BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F08 (830 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ug... 31 0.15 SPBC577.15c |||NASP family histone binding protein|Schizosacchar... 29 0.81 SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyce... 27 2.5 SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharom... 27 3.3 SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 10.0 >SPAC1B2.02c |ugo1||mitochondrial fusion and transport protein Ugo1|Schizosaccharomyces pombe|chr 1|||Manual Length = 421 Score = 31.5 bits (68), Expect = 0.15 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -3 Query: 273 AIAGPALINPSRTLRPTFSIFLKSFHLGSGAALTAP 166 AIA P +I+P ++RP S+F+KS A + +P Sbjct: 202 AIADPNIISPIDSVRPLLSLFIKSITSAISALILSP 237 >SPBC577.15c |||NASP family histone binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 29.1 bits (62), Expect = 0.81 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 390 LNSLKLEIHNYLQSCFKLNASLEFNDKVY 304 L L LEI N+ Q+ L +LE+ +KVY Sbjct: 205 LGELSLEIENFSQASQDLKTALEWKEKVY 233 >SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 747 Score = 27.5 bits (58), Expect = 2.5 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = -3 Query: 375 LEIHNYLQSCFKLNASLEFNDKVYFPNDFACPMTAIAGPALINPSRTLRPTFSI 214 L +H YL +C + + +E ++ + +T+I P +++PS+ + S+ Sbjct: 130 LLLHLYLLNCHEQGSLIEEPRPLFLDPSWKEKVTSIMSPQMVDPSKMISSCLSL 183 >SPAC23C11.01 |||ER membrane protein, ICE2 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 27.1 bits (57), Expect = 3.3 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 210 LKSFH-LGSGAALTAPRASTNAKTKLKIRTKFILPKFYSAGEFKIPIQYRSTRTL 49 L+S H L S + T PR N + K + P ++ F+I + Y TR L Sbjct: 291 LQSVHYLISTISATLPRTLYNIVLFMVAAAKTVAPSVFATFAFRISVMYAVTRIL 345 >SPAC17A2.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 25.4 bits (53), Expect = 10.0 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 3/22 (13%) Frame = +2 Query: 677 FRFFFF---CVYLYLIFSLGYL 733 F FFFF CV+L +FSL +L Sbjct: 155 FLFFFFLCVCVFLSFLFSLSHL 176 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,717,602 Number of Sequences: 5004 Number of extensions: 46612 Number of successful extensions: 118 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 408446760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -