BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F09 (879 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosac... 28 2.0 SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ... 27 4.7 SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pomb... 26 6.1 SPAC1F12.06c |||endonuclease |Schizosaccharomyces pombe|chr 1|||... 26 8.1 SPBC28F2.02 |mep33||mRNA export protein Mep33|Schizosaccharomyce... 26 8.1 >SPAC11H11.01 |sst6|cps23|ESCRT I complex subunit Vps23|Schizosaccharomyces pombe|chr 1|||Manual Length = 487 Score = 27.9 bits (59), Expect = 2.0 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +1 Query: 142 VHAFVKRDAPKEDNSINTLAESAKKTIEELREKVESALAPETVKKNFGT 288 V A +K+D +E S L TIE+L+ K E+ P K F + Sbjct: 128 VQALIKQDFEREHTSPPELPTKLVNTIEKLKVKEENEAPPVIPAKPFSS 176 >SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 2344 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/57 (26%), Positives = 29/57 (50%) Frame = -2 Query: 260 GAKADSTFSLNSSIVFFALSASVFMLLSSLGASRLTNACTLARQIANKIISSLFILD 90 G A + F ++ SIV+ A+ ++V + + A ++ NK+ S L++LD Sbjct: 410 GYMAITKFEVSQSIVYSAIVSAVAEFIRQILAEDQLLLNNFFEELKNKLESDLYLLD 466 >SPCC1450.12 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 26.2 bits (55), Expect = 6.1 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 172 KEDNSINTLAESAKKTIEELREKVESAL 255 KE NSI+ L+ S +KTIE R + S + Sbjct: 371 KEKNSISELSPSLQKTIEWARVNLASTI 398 >SPAC1F12.06c |||endonuclease |Schizosaccharomyces pombe|chr 1|||Manual Length = 252 Score = 25.8 bits (54), Expect = 8.1 Identities = 16/75 (21%), Positives = 36/75 (48%) Frame = -1 Query: 426 YSITSRTLLHSIYLGLCT*ILKNYFSGFRCFRGLQIFIKFVEAVYHRAKVFLNSLRGQGG 247 Y + R +++ YL + + ++Y GF FR ++ ++ + + H+ ++ + + G G Sbjct: 60 YDLEQRMIIYKDYLCIEK-LEEDYVPGFLSFREIKWYLPLLNHIPHQFRIDIILVDGNGV 118 Query: 246 FNFFPQFLNCFLRTL 202 + L C L L Sbjct: 119 LHPVGFGLACHLGVL 133 >SPBC28F2.02 |mep33||mRNA export protein Mep33|Schizosaccharomyces pombe|chr 2|||Manual Length = 292 Score = 25.8 bits (54), Expect = 8.1 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +3 Query: 276 KLWHDGRQLQRIL*KSEARGSTESL-RSNFLVSKYITPN 389 K W DGR+ RIL ++E R S ++ RSN +Y N Sbjct: 216 KKWSDGRR-DRILKQAEERRSNRAVGRSNLSGREYFESN 253 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,878,657 Number of Sequences: 5004 Number of extensions: 52351 Number of successful extensions: 159 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 159 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 440481800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -