BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F06 (888 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P03087 Cluster: Capsid protein VP1; n=1927; Polyomaviru... 41 0.048 UniRef50_Q2C3D2 Cluster: Chitinase, containing dual catalytic do... 35 2.4 UniRef50_P12907 Cluster: Capsid protein VP1; n=79; Polyomavirus|... 33 9.7 >UniRef50_P03087 Cluster: Capsid protein VP1; n=1927; Polyomavirus|Rep: Capsid protein VP1 - Simian virus 40 (SV40) Length = 364 Score = 40.7 bits (91), Expect = 0.048 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 461 DPDMIRYIDEFGQTTTXM 514 DPDMIRYIDEFGQTTT M Sbjct: 346 DPDMIRYIDEFGQTTTRM 363 >UniRef50_Q2C3D2 Cluster: Chitinase, containing dual catalytic domains; n=3; Vibrionaceae|Rep: Chitinase, containing dual catalytic domains - Photobacterium sp. SKA34 Length = 399 Score = 35.1 bits (77), Expect = 2.4 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +1 Query: 106 MKFTVAFALIAMFAIVAVNSQENGGDSPDGEVAPGVDPVKVVD 234 MK+T+ ALIA ++ A NS N D G VA P K+ + Sbjct: 1 MKYTLLAALIAATSLTACNSSSNSSDDYSGYVAQEPKPAKITE 43 >UniRef50_P12907 Cluster: Capsid protein VP1; n=79; Polyomavirus|Rep: Capsid protein VP1 - Murine polyomavirus (strain Crawford small-plaque) (MPyV) Length = 384 Score = 33.1 bits (72), Expect = 9.7 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 461 DPDMIRYIDEFGQTTTXMP 517 DPDM RY+D FG+T T P Sbjct: 364 DPDMTRYVDRFGKTKTVFP 382 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 648,376,709 Number of Sequences: 1657284 Number of extensions: 10207760 Number of successful extensions: 20960 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20937 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 79932179145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -