BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F06 (888 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 27 4.7 SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|S... 27 4.7 SPCC4G3.12c |||ubiquitin-protein ligase E3 |Schizosaccharomyces ... 27 4.7 SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase ki... 26 6.2 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +1 Query: 16 PHYRESLRF*SNISQQHEVIINFLVLRIEIMKFTVAFALIAMFAIVAV 159 P YR R +N+ ++N + L I K VAF +++FAI + Sbjct: 572 PDYRLFFRRYTNLVDIVLAVLNLVTLLPSIRKNPVAFGWLSIFAIARI 619 >SPBC216.07c |tor2|SPBC646.01c|phosphatidylinositol kinase Tor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2337 Score = 26.6 bits (56), Expect = 4.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 78 QFPGFKNRNHEIYGRFCTDRY 140 +FPG K+RN EI + D Y Sbjct: 3 EFPGLKSRNEEIRNKAANDLY 23 >SPCC4G3.12c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 821 Score = 26.6 bits (56), Expect = 4.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 594 TCLLQLIXVTNKAIASQISQIKHFFH 517 +CL+ L TN I ++ KHFFH Sbjct: 765 SCLICLETYTNGDICRKLQACKHFFH 790 >SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase kinase Win1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1436 Score = 26.2 bits (55), Expect = 6.2 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = -1 Query: 252 VNAMIFIHNFHWINAGGDFAIGTVPAVFLRVDSYNRKHSDQCKSDRKFHDFYS 94 V+ ++ I NFHW + I V + ++D Y R + + +S + H Y+ Sbjct: 388 VDVLLAIMNFHWDESNELTPIVAVDNMLQKLDKYERLYPSR-RSILQEHSLYA 439 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,587,459 Number of Sequences: 5004 Number of extensions: 39071 Number of successful extensions: 80 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -