BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F07 (854 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 25 0.89 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.89 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 4.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 6.3 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 8.3 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 8.3 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 25.0 bits (52), Expect = 0.89 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 176 RKLKFHEGKLLKKVDFISWKLDNNISEVKVMKKFCIQKREDYT 304 R L+ +G ++ + I W+L ++ V +M FCI K +T Sbjct: 191 RTLQISDG--IENIGSIRWELAGTLAVVWIMCYFCIWKGVKWT 231 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 25.0 bits (52), Expect = 0.89 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 176 RKLKFHEGKLLKKVDFISWKLDNNISEVKVMKKFCIQKREDYT 304 R L+ +G ++ + I W+L ++ V +M FCI K +T Sbjct: 244 RTLQISDG--IENIGSIRWELAGTLAVVWIMCYFCIWKGVKWT 284 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 4.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 630 PPSXXXPPPPP 662 PP PPPPP Sbjct: 338 PPKPAPPPPPP 348 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 6.3 Identities = 11/28 (39%), Positives = 11/28 (39%), Gaps = 4/28 (14%) Frame = +3 Query: 783 PXPXPXPPXXPPXP----PXPPXXXPPP 854 P P P P P P P P PPP Sbjct: 21 PGPQPSPHQSPQAPQRGSPPNPSQGPPP 48 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = +1 Query: 772 PXPPPXXXPXPPXXPPXPXXPPXXXP 849 P P P P P P PP P Sbjct: 31 PQAPQRGSPPNPSQGPPPGGPPGAPP 56 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 21.8 bits (44), Expect = 8.3 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +2 Query: 281 IQKREDYTKYNKLSRDIRE 337 +++ E+Y Y KL R++R+ Sbjct: 392 VKQVEEYMAYRKLPREMRQ 410 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 21.8 bits (44), Expect = 8.3 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +2 Query: 281 IQKREDYTKYNKLSRDIRE 337 +++ E+Y Y KL R++R+ Sbjct: 360 VKQVEEYMAYRKLPREMRQ 378 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,340 Number of Sequences: 438 Number of extensions: 12386 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -