BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F12 (859 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB158503-1|BAD69710.1| 151|Homo sapiens splice variant of four ... 34 0.76 K01747-1|AAA51586.1| 330|Homo sapiens ACTA2 protein. 31 4.1 J05192-1|AAA51577.1| 377|Homo sapiens ACTA3 protein. 31 4.1 >AB158503-1|BAD69710.1| 151|Homo sapiens splice variant of four and a half LIM domain protein 2 protein. Length = 151 Score = 33.9 bits (74), Expect = 0.76 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +1 Query: 466 AG*EKGSTEACSSTLLLARASTEPTARVSTCPLLTRSIPTSSLTAMS 606 AG S+ +S+ L R S+ T R+S CP + ++P S+ +A S Sbjct: 63 AGMRPASSATAASSQLEPRVSSPKTIRISVCPAMRNNMPCSAFSAKS 109 >K01747-1|AAA51586.1| 330|Homo sapiens ACTA2 protein. Length = 330 Score = 31.5 bits (68), Expect = 4.1 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +3 Query: 300 MNVDVVKQFMEMYKMGMLP-RGETFVHTNELQMEEAVKVFRVLYYAKDFDVFMRTACW 470 M +D+ + + Y M +L RG +FV T E ++ +K ++ Y A DF+ M TA W Sbjct: 178 MRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKE-KLCYVALDFENEMATAAW 234 >J05192-1|AAA51577.1| 377|Homo sapiens ACTA3 protein. Length = 377 Score = 31.5 bits (68), Expect = 4.1 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +3 Query: 300 MNVDVVKQFMEMYKMGMLP-RGETFVHTNELQMEEAVKVFRVLYYAKDFDVFMRTACW 470 M +D+ + + Y M +L RG +FV T E ++ +K ++ Y A DF+ M TA W Sbjct: 178 MRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKE-KLCYVALDFENEMATAAW 234 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,277,348 Number of Sequences: 237096 Number of extensions: 2247913 Number of successful extensions: 4800 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4800 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10928473528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -