BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F06 (888 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70680-2|CAA94573.1| 424|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z46791-5|CAA86755.2| 948|Caenorhabditis elegans Hypothetical pr... 29 4.4 >Z70680-2|CAA94573.1| 424|Caenorhabditis elegans Hypothetical protein C25G4.4 protein. Length = 424 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -1 Query: 198 FAIGTVPAVFLRVDSYNRKHSDQCKSDRKFHDFYS 94 FA+G P V RV S R Q K D F+D S Sbjct: 332 FALGIPPVVVHRVQSIERNAYQQRKHDEMFNDIQS 366 >Z46791-5|CAA86755.2| 948|Caenorhabditis elegans Hypothetical protein C09G5.6 protein. Length = 948 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 175 GGDSPDGEVAPGVDPVKVVDEDHGVNIVDGEPG 273 G PDG PGV +D + GVN DG+PG Sbjct: 429 GERGPDG--TPGVPGEDGIDGEQGVNGQDGQPG 459 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,926,771 Number of Sequences: 27780 Number of extensions: 245268 Number of successful extensions: 523 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 504 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -