BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F11 (851 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 27 0.25 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 27 0.25 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 4.1 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 4.1 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 22 5.4 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 7.1 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 26.6 bits (56), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 460 RTHTRQSNASARPRAERRGSHACPTSSHMRTHIG 359 RTH+ + P +RR S + ++HMRTH G Sbjct: 42 RTHSGEKPFRC-PVCDRRFSQSSSVTTHMRTHSG 74 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 26.6 bits (56), Expect = 0.25 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 460 RTHTRQSNASARPRAERRGSHACPTSSHMRTHIG 359 RTH+ + P +RR S + ++HMRTH G Sbjct: 298 RTHSGEKPFRC-PVCDRRFSQSSSVTTHMRTHSG 330 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -2 Query: 694 LLFVLFSI*RLYLSCIFF-GRLLYF 623 ++FV FS+ L C+FF G +L F Sbjct: 221 IVFVCFSLVEDTLPCVFFLGSILIF 245 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 250 YDLGGLLLQMSAAAARPTAVLSH 318 +D GLLL + AAA P+ LS+ Sbjct: 172 WDQHGLLLTAAVAAAGPSVDLSY 194 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -3 Query: 441 PTPAPGRGRSAAVRTRAPLLAIC 373 P PG + V T+APL +C Sbjct: 105 PKAKPGERKFIKVTTKAPLECMC 127 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 7.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 167 CIVVRAQLHTSEPRPSLLLPTVL 235 CI V A+ S+ LLLPTVL Sbjct: 506 CINVLAEACGSDITTRLLLPTVL 528 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,226 Number of Sequences: 336 Number of extensions: 4295 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -