PXPPPPXPXXXPXPPPPXXPPPPPXR 969 P PP P P P PPPP P P P P R Sbjct: 218 AVS----------PEIPPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMPSR 261 Score = 30.3 bits (65), Expect = 0.50 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 1/68 (1%) Frame = +2 Query: 536 PPXPPXXXPXXXXXXXPXPPPPPP-XPXXXXPXPPXXXPPPPXFXXXXXXXXPPPXXXXP 712 P PP P PPPPPP P P PPP Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPP--PAT 278 Query: 713 PXXPPPPP 736 P PP PP Sbjct: 279 PSQPPRPP 286 Score = 29.9 bits (64), Expect = 0.67 Identities = 31/131 (23%), Positives = 31/131 (23%), Gaps = 8/131 (6%) Frame = +1 Query: 595 PPPPXPPXXXPPPPPXXXPPXXFXP---XPXPXXPPPPXXXPPXXXXPPPXPXPPXPXXX 765 P P PPP PP P P PPPP PP P Sbjct: 156 PTVSAPNSMVSPPP-SFQPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADANEPDDYYS 214 Query: 766 XXXXXXXXXXXXXXXXXXXXXXXXPPXXPXXPPXPPPXXXXPPXPPPP-----XPXXXPX 930 PP P P PP P P Sbjct: 215 SGRAVSPEIPPTYTPKQADPLPAPPP--PPPPTLPPQSTNTSQLPMPSRNVNNLGSQVNI 272 Query: 931 PPPPXXPPPPP 963 PPPP P PP Sbjct: 273 PPPPATPSQPP 283 Score = 28.3 bits (60), Expect = 2.0 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +1 Query: 583 PXPXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPP 750 P P PPPP PP PP P PP P P PP Sbjct: 234 PLPAPPPPPPPTL---PPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPPRPP 286 Score = 27.1 bits (57), Expect = 4.7 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 480 PXXPPPPPXXGGXAXRXPPPPXPPPXPP 563 P PP PPPP PP PP Sbjct: 221 PEIPPTYTPKQADPLPAPPPPPPPTLPP 248 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 35.9 bits (79), Expect = 0.010 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -2 Query: 968 RXGGGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGGXXGXXGG 837 R G GG GG G G G GGG GG GG GG G G Sbjct: 151 RGGFGGNSRGGFGGGSRGGFGGGSRGG--SRGGFRGGSRGGFRG 192 Score = 34.7 bits (76), Expect = 0.023 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -2 Query: 755 GXGGXGXGGGXXXXGGXXXGG-GGXXGXGXGXXXXGGXXXGGGGGXXXGGXGGGGXG 588 G G G GG G GG GG G G GG G GG G GG G Sbjct: 133 GPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 34.3 bits (75), Expect = 0.031 Identities = 24/69 (34%), Positives = 24/69 (34%) Frame = -1 Query: 651 GGXXXGGXGXXXXGXGGGGGGXGXXXXXXXGXXXGGXGGGGXXGRXPPXXGGXGXXRGGG 472 G GG G G GG GG G G GG GGG G GG GG Sbjct: 133 GPAGRGGRGGFRGGRGGSRGGFG-------GNSRGGFGGGSRGGFGGGSRGGSRGGFRGG 185 Query: 471 GPXGXXGXF 445 G G F Sbjct: 186 SRGGFRGRF 194 Score = 33.1 bits (72), Expect = 0.071 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = -1 Query: 762 GXGXGXXGXGGGGGXXGGXXXXGGGXXXXXXXXKXGGGGXXXGGXGXXXXGXGGGG 595 G G G GG GG GG GG + G GG GG G G GG Sbjct: 129 GARNGPAGRGGRGGFRGG---RGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGG 181 Score = 32.7 bits (71), Expect = 0.094 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = -1 Query: 513 PPXXGGXGXXRGGGGPXGXXGXFXEXGXGAXXGGXPXGXPGGGEXXGKXXEXXGXXXXXR 334 P GG G RGG G G G F G GG G GG + G R Sbjct: 134 PAGRGGRGGFRGGRG--GSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFR 191 Query: 333 GK 328 G+ Sbjct: 192 GR 193 Score = 32.3 bits (70), Expect = 0.12 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 962 GGGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGGXXGXXGG 837 GG G GG G G GG GG G G G GG Sbjct: 148 GGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 31.5 bits (68), Expect = 0.22 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 657 GGGGXXXGGXGXXXXGXGGGGGGXGXXXXXXXGXXXGGXGGGGXXG 520 GG G GG G G G GGG G G GG GG G Sbjct: 145 GGRGGSRGGFGGNSRG-GFGGGSRGGFGGGSRGGSRGGFRGGSRGG 189 Score = 31.1 bits (67), Expect = 0.29 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -2 Query: 968 RXGGGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGGXXGXXGG 837 R G GG GG G G GGG GG GG GG G G Sbjct: 144 RGGRGGSR-GGFGGNSRGGFGGGSRGG--FGGGSRGGSRGGFRG 184 Score = 30.3 bits (65), Expect = 0.50 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -3 Query: 961 GXGGGXGGG-GGXGXXXXXGGGXXGXXGXGGGXXGG 857 G GG GG GG G G G G GGG GG Sbjct: 142 GFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGG 177 Score = 29.9 bits (64), Expect = 0.67 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = -3 Query: 988 PXGXPRXAXGXGGGXGGGGGXGXXXXXGGGXXGXXGXGGGXXGG-GXXXXGG 836 P G G GG G GG G G G G GGG GG G GG Sbjct: 127 PKGARNGPAGRGGRGGFRGGRG-GSRGGFGGNSRGGFGGGSRGGFGGGSRGG 177 Score = 28.3 bits (60), Expect = 2.0 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = -1 Query: 657 GGGGXXXGGXGXXXXGXGGGG-GGXGXXXXXXXGXXXGGXGGGGXXGRXPPXXGG 496 GG G GG G G GG GG G G GG GG G GG Sbjct: 138 GGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFG---GGSRGGSRGGFRGGSRGG 189 Score = 27.9 bits (59), Expect = 2.7 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -3 Query: 991 PPXGXPRXAXGXGGGXGGGGGXGXXXXXGGGXXGXXGXGG-GXXGGG 854 P P+ G G G GG G GG G G G GGG Sbjct: 119 PKTVGPKKPKGARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGG 165 Score = 27.9 bits (59), Expect = 2.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 710 GXXXGGGGXXGXGXGXXXXGGXXXGGGGGXXXGGXGGGGXG 588 G G G G G GG G GG GG GGG G Sbjct: 129 GARNGPAGRGGRGGFRGGRGGSRGGFGGN-SRGGFGGGSRG 168 Score = 26.6 bits (56), Expect = 6.2 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -1 Query: 549 GGXGGGGXXGRXPPXXGGXGXXRGGGGPXGXXGXFXEXGXGAXXGGXPXGXPGG 388 G G GG G GG G GG G G F G GG G GG Sbjct: 136 GRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFG----GGSRGGSRGGFRGG 185 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 33.9 bits (74), Expect = 0.041 Identities = 49/231 (21%), Positives = 51/231 (22%), Gaps = 5/231 (2%) Frame = +1 Query: 286 PPPPLPPPPXXXFFFSPXXXXXPPXFXXFSXXFPP--PXXPXGXSPXXXPXSXFXKXXXX 459 PPP +P S P S PP P P S P + Sbjct: 484 PPPAMPKVFPERDISSASQKAAQPSVITPSVPQPPAAPVVPEAPSVHQPPAAPVAPEVPS 543 Query: 460 PXGXPPPPXXPXPPXXXXXXXXXXXXXXXXXPXPXXXXXXXPXPXPPPPXPPXXXPPPPP 639 P P P P P P P P P P P Sbjct: 544 APQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPS 603 Query: 640 XXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXPXXXXXXXXXXXXXXXXXXXXX 819 PP P P P P P P PP Sbjct: 604 VPQPPVAPVAPEVPSVPQRPAV--PVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEA 661 Query: 820 XXXXXXPPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXP---PPPXXPPPPP 963 P P PP P P P PP P P PP PP Sbjct: 662 -------PSVPQ-PPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLPP 704 Score = 33.5 bits (73), Expect = 0.054 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 1/74 (1%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXP-PPXXXXXPXPPPPPXPPPXPXAXRGXPXGGXXXXXPX 1013 P P P P P P P PP P P P PP P A P P Sbjct: 569 PEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPE-VPSVPQRPAVPV 627 Query: 1014 PXPXXXXPPPPXXP 1055 P PP P Sbjct: 628 VPEAPSVPQPPAAP 641 Score = 32.3 bits (70), Expect = 0.12 Identities = 35/169 (20%), Positives = 36/169 (21%), Gaps = 1/169 (0%) Frame = +3 Query: 459 PXXXPPPPXXPPPPPXXGGXAXRXPPPPXPPPXPPXXXXXXXXXXXXXXXXXXGXXPXPP 638 P P P P P G PPP P P P PP Sbjct: 460 PFTNNPNPISAPEKPTSGESLSLNPPPAMPKVFPERDISSASQKAAQPSVITPS-VPQPP 518 Query: 639 XXXPPXPXSPXXXXXXPPPPXXXXPPXXXPPPXXPXXXPPXXXXXXXXXXXXXXXXXXXX 818 P P +P P P P P Sbjct: 519 -AAPVVPEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQP 577 Query: 819 XXXXXXPPXXXXPPPXXPPPXPXXPXXP-PPXXXXXPXPPPPPXPPPXP 962 P P P P P P P PP P P P P P Sbjct: 578 PVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPEVPSVPQRPAVP 626 Score = 29.9 bits (64), Expect = 0.67 Identities = 20/79 (25%), Positives = 20/79 (25%), Gaps = 2/79 (2%) Frame = +2 Query: 521 PXXPPPPXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPPPX 700 P P P P P P PP P P P PP Sbjct: 611 PVAPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQPPAA 670 Query: 701 XXXP--PXXPPPPPXPXXP 751 P P P PP P P Sbjct: 671 PVVPEVPSVPQPPAVPVVP 689 Score = 29.1 bits (62), Expect = 1.2 Identities = 20/74 (27%), Positives = 20/74 (27%), Gaps = 1/74 (1%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXPP-PXXXXXPXPPPPPXPPPXPXAXRGXPXGGXXXXXPX 1013 P P P P P P P P P P P PP P P P Sbjct: 599 PEAPSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPE-VPSVPQRPAVPV 657 Query: 1014 PXPXXXXPPPPXXP 1055 P PP P Sbjct: 658 VPEAPSVPQPPAAP 671 Score = 27.5 bits (58), Expect = 3.6 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +2 Query: 521 PXXPPPPXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPP 658 P P P PP P PP P P P P PP Sbjct: 659 PEAPSVPQPPAAPVVPEVPSVPQPPAVPVVPEAGQLNEPVVPPLPP 704 Score = 27.1 bits (57), Expect = 4.7 Identities = 18/71 (25%), Positives = 18/71 (25%) Frame = +2 Query: 539 PXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPPPXXXXPPX 718 P PP P PP P P P P P P P Sbjct: 575 PQPPVAPVAPEVPSVPQPPVAPVVPEAPSVPQPPVAPVAPE-VPSVPQRPAVPVVPEAPS 633 Query: 719 XPPPPPXPXXP 751 P PP P P Sbjct: 634 VPQPPAAPVVP 644 Score = 26.2 bits (55), Expect = 8.2 Identities = 19/77 (24%), Positives = 19/77 (24%) Frame = +2 Query: 521 PXXPPPPXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPPPX 700 P P P P P PP P P P PP PP Sbjct: 554 PEAPSVPQRPAVPVVPEALSVPQPPVAPVAPEV----PSVPQPPVAPVVPEAPSVPQPPV 609 Query: 701 XXXPPXXPPPPPXPXXP 751 P P P P P Sbjct: 610 APVAPEVPSVPQRPAVP 626 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 27.9 bits (59), Expect = 2.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 584 PXPPPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPPPXXXXPPXXPPPPP 736 P PPPPPP P P PP PPPPP Sbjct: 905 PTPPPPPPLPVKTSLN--TFSHPDSVNIVANDTSVAGVMPAFPPPPPPPPP 953 Score = 27.5 bits (58), Expect(2) = 0.069 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 930 PPPPPXPPPXPXAXRG 977 PPPPP PPP A G Sbjct: 945 PPPPPPPPPLVSAAGG 960 Score = 24.6 bits (51), Expect(2) = 1.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 931 PPPPXXPPPPPXRRGG 978 PPPP PPP GG Sbjct: 945 PPPPPPPPPLVSAAGG 960 Score = 24.2 bits (50), Expect(2) = 0.069 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 924 PXPPPPPXPPP 956 P PPPP PPP Sbjct: 942 PAFPPPPPPPP 952 Score = 23.0 bits (47), Expect(2) = 3.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 537 PPXPPPXPP 563 PP PPP PP Sbjct: 945 PPPPPPPPP 953 Score = 22.6 bits (46), Expect(2) = 1.2 Identities = 14/56 (25%), Positives = 14/56 (25%) Frame = +1 Query: 709 PPXXXXPPPXPXPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXPPXXPXXPPXPPP 876 P P P P PP P P P PP PPP Sbjct: 899 PTIITHPTPPPPPPLPVKTSLNTFSHPDSVNIVANDTSVAGVMPAFPPP-PPPPPP 953 Score = 22.6 bits (46), Expect(2) = 3.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 531 PPPPXPPPXP 560 P PP PPP P Sbjct: 905 PTPPPPPPLP 914 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 32.7 bits (71), Expect = 0.094 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -2 Query: 941 GGGGXGXXXGXGG-GGXGGXXXXGGGXG-GXXGXXGG 837 GGG G G GG GG GG GGG G G G G Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGGARSG 482 Score = 26.2 bits (55), Expect = 8.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -2 Query: 695 GGGXXGXGXGXXXXGGXXXGGG-GGXXXGGXGGGGXG 588 GGG G G GG GG GG G GG G Sbjct: 446 GGGSRGGRGGFGGRGGFGGRGGFGGGRGRGRGGARSG 482 Score = 26.2 bits (55), Expect = 8.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 955 GGGXGGGGGXGXXXXXGGGXXGXXGXGGGXXGGG 854 GGG GG G G G G G G G G GG Sbjct: 446 GGGSRGGRG-GFGGRGGFGGRGGFGGGRGRGRGG 478 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 31.5 bits (68), Expect = 0.22 Identities = 31/128 (24%), Positives = 31/128 (24%), Gaps = 2/128 (1%) Frame = +1 Query: 598 PPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXPXXXXXXX 777 P PP P P P P PP PP P PP P Sbjct: 457 PSSLPPWQQPTQQSAVQPSNLVPSQNAPFIPGTSAPLPPTTFAPPGVPLPPIP------- 509 Query: 778 XXXXXXXXXXXXXXXXXXXXPPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXP-- 951 P PP PP PP P P P P P P Sbjct: 510 ---------------GAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYPAVPAMPGIPGA 554 Query: 952 PPPPXRRG 975 PP G Sbjct: 555 TAPPGAPG 562 Score = 30.3 bits (65), Expect = 0.50 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 837 PPXXXXPPPXXPPPXPXXPXXPPPXXXXXP-XPPPPPXPPPXPXAXRGXP 983 PP PP PP P P P P PP PP P G P Sbjct: 494 PPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPGYP 543 Score = 27.9 bits (59), Expect = 2.7 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +1 Query: 589 PXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPP 750 P PP P P PP P P PP PP P P P P Sbjct: 492 PLPPTTFAPPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPP--GMPAPFPGYP 543 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 30.7 bits (66), Expect = 0.38 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Frame = +1 Query: 589 PXPPPPXPPXXXPPPPPXXXP-PXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPP 750 P PP PP P P P P PP PP P P PP Sbjct: 1021 PLPPTASQRASAYEPPTVSVPSPSALSPSVTPQLPPVSSRLPPVSATRPQIPQPP 1075 Score = 30.3 bits (65), Expect = 0.50 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +2 Query: 593 PPPPPXPXXXXPXPPXXXPPPPXFXXXXXXXXPP--PXXXXPPXXPPPPPXPXXP 751 PPPPP P PPPP PP PP P P P P Sbjct: 908 PPPPPTASMTASAPAIASPPPP---KVGETYHPPTASGTRVPPVQQPSHPNPYTP 959 >SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyces pombe|chr 3|||Manual Length = 379 Score = 29.9 bits (64), Expect = 0.67 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -1 Query: 561 GXXXGGXGGGGXXGRXPPXXGGXGXX-RGGGGPXGXXGXFXEXGXG 427 G GG GG G GG G RGGG P G F G G Sbjct: 137 GGMGGGMGGMGGMDDDMDMDGGFGTRTRGGGMPGGFANMFGGGGAG 182 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 29.5 bits (63), Expect = 0.88 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 837 PPXXXXPPPXXP-PPXPXXPXXPPPXXXXXPXPPPPPXPPPXPXAXRGXP 983 PP P P P P P P P P PP P P P + P Sbjct: 107 PPLPNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVPETNCHKESP 156 Score = 28.7 bits (61), Expect = 1.5 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +1 Query: 604 PXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXP--PPXPXPPXP 756 P P PP P P P P PP P P P PP P P P Sbjct: 99 PEEPLPREPPLPNEPVPEE----PLPGEPPLPDEPVPEEPLPGEPPLPNEPVP 147 Score = 28.7 bits (61), Expect = 1.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 841 PXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXPPPP 960 P P P P P P PP P P P P PP P Sbjct: 104 PREPPLPNEPVPEEPLPGEPPLP-DEPVPEEPLPGEPPLP 142 Score = 27.9 bits (59), Expect = 2.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 841 PXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXPPPP 960 P P P P PP P P P P P P P P Sbjct: 107 PPLPNEPVPEEPLPGEPPLPDEPVP-EEPLPGEPPLPNEP 145 Score = 26.6 bits (56), Expect = 6.2 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +2 Query: 521 PXXPPPPXPPXXXPXXXXXXXPXPPPPPPXPXXXXPXPPXXXPPPP 658 P P P PP P PP P P P P PP P Sbjct: 99 PEEPLPREPPLPNEPVPEEPLPGEPPLPDEPVPEEPLP--GEPPLP 142 Score = 26.6 bits (56), Expect = 6.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 583 PXPXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPPPPXXXPP 714 P P P P P PP P P P P PP P P Sbjct: 108 PLPNEPVPEEPLPGEPPLPDEPVPEE----PLPGEPPLPNEPVP 147 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 28.7 bits (61), Expect = 1.5 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +1 Query: 595 PPPPXPPXXXPPPPPXXXPPXXF--XPXPXPXXPPPPXXXPPXXXXPP 732 PPPP P PP PP + P P PP P P Sbjct: 206 PPPPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPYPPVQAYPQAPQQP 253 Score = 27.9 bits (59), Expect = 2.7 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 859 PPXPPPXXXXPP---XPPPPXPXXXPXPPPPXXPPPP 960 PP PPP PP PP PP P PP Sbjct: 206 PPPPPPQQNYPPAASSSAPPMQYQQTAYPPQQAPYPP 242 >SPCC306.09c |cap1|cap|adenylyl cyclase-associated protein Cap1|Schizosaccharomyces pombe|chr 3|||Manual Length = 551 Score = 27.1 bits (57), Expect = 4.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 286 PPPPLPPPPXXXFF 327 PPPP PPPP F+ Sbjct: 306 PPPPPPPPPSNDFW 319 Score = 26.2 bits (55), Expect = 8.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 Query: 930 PPPPPXPPP 956 PPPPP PPP Sbjct: 306 PPPPPPPPP 314 Score = 23.4 bits (48), Expect(2) = 1.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 584 PXPPPPPP 607 P PPPPPP Sbjct: 306 PPPPPPPP 313 Score = 23.4 bits (48), Expect(2) = 1.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 590 PPPPPPXP 613 PPPPPP P Sbjct: 307 PPPPPPPP 314 >SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 262 Score = 28.3 bits (60), Expect = 2.0 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 6/48 (12%) Frame = +1 Query: 838 PPXXPXXPPXPPPXXXXPPXPPPPXPXXXPXPPPPXXP------PPPP 963 PP P P P P P PPPP P PPPP Sbjct: 108 PPKEPALPSRGTPSLPSRPGSRPSVLNQEQVPPPPVRPNVMSQMPPPP 155 >SPBC13E7.03c |||RNA hairpin binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 28.3 bits (60), Expect = 2.0 Identities = 18/69 (26%), Positives = 20/69 (28%) Frame = +1 Query: 286 PPPPLPPPPXXXFFFSPXXXXXPPXFXXFSXXFPPPXXPXGXSPXXXPXSXFXKXXXXPX 465 P P P FF +P P P P G SP S + Sbjct: 309 PSNSTPSKPNTSFFETPHNNIWDSRDRGAFSAPPAPFFPLGFSPHLNDESSRSRWSNISY 368 Query: 466 GXPPPPXXP 492 PPPP P Sbjct: 369 SPPPPPPPP 377 >SPAP32A8.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 23.4 bits (48), Expect(2) = 2.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 590 PPPPPPXP 613 PPPPPP P Sbjct: 240 PPPPPPRP 247 Score = 22.6 bits (46), Expect(2) = 2.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 722 PPPPPXPXXP 751 PPPPP P P Sbjct: 241 PPPPPRPSQP 250 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 27.5 bits (58), Expect = 3.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 898 PPPPXPXXXPXPPPPXXPPPPPXR 969 P PP P P P PPPPP R Sbjct: 729 PAPPTPA--PTPAVKHHPPPPPVR 750 Score = 26.2 bits (55), Expect = 8.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 459 PXXXPPPPXXPPPPPXXGGXAXRXPPPP 542 P P PPPPP + PP P Sbjct: 734 PAPTPAVKHHPPPPPVRSSISPSMPPAP 761 >SPBC660.05 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 143 Score = 27.5 bits (58), Expect = 3.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 977 PPRRXGGGGGXXGGGGXGXXXGXGGGGXGGXXXXGGGXGG 858 PP R G GGG G G GG G GG GG Sbjct: 100 PPPRGPLFGPRIGGGHHGPLHGPHGGFGGRGGGRMGGRGG 139 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 27.5 bits (58), Expect = 3.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 625 PPPPPXXXPPXXFXPXPXPXXPPPPXXXPPXXXXPPPXPXPPXP 756 PPPPP P P P PP P P P P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPPAGATAISGNPGMPAP 1925 >SPAC31A2.14 |||WD repeat protein, human WRDR48 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 962 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +1 Query: 628 PPPPXXXPPXXFXPXPXPXXPPPPXXXP 711 PP P P + P P PPP P Sbjct: 582 PPEPLLSPTIDYSATPFPLEPPPESPGP 609 >SPAC26A3.09c |rga2||GTPase activating protein Rga2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1275 Score = 26.2 bits (55), Expect = 8.2 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 589 PXPPPPXPPXXXPPPPPXXXPPXXFXPXPXPXXPP 693 P P P PPPPP P P PP Sbjct: 407 PAYSTPARPTESPPPPPISSSSTTPRPDDKPSLPP 441 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.314 0.163 0.634 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,743,774 Number of Sequences: 5004 Number of extensions: 79094 Number of successful extensions: 2539 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 715 length of database: 2,362,478 effective HSP length: 74 effective length of database: 1,992,182 effective search space used: 587693690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -