Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP03_F_F06
         (888 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g36390.1 68415.m04466 1,4-alpha-glucan branching enzyme / sta...    31   0.77 

>At2g36390.1 68415.m04466 1,4-alpha-glucan branching enzyme / starch
           branching enzyme class II (SBE2-1) nearly identical to
           starch branching enzyme class II [Arabidopsis thaliana]
           GI:619939
          Length = 858

 Score = 31.5 bits (68), Expect = 0.77
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 2/34 (5%)
 Frame = -1

Query: 243 MIFIHNFHWINAGGDFAIG-TVPAVF-LRVDSYN 148
           ++F+ NFHW N+  D+ IG +VP  + + +DS N
Sbjct: 760 LLFVFNFHWTNSYSDYRIGCSVPGKYKIVLDSDN 793


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,920,493
Number of Sequences: 28952
Number of extensions: 220486
Number of successful extensions: 453
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 444
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 453
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2081245872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)