BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F05 (862 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 85 3e-15 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 81 3e-14 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 79 1e-13 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 77 8e-13 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 77 8e-13 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 77 8e-13 UniRef50_Q9L252 Cluster: Putative uncharacterized protein SCO266... 76 1e-12 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 76 1e-12 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 75 3e-12 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 75 3e-12 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 74 5e-12 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 74 5e-12 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 73 1e-11 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 72 2e-11 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 72 2e-11 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 72 2e-11 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 72 2e-11 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 71 4e-11 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 71 4e-11 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 71 5e-11 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 70 7e-11 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 70 7e-11 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 70 7e-11 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 70 9e-11 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 69 1e-10 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 69 2e-10 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 69 2e-10 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 69 2e-10 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 69 2e-10 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 68 3e-10 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 68 3e-10 UniRef50_Q9VRM2 Cluster: CG10625-PB, isoform B; n=5; Fungi/Metaz... 68 3e-10 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 68 3e-10 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 68 4e-10 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 68 4e-10 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 68 4e-10 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 67 5e-10 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 67 5e-10 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 67 5e-10 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 67 6e-10 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 67 6e-10 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 67 6e-10 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 66 8e-10 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 66 8e-10 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 66 8e-10 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 66 8e-10 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 66 8e-10 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 66 1e-09 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 66 1e-09 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 66 1e-09 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 66 1e-09 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 66 1e-09 UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic p... 65 2e-09 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 65 2e-09 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 65 2e-09 UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; ... 65 2e-09 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 64 3e-09 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 64 4e-09 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 64 4e-09 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 64 4e-09 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 64 4e-09 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 64 4e-09 UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein;... 64 6e-09 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 64 6e-09 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 64 6e-09 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 64 6e-09 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 64 6e-09 UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gamb... 64 6e-09 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 64 6e-09 UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella ve... 64 6e-09 UniRef50_A1Z8H7 Cluster: CG13214-PA, isoform A; n=5; Eukaryota|R... 64 6e-09 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 64 6e-09 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 64 6e-09 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 63 8e-09 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 63 8e-09 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 63 8e-09 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 63 8e-09 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 63 8e-09 UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Pr... 63 8e-09 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 63 8e-09 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 63 1e-08 UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; ... 63 1e-08 UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; ... 63 1e-08 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 63 1e-08 UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; ... 63 1e-08 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 63 1e-08 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 63 1e-08 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 63 1e-08 UniRef50_Q20IN6 Cluster: HrpW; n=1; Pseudomonas cichorii|Rep: Hr... 62 1e-08 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 62 1e-08 UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structu... 62 1e-08 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 62 1e-08 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 62 2e-08 UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12;... 62 2e-08 UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG214... 62 2e-08 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 62 2e-08 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 62 2e-08 UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, in... 62 2e-08 UniRef50_A5H447 Cluster: Zyxin; n=5; Euteleostomi|Rep: Zyxin - X... 62 2e-08 UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; ... 62 2e-08 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 62 2e-08 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 62 2e-08 UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; ... 62 2e-08 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 62 2e-08 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 61 3e-08 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 61 3e-08 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 61 3e-08 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 61 3e-08 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 61 3e-08 UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogene... 61 4e-08 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 61 4e-08 UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n... 61 4e-08 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 61 4e-08 UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. na... 61 4e-08 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 61 4e-08 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 61 4e-08 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 61 4e-08 UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precur... 61 4e-08 UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein;... 60 5e-08 UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled ho... 60 5e-08 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 60 5e-08 UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lu... 60 5e-08 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 60 5e-08 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 60 5e-08 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 60 7e-08 UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein;... 60 7e-08 UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein... 60 7e-08 UniRef50_Q197B3 Cluster: Putative uncharacterized protein; n=1; ... 60 7e-08 UniRef50_Q127H7 Cluster: Putative uncharacterized protein precur... 60 7e-08 UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|R... 60 7e-08 UniRef50_Q5VS40 Cluster: Putative glycine-rich protein; n=3; Ory... 60 7e-08 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 60 7e-08 UniRef50_Q7Z152 Cluster: Collagen protein 51; n=4; Caenorhabditi... 60 7e-08 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 60 7e-08 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 60 7e-08 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 60 9e-08 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 60 9e-08 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 60 9e-08 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 60 9e-08 UniRef50_Q0J6R0 Cluster: Os08g0280200 protein; n=2; Oryza sativa... 60 9e-08 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 60 9e-08 UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057... 60 9e-08 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 60 9e-08 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 60 9e-08 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 60 9e-08 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 60 9e-08 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 59 1e-07 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 59 1e-07 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 59 1e-07 UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emilian... 59 1e-07 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 59 1e-07 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 59 1e-07 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 59 1e-07 UniRef50_P27483 Cluster: Glycine-rich cell wall structural prote... 59 1e-07 UniRef50_A7IPJ6 Cluster: SH3 type 3 domain protein precursor; n=... 59 2e-07 UniRef50_Q43522 Cluster: Tfm5 protein; n=9; Magnoliophyta|Rep: T... 59 2e-07 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 59 2e-07 UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 59 2e-07 UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-... 59 2e-07 UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gamb... 59 2e-07 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 59 2e-07 UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Al... 58 2e-07 UniRef50_Q4T4L4 Cluster: Chromosome undetermined SCAF9593, whole... 58 2e-07 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 58 2e-07 UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG068... 58 2e-07 UniRef50_Q4P6X2 Cluster: Putative uncharacterized protein; n=1; ... 58 2e-07 UniRef50_Q2HGM6 Cluster: Putative uncharacterized protein; n=1; ... 58 2e-07 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 58 2e-07 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 58 2e-07 UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n... 58 3e-07 UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n... 58 3e-07 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 58 3e-07 UniRef50_Q9SXE7 Cluster: T3P18.6; n=2; core eudicotyledons|Rep: ... 58 3e-07 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 58 3e-07 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 58 3e-07 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 58 3e-07 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 58 4e-07 UniRef50_UPI0000584992 Cluster: PREDICTED: similar to actin bind... 58 4e-07 UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; ... 58 4e-07 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 58 4e-07 UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n... 58 4e-07 UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dic... 58 4e-07 UniRef50_A2FA50 Cluster: Proline-rich protein MP-2-related prote... 58 4e-07 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 58 4e-07 UniRef50_A0CFX0 Cluster: Chromosome undetermined scaffold_177, w... 58 4e-07 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 58 4e-07 UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Eute... 58 4e-07 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 57 5e-07 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 57 5e-07 UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza s... 57 5e-07 UniRef50_Q9VC23 Cluster: CG7016-PA; n=2; Sophophora|Rep: CG7016-... 57 5e-07 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 57 5e-07 UniRef50_Q0D0J9 Cluster: Predicted protein; n=1; Aspergillus ter... 57 5e-07 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 57 5e-07 UniRef50_A1CEV2 Cluster: Extracellular threonine rich protein, p... 57 5e-07 UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated p... 57 5e-07 UniRef50_P23246 Cluster: Splicing factor, proline- and glutamine... 57 5e-07 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 57 7e-07 UniRef50_UPI0000DA4780 Cluster: PREDICTED: hypothetical protein;... 57 7e-07 UniRef50_Q8QKX8 Cluster: EsV-1-144; n=1; Ectocarpus siliculosus ... 57 7e-07 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 57 7e-07 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 57 7e-07 UniRef50_Q08YB2 Cluster: Response regulator; n=4; cellular organ... 57 7e-07 UniRef50_Q9LVN1 Cluster: Gb|AAD23008.1; n=2; Arabidopsis thalian... 57 7e-07 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 57 7e-07 UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=... 57 7e-07 UniRef50_Q20327 Cluster: Ground-like (Grd related) protein 4; n=... 57 7e-07 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 57 7e-07 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 57 7e-07 UniRef50_Q4PG90 Cluster: Putative uncharacterized protein; n=1; ... 57 7e-07 UniRef50_Q0U8T6 Cluster: Predicted protein; n=1; Phaeosphaeria n... 57 7e-07 UniRef50_A4R3R8 Cluster: Predicted protein; n=1; Magnaporthe gri... 57 7e-07 UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomyc... 57 7e-07 UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria... 57 7e-07 UniRef50_Q03211 Cluster: Pistil-specific extensin-like protein p... 57 7e-07 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 57 7e-07 UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH30... 56 9e-07 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 56 9e-07 UniRef50_Q2J3C8 Cluster: OmpA/MotB precursor; n=4; Alphaproteoba... 56 9e-07 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 56 9e-07 UniRef50_Q8LJ87 Cluster: Putative leucine-rich repeat/extensin 1... 56 9e-07 UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; ... 56 9e-07 UniRef50_Q22168 Cluster: Putative uncharacterized protein; n=2; ... 56 9e-07 UniRef50_O44367 Cluster: Precollagen D; n=2; Mytilus|Rep: Precol... 56 9e-07 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 56 9e-07 UniRef50_P03211 Cluster: Epstein-Barr nuclear antigen 1; n=50; r... 56 9e-07 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 56 9e-07 UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein;... 56 1e-06 UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein;... 56 1e-06 UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein... 56 1e-06 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 56 1e-06 UniRef50_Q3KEU2 Cluster: Putative uncharacterized protein precur... 56 1e-06 UniRef50_Q9XDH2 Cluster: Proline-rich mucin homolog; n=2; Mycoba... 56 1e-06 UniRef50_Q0RHG8 Cluster: Putative serine/threonine protein kinas... 56 1e-06 UniRef50_Q0LTW4 Cluster: Peptidase M56, BlaR1 precursor; n=1; Ca... 56 1e-06 UniRef50_Q6Z495 Cluster: Putative glycine-rich cell wall structu... 56 1e-06 UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; ... 56 1e-06 UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - ... 56 1e-06 UniRef50_Q58MY1 Cluster: Phage tail fiber-like protein; n=1; Cya... 56 1e-06 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 56 1e-06 UniRef50_Q16630 Cluster: Cleavage and polyadenylation specificit... 56 1e-06 UniRef50_UPI0000F1DE0A Cluster: PREDICTED: hypothetical protein;... 56 2e-06 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 56 2e-06 UniRef50_Q3W0R6 Cluster: Collagen, type III, alpha 1; n=1; Frank... 56 2e-06 UniRef50_A4TD05 Cluster: Putative uncharacterized protein precur... 56 2e-06 UniRef50_A0LQ52 Cluster: Putative uncharacterized protein; n=1; ... 56 2e-06 UniRef50_Q9LY08 Cluster: Oleosin; n=13; Brassicaceae|Rep: Oleosi... 56 2e-06 UniRef50_Q00ZC5 Cluster: Splicing factor 1/branch point binding ... 56 2e-06 UniRef50_O65450 Cluster: Glycine-rich protein; n=1; Arabidopsis ... 56 2e-06 UniRef50_Q58MX6 Cluster: Phage tail fiber-like protein; n=1; Cya... 56 2e-06 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 56 2e-06 UniRef50_Q581B0 Cluster: Putative uncharacterized protein; n=5; ... 56 2e-06 UniRef50_Q7S7S6 Cluster: Putative uncharacterized protein NCU042... 56 2e-06 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 56 2e-06 UniRef50_A5DVD6 Cluster: Putative uncharacterized protein; n=1; ... 56 2e-06 UniRef50_Q86UP3 Cluster: Zinc finger homeobox protein 4; n=18; E... 56 2e-06 UniRef50_P05143 Cluster: Proline-rich protein 2 precursor; n=10;... 56 2e-06 UniRef50_UPI0000E4908A Cluster: PREDICTED: hypothetical protein;... 55 2e-06 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 55 2e-06 UniRef50_Q7X838 Cluster: OSJNBa0085H03.3 protein; n=1; Oryza sat... 55 2e-06 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 55 2e-06 UniRef50_Q872W5 Cluster: Putative uncharacterized protein B2G14.... 55 2e-06 UniRef50_Q6FTP1 Cluster: Similar to sp|P37370 Saccharomyces cere... 55 2e-06 UniRef50_Q82K53 Cluster: Translation initiation factor IF-2; n=5... 55 2e-06 UniRef50_UPI0000DB75B1 Cluster: PREDICTED: similar to One cut do... 55 3e-06 UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; ... 55 3e-06 UniRef50_UPI0000F30461 Cluster: Formin-2.; n=2; Bos taurus|Rep: ... 55 3e-06 UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein;... 55 3e-06 UniRef50_A2SM82 Cluster: Periplasmic protein/ biopolymer transpo... 55 3e-06 UniRef50_Q7F0U2 Cluster: OJ1116_C07.3 protein; n=4; Oryza sativa... 55 3e-06 UniRef50_Q9UA70 Cluster: Unconventional myosin heavy chain MyoK;... 55 3e-06 UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1; Acant... 55 3e-06 UniRef50_Q7PRU1 Cluster: ENSANGP00000019944; n=3; cellular organ... 55 3e-06 UniRef50_Q7PMA5 Cluster: ENSANGP00000031515; n=1; Anopheles gamb... 55 3e-06 UniRef50_A7RV64 Cluster: Predicted protein; n=2; Nematostella ve... 55 3e-06 UniRef50_Q5ANI0 Cluster: Potential fungal zinc cluster transcrip... 55 3e-06 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 55 3e-06 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 55 3e-06 UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family... 55 3e-06 UniRef50_P10165 Cluster: Proline-rich proteoglycan 2 precursor; ... 55 3e-06 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 55 3e-06 UniRef50_UPI0000F2C731 Cluster: PREDICTED: hypothetical protein;... 54 4e-06 UniRef50_A6G1X8 Cluster: Single-stranded DNA-binding protein; n=... 54 4e-06 UniRef50_A1UQ48 Cluster: Peptidase S8 and S53, subtilisin, kexin... 54 4e-06 UniRef50_A1FZ88 Cluster: Outer membrane autotransporter barrel d... 54 4e-06 UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabido... 54 4e-06 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 54 4e-06 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 54 4e-06 UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.... 54 4e-06 UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms... 54 4e-06 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 54 4e-06 UniRef50_Q00486 Cluster: Mini-collagen precursor; n=2; Hydra sp.... 54 4e-06 UniRef50_O96853 Cluster: ORF 1; n=1; Schistosoma haematobium|Rep... 54 4e-06 UniRef50_Q1EA57 Cluster: Predicted protein; n=12; Pezizomycotina... 54 4e-06 UniRef50_A5DP36 Cluster: Putative uncharacterized protein; n=1; ... 54 4e-06 UniRef50_A1DF14 Cluster: Cell wall protein, putative; n=2; Trich... 54 4e-06 UniRef50_Q7Z5R6 Cluster: Amyloid beta A4 precursor protein-bindi... 54 4e-06 UniRef50_UPI0000E48B55 Cluster: PREDICTED: hypothetical protein;... 54 5e-06 UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropica... 54 5e-06 UniRef50_Q04117 Cluster: Salivary proline-rich protein; n=5; Rat... 54 5e-06 UniRef50_Q5YRG4 Cluster: Putative uncharacterized protein; n=1; ... 54 5e-06 UniRef50_A4A9H5 Cluster: Putative uncharacterized protein; n=1; ... 54 5e-06 UniRef50_Q9SUX2 Cluster: Extensin-like protein; n=2; Arabidopsis... 54 5e-06 UniRef50_Q9FED4 Cluster: CCM1-A; n=2; Chlamydomonas reinhardtii|... 54 5e-06 UniRef50_Q6ZDB2 Cluster: Putative uncharacterized protein P0045D... 54 5e-06 UniRef50_Q53LC9 Cluster: Transposon protein, putative, CACTA, En... 54 5e-06 UniRef50_Q0JD12 Cluster: Os04g0438100 protein; n=2; Oryza sativa... 54 5e-06 UniRef50_Q18880 Cluster: Putative uncharacterized protein grl-17... 54 5e-06 UniRef50_A7SEJ5 Cluster: Predicted protein; n=2; Nematostella ve... 54 5e-06 UniRef50_Q7SFQ1 Cluster: Predicted protein; n=1; Neurospora cras... 54 5e-06 UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein P... 54 5e-06 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 54 5e-06 UniRef50_A3GHT1 Cluster: Predicted protein; n=3; Saccharomycetac... 54 5e-06 UniRef50_P42534 Cluster: Putative polyketide hydroxylase; n=4; S... 54 5e-06 UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Sacc... 54 5e-06 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 54 6e-06 UniRef50_Q1IUZ9 Cluster: Putative uncharacterized protein precur... 54 6e-06 UniRef50_A6G120 Cluster: Putative periplasmic protein TonB; n=1;... 54 6e-06 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 54 6e-06 UniRef50_Q8MQE6 Cluster: Wasp (Actin cytoskeleton modulator) hom... 54 6e-06 UniRef50_Q57ZF9 Cluster: Putative uncharacterized protein; n=1; ... 54 6e-06 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 54 6e-06 UniRef50_Q4QAM2 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 54 6e-06 UniRef50_O16161 Cluster: Precollagen P precursor; n=6; Mytilus|R... 54 6e-06 UniRef50_Q870R1 Cluster: Putative uncharacterized protein B1D14.... 54 6e-06 UniRef50_Q5KGJ5 Cluster: Putative uncharacterized protein; n=2; ... 54 6e-06 UniRef50_Q2GSQ1 Cluster: Predicted protein; n=1; Chaetomium glob... 54 6e-06 UniRef50_Q8WZX5 Cluster: 5'-3' exoribonuclease 2; n=11; Pezizomy... 54 6e-06 UniRef50_Q9UMN6 Cluster: WW domain-binding protein 7; n=16; Euka... 54 6e-06 UniRef50_P19706 Cluster: Myosin heavy chain IB; n=5; Eukaryota|R... 54 6e-06 UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pomb... 54 6e-06 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 53 8e-06 UniRef50_UPI0000DB70F4 Cluster: PREDICTED: similar to scribbler ... 53 8e-06 UniRef50_UPI0000D561BD Cluster: PREDICTED: hypothetical protein;... 53 8e-06 UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; ... 53 8e-06 UniRef50_Q9XIB6 Cluster: F13F21.7 protein; n=5; core eudicotyled... 53 8e-06 UniRef50_Q9LT74 Cluster: Similarity to late embryogenesis abunda... 53 8e-06 UniRef50_Q9LJ64 Cluster: Extensin protein-like; n=8; Eukaryota|R... 53 8e-06 UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhar... 53 8e-06 UniRef50_Q8H776 Cluster: Putative uncharacterized protein; n=1; ... 53 8e-06 UniRef50_Q0DLG0 Cluster: Os05g0104000 protein; n=9; Oryza sativa... 53 8e-06 UniRef50_O02049 Cluster: Putative uncharacterized protein; n=2; ... 53 8e-06 UniRef50_Q6FT22 Cluster: Candida glabrata strain CBS138 chromoso... 53 8e-06 UniRef50_Q5KLE2 Cluster: Putative uncharacterized protein; n=1; ... 53 8e-06 UniRef50_Q2GSQ8 Cluster: Putative uncharacterized protein; n=2; ... 53 8e-06 UniRef50_A4QRZ1 Cluster: Putative uncharacterized protein; n=1; ... 53 8e-06 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 53 8e-06 UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana taba... 53 8e-06 UniRef50_UPI00015B52EC Cluster: PREDICTED: similar to ENSANGP000... 53 1e-05 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 53 1e-05 UniRef50_UPI0000EBEBA8 Cluster: PREDICTED: hypothetical protein;... 53 1e-05 UniRef50_UPI0000DB7618 Cluster: PREDICTED: hypothetical protein;... 53 1e-05 UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to... 53 1e-05 UniRef50_UPI0000F30AB8 Cluster: UPI0000F30AB8 related cluster; n... 53 1e-05 UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 ... 53 1e-05 UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome s... 53 1e-05 UniRef50_Q9PF60 Cluster: Endo-1,4-beta-glucanase; n=7; Xanthomon... 53 1e-05 UniRef50_Q8YTC9 Cluster: All2793 protein; n=3; Bacteria|Rep: All... 53 1e-05 UniRef50_Q0SG23 Cluster: Possible glycine rich protein; n=1; Rho... 53 1e-05 UniRef50_Q0LCI7 Cluster: Putative uncharacterized protein; n=1; ... 53 1e-05 UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP... 53 1e-05 UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliop... 53 1e-05 UniRef50_A5AEG8 Cluster: Putative uncharacterized protein; n=1; ... 53 1e-05 UniRef50_Q7PNQ0 Cluster: ENSANGP00000005715; n=2; Culicidae|Rep:... 53 1e-05 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 53 1e-05 UniRef50_A7RHP4 Cluster: Predicted protein; n=3; Nematostella ve... 53 1e-05 UniRef50_Q96JH1 Cluster: KIAA1856 protein; n=21; Eutheria|Rep: K... 53 1e-05 UniRef50_Q4P459 Cluster: Putative uncharacterized protein; n=1; ... 53 1e-05 UniRef50_Q2HGD8 Cluster: Predicted protein; n=1; Chaetomium glob... 53 1e-05 UniRef50_Q9Y2W2 Cluster: WW domain-binding protein 11; n=42; Eut... 53 1e-05 UniRef50_Q9UPT8 Cluster: Zinc finger CCCH domain-containing prot... 53 1e-05 UniRef50_UPI0000E4931A Cluster: PREDICTED: hypothetical protein;... 52 1e-05 UniRef50_UPI0000DC00CB Cluster: SH3 domain binding protein CR16;... 52 1e-05 UniRef50_A7IPA8 Cluster: Putative uncharacterized protein precur... 52 1e-05 UniRef50_A4FPH6 Cluster: PE-PGRS family protein; n=1; Saccharopo... 52 1e-05 UniRef50_A3Q026 Cluster: Putative uncharacterized protein precur... 52 1e-05 UniRef50_Q3EDB7 Cluster: Uncharacterized protein At1g15830.1; n=... 52 1e-05 UniRef50_Q2QR52 Cluster: Transposon protein, putative, CACTA, En... 52 1e-05 UniRef50_O65514 Cluster: Putative glycine-rich cell wall protein... 52 1e-05 UniRef50_Q7YYP6 Cluster: Hydroxyproline-rich glycoprotein dz-hrg... 52 1e-05 UniRef50_A7SIG7 Cluster: Predicted protein; n=1; Nematostella ve... 52 1e-05 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 52 1e-05 UniRef50_A7TP17 Cluster: Putative uncharacterized protein; n=1; ... 52 1e-05 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 52 1e-05 UniRef50_A4QXQ3 Cluster: Putative uncharacterized protein; n=6; ... 52 1e-05 UniRef50_A4QQZ5 Cluster: Predicted protein; n=1; Magnaporthe gri... 52 1e-05 UniRef50_P10496 Cluster: Glycine-rich cell wall structural prote... 52 1e-05 UniRef50_P40602 Cluster: Anter-specific proline-rich protein APG... 52 1e-05 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 52 2e-05 UniRef50_Q4A2U2 Cluster: Putative membrane protein precursor; n=... 52 2e-05 UniRef50_Q3WAE2 Cluster: Protein kinase:NHL repeat; n=2; Frankia... 52 2e-05 UniRef50_Q2CA03 Cluster: Phosphoribosylformylglycinamidine synth... 52 2e-05 UniRef50_A3ZRC6 Cluster: Putative uncharacterized protein; n=2; ... 52 2e-05 UniRef50_Q9SFY8 Cluster: T22C5.16; n=2; Arabidopsis thaliana|Rep... 52 2e-05 UniRef50_Q3E939 Cluster: Uncharacterized protein At5g26080.1; n=... 52 2e-05 UniRef50_Q09085 Cluster: Hydroxyproline-rich glycoprotein; n=2; ... 52 2e-05 UniRef50_Q9VFU0 Cluster: CG9757-PA; n=3; cellular organisms|Rep:... 52 2e-05 UniRef50_A2F4E1 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_UPI0000F2146D Cluster: PREDICTED: similar to alpha-1 ty... 52 2e-05 UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L spl... 52 2e-05 UniRef50_UPI0000DC2237 Cluster: RIKEN cDNA D030022P06 gene; n=6;... 52 2e-05 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 52 2e-05 UniRef50_Q4RQM1 Cluster: Chromosome 2 SCAF15004, whole genome sh... 52 2e-05 UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome... 52 2e-05 UniRef50_A5US08 Cluster: Conserved repeat domain precursor; n=2;... 52 2e-05 UniRef50_A1GBV0 Cluster: Collagen triple helix repeat precursor;... 52 2e-05 UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; ... 52 2e-05 UniRef50_Q9STP1 Cluster: Putative proline-rich protein; n=2; Euk... 52 2e-05 UniRef50_Q9FGY2 Cluster: Dbj|BAA84609.1; n=2; Arabidopsis thalia... 52 2e-05 UniRef50_Q8RUS0 Cluster: Putative uncharacterized protein At2g18... 52 2e-05 UniRef50_Q10P17 Cluster: Transposon protein, putative, CACTA, En... 52 2e-05 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 52 2e-05 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar ... 52 2e-05 UniRef50_Q9W4V1 Cluster: CG3588-PB, isoform B; n=20; melanogaste... 52 2e-05 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 52 2e-05 UniRef50_Q752A6 Cluster: AFR669Wp; n=1; Eremothecium gossypii|Re... 52 2e-05 UniRef50_Q4PDN4 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_Q1DIN9 Cluster: Predicted protein; n=1; Coccidioides im... 52 2e-05 UniRef50_A2QYL5 Cluster: Contig An12c0060, complete genome; n=1;... 52 2e-05 UniRef50_Q03251 Cluster: Glycine-rich RNA-binding protein 8; n=7... 52 2e-05 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 52 2e-05 UniRef50_UPI00015056F9 Cluster: DNA binding / ligand-dependent n... 51 3e-05 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 51 3e-05 UniRef50_UPI0000ECB5F0 Cluster: peroxisome proliferator-activate... 51 3e-05 UniRef50_Q7SZN7 Cluster: Enah/Vasp-like a; n=3; Danio rerio|Rep:... 51 3e-05 UniRef50_Q08C24 Cluster: Zgc:153739; n=4; Clupeocephala|Rep: Zgc... 51 3e-05 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 51 3e-05 UniRef50_A1G4V0 Cluster: Putative uncharacterized protein; n=2; ... 51 3e-05 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 51 3e-05 UniRef50_Q9FPQ5 Cluster: Gamete-specific hydroxyproline-rich gly... 51 3e-05 UniRef50_Q5JN59 Cluster: Putative loricrin; n=3; Oryza sativa|Re... 51 3e-05 UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; ... 51 3e-05 UniRef50_Q9VRI3 Cluster: CG10918-PA; n=3; melanogaster subgroup|... 51 3e-05 UniRef50_Q9VEP4 Cluster: CG5225-PA; n=2; Drosophila melanogaster... 51 3e-05 UniRef50_Q581C6 Cluster: Flagellum-adhesion glycoprotein, putati... 51 3e-05 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 51 3e-05 UniRef50_Q4QBP0 Cluster: Putative uncharacterized protein; n=1; ... 51 3e-05 UniRef50_O45114 Cluster: Collagen protein 103; n=3; cellular org... 51 3e-05 UniRef50_Q9C0D6 Cluster: KIAA1727 protein; n=13; Tetrapoda|Rep: ... 51 3e-05 UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cere... 51 3e-05 UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; ... 51 3e-05 UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe gri... 51 3e-05 UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Ad... 51 3e-05 UniRef50_P41479 Cluster: Uncharacterized 24.1 kDa protein in LEF... 51 3e-05 UniRef50_O43516 Cluster: WAS/WASL-interacting protein family mem... 51 3e-05 UniRef50_Q01851 Cluster: POU domain, class 4, transcription fact... 51 3e-05 UniRef50_UPI00005101A5 Cluster: hypothetical protein BlinB010028... 51 4e-05 UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whol... 51 4e-05 UniRef50_A2RV11 Cluster: FNBP4 protein; n=7; Danio rerio|Rep: FN... 51 4e-05 UniRef50_Q9E938 Cluster: ICP4 protein; n=2; Gallid herpesvirus 3... 51 4e-05 UniRef50_Q9XAI1 Cluster: Putative serine-threonine protein kinas... 51 4e-05 UniRef50_Q89KP2 Cluster: Bll4862 protein; n=4; Bradyrhizobiaceae... 51 4e-05 UniRef50_O69740 Cluster: CONSERVED HYPOTHETICAL PROLINE AND ALAN... 51 4e-05 UniRef50_A0G0U4 Cluster: Putative uncharacterized protein; n=1; ... 51 4e-05 UniRef50_A0ADW6 Cluster: Putative secreted proline-rich protein;... 51 4e-05 UniRef50_Q6NMD9 Cluster: At1g02405; n=1; Arabidopsis thaliana|Re... 51 4e-05 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 51 4e-05 UniRef50_Q01942 Cluster: Extensin; n=22; root|Rep: Extensin - So... 51 4e-05 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 51 4e-05 UniRef50_Q7PQT9 Cluster: ENSANGP00000014747; n=1; Anopheles gamb... 51 4e-05 UniRef50_Q5DGR5 Cluster: SJCHGC08168 protein; n=1; Schistosoma j... 51 4e-05 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 51 4e-05 UniRef50_Q4XND7 Cluster: Putative uncharacterized protein; n=1; ... 51 4e-05 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 51 4e-05 UniRef50_Q19479 Cluster: Putative uncharacterized protein inft-2... 51 4e-05 UniRef50_Q6CUT9 Cluster: Similar to sp|P41832 Saccharomyces cere... 51 4e-05 UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cere... 51 4e-05 UniRef50_Q5KPW9 Cluster: U1 snRNP 70K protein (Short form), puta... 51 4e-05 UniRef50_O53553 Cluster: Uncharacterized PE-PGRS family protein ... 51 4e-05 UniRef50_P10569 Cluster: Myosin IC heavy chain; n=4; Eukaryota|R... 51 4e-05 UniRef50_P18165 Cluster: Loricrin; n=18; Eukaryota|Rep: Loricrin... 51 4e-05 UniRef50_P0C5C7 Cluster: Glycine-rich cell wall structural prote... 51 4e-05 UniRef50_P27658 Cluster: Collagen alpha-1(VIII) chain precursor;... 51 4e-05 UniRef50_UPI00015B4FEB Cluster: PREDICTED: similar to conserved ... 50 6e-05 UniRef50_UPI0000F2CB43 Cluster: PREDICTED: hypothetical protein;... 50 6e-05 UniRef50_UPI000023E7FD Cluster: hypothetical protein FG06780.1; ... 50 6e-05 UniRef50_UPI00006A2843 Cluster: UPI00006A2843 related cluster; n... 50 6e-05 UniRef50_A1YIZ3 Cluster: Capsid-associated protein; n=1; Spodopt... 50 6e-05 UniRef50_Q3W1Z4 Cluster: Putative uncharacterized protein; n=1; ... 50 6e-05 UniRef50_Q0RST3 Cluster: Putative uncharacterized protein; n=1; ... 50 6e-05 UniRef50_Q0RIC4 Cluster: Putative FMN-dependent lactate dehydrog... 50 6e-05 UniRef50_A6GGW9 Cluster: Pkn9 associate protein 1; n=1; Plesiocy... 50 6e-05 UniRef50_A6GG77 Cluster: Putative uncharacterized protein; n=1; ... 50 6e-05 UniRef50_Q75QN8 Cluster: Cold shock domain protein 3; n=2; Triti... 50 6e-05 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 50 6e-05 UniRef50_Q9VD49 Cluster: CG5778-PA; n=1; Drosophila melanogaster... 50 6e-05 UniRef50_Q9VB86 Cluster: CG5812-PA; n=10; Endopterygota|Rep: CG5... 50 6e-05 UniRef50_Q61XH9 Cluster: Putative uncharacterized protein CBG039... 50 6e-05 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 50 6e-05 UniRef50_A6QWU5 Cluster: Predicted protein; n=10; Pezizomycotina... 50 6e-05 UniRef50_A4R6C0 Cluster: Predicted protein; n=1; Magnaporthe gri... 50 6e-05 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 50 6e-05 UniRef50_P17816 Cluster: Glycine-rich cell wall structural prote... 50 6e-05 UniRef50_P23093 Cluster: Circumsporozoite protein precursor; n=3... 50 6e-05 UniRef50_UPI0000F31DEE Cluster: UPI0000F31DEE related cluster; n... 50 8e-05 UniRef50_Q65553 Cluster: UL36; n=5; Varicellovirus|Rep: UL36 - B... 50 8e-05 UniRef50_Q2JF54 Cluster: Putative uncharacterized protein; n=1; ... 50 8e-05 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 84.6 bits (200), Expect = 3e-15 Identities = 42/87 (48%), Positives = 42/87 (48%), Gaps = 3/87 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX--PGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP GGGG PPPPPP P PPPP PP GG P P PPPPP Sbjct: 667 PPPPPMTGGGGPP-----PPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPP 721 Query: 743 XPPXPXA-GPPXPAAPXXXPPXXGXGG 820 PP A GPP P P P GG Sbjct: 722 PPPGAKAGGPPPPPPPFGKGPPPPPGG 748 Score = 72.5 bits (170), Expect = 1e-11 Identities = 39/86 (45%), Positives = 39/86 (45%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX---PGPPPPXPPXXGG---XXXPXAPXXXAXP 730 PPPPP GGG PPPPPP P PPPP PP GG P P P Sbjct: 652 PPPPPMTGGGAPP-----PPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGP 706 Query: 731 PPPPXPP--XPXAGPPXPAAPXXXPP 802 PPPP PP P PP P A PP Sbjct: 707 PPPPPPPGGGPPPPPPPPGAKAGGPP 732 Score = 66.5 bits (155), Expect = 8e-10 Identities = 39/106 (36%), Positives = 39/106 (36%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP GG P GGG PPPP GGG PPPPP G Sbjct: 655 PPMTGGGAPPPPPPPPPMTGGGGPPPPP--PPPPMTGGG--------PPPPPPPPPMTGG 704 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 P P PPPPPP P PPPPPP GG G Sbjct: 705 GPPPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPPGGFG 750 Score = 61.3 bits (142), Expect = 3e-08 Identities = 30/68 (44%), Positives = 30/68 (44%), Gaps = 9/68 (13%) Frame = +2 Query: 626 PPPPPP----XXXPGPPPPXPPXXGGXXXPXAP-----XXXAXPPPPPXPPXPXAGPPXP 778 PPPPPP P PPPP PP GG P P PPPPP PP GPP P Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPP 709 Query: 779 AAPXXXPP 802 P P Sbjct: 710 PPPPGGGP 717 Score = 58.0 bits (134), Expect = 3e-07 Identities = 50/143 (34%), Positives = 50/143 (34%), Gaps = 5/143 (3%) Frame = +2 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 PPPP P GGG GGGG P GGG Sbjct: 650 PPPPPPP-----MTGGGAPPPPPPPPPMTGGGGPPPPPPP-------PPMTGGG------ 691 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXG---GXXXPXAPXXXA 724 PPPPP GGG PPPPPP GPPPP PP G G P P Sbjct: 692 -PPPPPPPPPMTGGG---------PPPPPPPPGGGPPPP-PPPPGAKAGGPPPPPPPFGK 740 Query: 725 XPPPPP--XPPXPXAGPPXPAAP 787 PPPPP A PP P Sbjct: 741 GPPPPPGGFGMKKAAAPPRKEVP 763 Score = 55.6 bits (128), Expect = 2e-06 Identities = 35/92 (38%), Positives = 35/92 (38%), Gaps = 8/92 (8%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX---PPPPPPXPXXPXX-- 436 PPPP GGG PPPPP G P P PPPPPP P Sbjct: 653 PPPPMTGGGA------PPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGP 706 Query: 435 PPPPPPP---XXXXXXXXGXGGGGXXXPPXFF 349 PPPPPPP G GG PP F Sbjct: 707 PPPPPPPGGGPPPPPPPPGAKAGGPPPPPPPF 738 Score = 54.8 bits (126), Expect = 3e-06 Identities = 41/119 (34%), Positives = 41/119 (34%), Gaps = 5/119 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXP-----XXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PPPPP G P P PPPPPP P PPPPPPP GG Sbjct: 652 PPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMT-------GG 704 Query: 375 GXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPG 199 G PP P PG G PPPP P P PGG G Sbjct: 705 GPPPPP--------PPPGGGPPPPPPPPGAKAGGPPPPPPPFGKGP-----PPPPGGFG 750 Score = 50.8 bits (116), Expect = 4e-05 Identities = 41/126 (32%), Positives = 41/126 (32%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG PPPP P GGGG GGG P GGG Sbjct: 659 GGGAPPPPPPPPP----MTGGGGPPPPPPPPPMTGGGPPPPPPP--------PPMTGGGP 706 Query: 539 GXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXX 718 PPPPP G PPPPPP GPPPP P G AP Sbjct: 707 PPPPPPPGGGPPPPPPPPGA-----KAGGPPPPPPPFGKGPPPP--PGGFGMKKAAAPPR 759 Query: 719 XAXPPP 736 P P Sbjct: 760 KEVPVP 765 Score = 50.4 bits (115), Expect = 6e-05 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 2/68 (2%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXG--EXXKXPXXPXXXXXPPPPPXXXXXXX 437 A PPPP GGG PPPPP G P P PPPPP Sbjct: 649 APPPPPPPMTGGGAPPP-----PPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTG 703 Query: 436 TPPPPPPP 413 PPPPPP Sbjct: 704 GGPPPPPP 711 Score = 46.4 bits (105), Expect = 0.001 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAP----XXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 P PPPP G P P PPPPP PP GPP P P PP G G Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPP---PPMTGGG 705 Score = 44.8 bits (101), Expect = 0.003 Identities = 32/95 (33%), Positives = 32/95 (33%), Gaps = 1/95 (1%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX 295 PPPPPP PPPPPPP G GG PP P Sbjct: 651 PPPPPPMTGGGAPPPPPPPPPMT-----GGGGPPPPPPP------PPMTGGGPPPPPPPP 699 Query: 294 PGXXXXGXXPPPPXXXXPPRXPXTP-XXPGGPGXP 193 P PPPP PP P P GGP P Sbjct: 700 PMTGGGPPPPPPPPGGGPPPPPPPPGAKAGGPPPP 734 Score = 42.7 bits (96), Expect = 0.011 Identities = 29/100 (29%), Positives = 29/100 (29%), Gaps = 2/100 (2%) Frame = -1 Query: 715 GGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPP 536 GG PP GGG G PPPP GG PP Sbjct: 659 GGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPP 718 Query: 535 PPPXXXG--EXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP G P P PPPPP PP Sbjct: 719 PPPPPPGAKAGGPPPPPPPFGKGPPPPPGGFGMKKAAAPP 758 Score = 42.3 bits (95), Expect = 0.015 Identities = 33/118 (27%), Positives = 33/118 (27%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P GG P G GG G PP GGG P Sbjct: 653 PPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPP 712 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP 466 GGG PPPP GG PPPP K P P P Sbjct: 713 PGGG-----PPPPPPPPGAKAGGPPPPPPPFGKGPPPPPGGFGMKKAAAPPRKEVPVP 765 Score = 39.5 bits (88), Expect = 0.11 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 2/96 (2%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXX--PPPPPXXX 518 PP GGG G PPPP GGG PPPPP Sbjct: 666 PPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPPG 725 Query: 517 GEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 + P P PPPP PP E Sbjct: 726 AKAGGPPPPPPPFGKGPPPPPGGFGMKKAAAPPRKE 761 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 81.4 bits (192), Expect = 3e-14 Identities = 37/78 (47%), Positives = 37/78 (47%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG C PPPPPP PPPP PP G P P PPPPP P Sbjct: 442 PPPPPLPGGS---CIP---PPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPPPPPP 495 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P G P P P PP Sbjct: 496 PFPGGGVPPPPFPGGGPP 513 Score = 72.5 bits (170), Expect = 1e-11 Identities = 40/92 (43%), Positives = 40/92 (43%), Gaps = 9/92 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG----PPPPXPPXXGG--XXXPXAPXXXAXP 730 PPPPP G G PPPPPP PG PPPP PP GG P P P Sbjct: 424 PPPPPLPPGVGAP----PPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVP 479 Query: 731 PPPPXP---PXPXAGPPXPAAPXXXPPXXGXG 817 PPPP P P P PP P PP G G Sbjct: 480 PPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGG 511 Score = 62.9 bits (146), Expect = 1e-08 Identities = 31/70 (44%), Positives = 31/70 (44%), Gaps = 11/70 (15%) Frame = +2 Query: 626 PPPPPP--------XXXPGPPPPXPPXXGG---XXXPXAPXXXAXPPPPPXPPXPXAGPP 772 PPPPPP P PPPP PP GG P P PPPPP PP P PP Sbjct: 421 PPPPPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPP 480 Query: 773 XPAAPXXXPP 802 P P PP Sbjct: 481 PPPLPGGAPP 490 Score = 59.3 bits (137), Expect = 1e-07 Identities = 34/93 (36%), Positives = 34/93 (36%), Gaps = 1/93 (1%) Frame = -2 Query: 633 GGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX 454 G G PPPP GG PPPPP G P P PPPPP Sbjct: 432 GVGAPPPPPPPPPPPLPGGS-------CIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPL 484 Query: 453 PXX-PXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P P PPPPP P GGG PP Sbjct: 485 PGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPP 517 Score = 58.0 bits (134), Expect = 3e-07 Identities = 30/71 (42%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = +2 Query: 569 PPPPPXXGG-GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP GG PPPPPP PG P PP GG P P P P Sbjct: 469 PPPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPPIGGMGVPRLPG 528 Query: 746 PPXPXAGPPXP 778 PP +GPP P Sbjct: 529 PPV-ASGPPKP 538 Score = 57.6 bits (133), Expect = 4e-07 Identities = 43/116 (37%), Positives = 43/116 (37%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP G P P PPPPPP P PPPPPPP G GG P Sbjct: 424 PPPPPLPPGVGAPPPPP-----PPPPPPLPGGSCIPPPPPPP--------GMGGAPPPPP 470 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P F PG G PPPP P P P PGG G P Sbjct: 471 PPPF------------------PG----GVPPPPPLPGGAPPPPPPPPFPGG-GVP 503 Score = 55.6 bits (128), Expect = 2e-06 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPP P P P PPPPPP P PPPPP Sbjct: 424 PPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPP 483 Query: 420 PP--XXXXXXXXGXGGGGXXXPP 358 P GGG PP Sbjct: 484 LPGGAPPPPPPPPFPGGGVPPPP 506 Score = 54.0 bits (124), Expect = 5e-06 Identities = 30/81 (37%), Positives = 30/81 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G GG PPPPP P P PPPPPP P PPPP Sbjct: 455 PPPPPPGMGGAP--------PPPPPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPP 506 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 P GG G P Sbjct: 507 FPGGGPPPPPPIGGMGVPRLP 527 Score = 50.8 bits (116), Expect = 4e-05 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G G P PPPP P PPP PP GG PP P Sbjct: 420 PPPPPPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFP 475 Score = 50.4 bits (115), Expect = 6e-05 Identities = 43/134 (32%), Positives = 43/134 (32%), Gaps = 1/134 (0%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPPP G P PPPPP P PPPPP Sbjct: 425 PPPPLPPGVGAPPPPP----PPPPPPLPGGSCIPP-------PPPPPGMGGAPPPPPPPP 473 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPP-XXXX 244 P GG PP F P P G PPPP Sbjct: 474 FPGGVPPPPPLPGGAPPPPPPPPF-----------PGGGVPPPPFPGGGPPPPPPIGGMG 522 Query: 243 PPRXPXTPXXPGGP 202 PR P P G P Sbjct: 523 VPRLPGPPVASGPP 536 Score = 49.2 bits (112), Expect = 1e-04 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGE-XXKXPXXPXXXXXPPPPPXXXXXXXT 434 A PPPP G PPPPP G P P PPPPP Sbjct: 419 APPPPPPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGV 478 Query: 433 PPPPPPP 413 PPPPP P Sbjct: 479 PPPPPLP 485 Score = 47.6 bits (108), Expect = 4e-04 Identities = 33/91 (36%), Positives = 33/91 (36%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP GG P G GG PPPP GG PPPPP G Sbjct: 445 PPLPGGSCIPPPPPPPGMGGA------PPPPPPPPFPGG----------VPPPPPLPGGA 488 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P P PPPP P PPPPPP Sbjct: 489 PPPPPPPPFPGGGVPPPPFPG--GGPPPPPP 517 Score = 46.8 bits (106), Expect = 7e-04 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 5/65 (7%) Frame = +2 Query: 641 PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP-----AAPXXXPPX 805 P P PPPP PP G P P PPPPP P PP P AP PP Sbjct: 416 PAAAPPPPPPPPPLPPGVGAPPPP---PPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPP 472 Query: 806 XGXGG 820 GG Sbjct: 473 PFPGG 477 Score = 45.2 bits (102), Expect = 0.002 Identities = 31/94 (32%), Positives = 31/94 (32%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX 295 PPPPPP P PPPPPPP GG PP Sbjct: 423 PPPPPPLPPGVGAPPPPPPPPPPPLP-----GGSCIPPPP-------------------- 457 Query: 294 PGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P G PPPP P P P PGG P Sbjct: 458 PPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPP 491 Score = 45.2 bits (102), Expect = 0.002 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 5/67 (7%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXP-----XXPPPPPPXXXPXPPPXXPPXXGGXXXX 704 G P PPPP GG P PPPPPP P P PP GG Sbjct: 432 GVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPP 491 Query: 705 XXPPGXP 725 PP P Sbjct: 492 PPPPPFP 498 Score = 44.4 bits (100), Expect = 0.004 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 10/74 (13%) Frame = +2 Query: 632 PPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXP-----PPPPXPPXPXAGPPXPAAP-- 787 PPPP PP PP PP G P P P PPPP PP PP P P Sbjct: 420 PPPP-----PPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPF 474 Query: 788 --XXXPPXXGXGGA 823 PP GGA Sbjct: 475 PGGVPPPPPLPGGA 488 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP GG PPPPP P P PPPPP Sbjct: 463 GGAPPPPPPPPFPGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPPIGGMG 522 Query: 439 XTPPPPPP 416 P PP Sbjct: 523 VPRLPGPP 530 Score = 40.3 bits (90), Expect = 0.061 Identities = 26/83 (31%), Positives = 27/83 (32%) Frame = -2 Query: 711 GAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPP 532 G G PP GG P GG PPPP GGG PPP Sbjct: 461 GMGGAPPPPPPPPFPGGVPPPPPLPGGA-----PPPPPPPPFPGGGVPPPPFPGGGPPPP 515 Query: 531 PPXXXGXXXKXPXPXXXXXPPPP 463 PP + P P PP P Sbjct: 516 PPIGGMGVPRLPGPPVASGPPKP 538 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 686 GGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 G AP PPPPP P P G P P P PP G Sbjct: 408 GAPLLSAAPAAAPPPPPPPPPLPPGVGAPPPPPPPPPPPLPG 449 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 491 PXXXPXPPPPPXXLXXXXNPPPPPPP 414 P P PPPPP L PPPPPP Sbjct: 416 PAAAPPPPPPPPPLPPGVGAPPPPPP 441 Score = 37.9 bits (84), Expect = 0.33 Identities = 41/133 (30%), Positives = 41/133 (30%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG PPPP P G GG G P GG Sbjct: 449 GGSCIPPPPPP-------------------PGMGGAPPPPPPPPFPGGVPPPPPLPGGA- 488 Query: 539 GXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXX 718 PPPPP GGG PPPP PG PP PP GG P P Sbjct: 489 -------PPPPPPPPFPGGG--------VPPPP----FPGGGPPPPPPIGGMGVPRLP-- 527 Query: 719 XAXPPPPPXPPXP 757 PP PP P Sbjct: 528 --GPPVASGPPKP 538 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP 461 G PPPP GGG PPPPP G P PP P Sbjct: 486 GGAPPPPPPPPFPGGGVPPPPFPGGGPPPPPPIGGMGVPRLPGPPVASGPPKP 538 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +3 Query: 609 AXXPXXPPPP-PP---XXXPXPPPXXPPXXGGXXXXXXPP 716 A P PPPP PP P PPP PP GG PP Sbjct: 419 APPPPPPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPP 458 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXX-PPPPPPXXXPXPPP-XXPPXXGG 692 PPPP GGG P PPPPPP P PP G Sbjct: 492 PPPPPFPGGGVPPPPFPGGGPPPPPPIGGMGVPRLPGPPVASG 534 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 79.0 bits (186), Expect = 1e-13 Identities = 34/78 (43%), Positives = 35/78 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P +P PP Sbjct: 667 PPPPPPPPLPPSPPPPPP 684 Score = 79.0 bits (186), Expect = 1e-13 Identities = 34/78 (43%), Positives = 35/78 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P + PP P P PP Sbjct: 674 PLPPSPPPPPPPPPPPPP 691 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 289 PPPPPPPPPPPPPPPPPP 306 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 301 PPPPPPPPPPPPPPPPPP 318 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 302 PPPPPPPPPPPPPPPPPP 319 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 303 PPPPPPPPPPPPPPPPPP 320 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 304 PPPPPPPPPPPPPPPPPP 321 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 305 PPPPPPPPPPPPPPPPPP 322 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 306 PPPPPPPPPPPPPPPPPP 323 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 307 PPPPPPPPPPPPPPPPPP 324 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 308 PPPPPPPPPPPPPPPPPP 325 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 309 PPPPPPPPPPPPPPPPPP 326 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 310 PPPPPPPPPPPPPPPPPP 327 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 311 PPPPPPPPPPPPPPPPPP 328 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 312 PPPPPPPPPPPPPPPPPP 329 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 313 PPPPPPPPPPPPPPPPPP 330 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 314 PPPPPPPPPPPPPPPPPP 331 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 315 PPPPPPPPPPPPPPPPPP 332 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 316 PPPPPPPPPPPPPPPPPP 333 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 317 PPPPPPPPPPPPPPPPPP 334 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 318 PPPPPPPPPPPPPPPPPP 335 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 319 PPPPPPPPPPPPPPPPPP 336 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 320 PPPPPPPPPPPPPPPPPP 337 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 321 PPPPPPPPPPPPPPPPPP 338 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 322 PPPPPPPPPPPPPPPPPP 339 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 323 PPPPPPPPPPPPPPPPPP 340 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 324 PPPPPPPPPPPPPPPPPP 341 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 325 PPPPPPPPPPPPPPPPPP 342 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 326 PPPPPPPPPPPPPPPPPP 343 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 327 PPPPPPPPPPPPPPPPPP 344 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 328 PPPPPPPPPPPPPPPPPP 345 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 329 PPPPPPPPPPPPPPPPPP 346 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 330 PPPPPPPPPPPPPPPPPP 347 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 331 PPPPPPPPPPPPPPPPPP 348 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 332 PPPPPPPPPPPPPPPPPP 349 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 333 PPPPPPPPPPPPPPPPPP 350 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 334 PPPPPPPPPPPPPPPPPP 351 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 335 PPPPPPPPPPPPPPPPPP 352 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 336 PPPPPPPPPPPPPPPPPP 353 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 337 PPPPPPPPPPPPPPPPPP 354 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 338 PPPPPPPPPPPPPPPPPP 355 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 339 PPPPPPPPPPPPPPPPPP 356 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 340 PPPPPPPPPPPPPPPPPP 357 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 341 PPPPPPPPPPPPPPPPPP 358 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 342 PPPPPPPPPPPPPPPPPP 359 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 343 PPPPPPPPPPPPPPPPPP 360 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 344 PPPPPPPPPPPPPPPPPP 361 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 345 PPPPPPPPPPPPPPPPPP 362 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 346 PPPPPPPPPPPPPPPPPP 363 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 347 PPPPPPPPPPPPPPPPPP 364 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 348 PPPPPPPPPPPPPPPPPP 365 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 349 PPPPPPPPPPPPPPPPPP 366 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 350 PPPPPPPPPPPPPPPPPP 367 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 351 PPPPPPPPPPPPPPPPPP 368 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 352 PPPPPPPPPPPPPPPPPP 369 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 353 PPPPPPPPPPPPPPPPPP 370 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 354 PPPPPPPPPPPPPPPPPP 371 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 355 PPPPPPPPPPPPPPPPPP 372 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 356 PPPPPPPPPPPPPPPPPP 373 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 357 PPPPPPPPPPPPPPPPPP 374 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 358 PPPPPPPPPPPPPPPPPP 375 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 359 PPPPPPPPPPPPPPPPPP 376 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 360 PPPPPPPPPPPPPPPPPP 377 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 361 PPPPPPPPPPPPPPPPPP 378 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 362 PPPPPPPPPPPPPPPPPP 379 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 363 PPPPPPPPPPPPPPPPPP 380 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 364 PPPPPPPPPPPPPPPPPP 381 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 365 PPPPPPPPPPPPPPPPPP 382 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 366 PPPPPPPPPPPPPPPPPP 383 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 367 PPPPPPPPPPPPPPPPPP 384 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 368 PPPPPPPPPPPPPPPPPP 385 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 369 PPPPPPPPPPPPPPPPPP 386 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 370 PPPPPPPPPPPPPPPPPP 387 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 371 PPPPPPPPPPPPPPPPPP 388 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 372 PPPPPPPPPPPPPPPPPP 389 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 373 PPPPPPPPPPPPPPPPPP 390 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 374 PPPPPPPPPPPPPPPPPP 391 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 375 PPPPPPPPPPPPPPPPPP 392 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 376 PPPPPPPPPPPPPPPPPP 393 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 377 PPPPPPPPPPPPPPPPPP 394 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 378 PPPPPPPPPPPPPPPPPP 395 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 379 PPPPPPPPPPPPPPPPPP 396 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 380 PPPPPPPPPPPPPPPPPP 397 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 381 PPPPPPPPPPPPPPPPPP 398 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 382 PPPPPPPPPPPPPPPPPP 399 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 383 PPPPPPPPPPPPPPPPPP 400 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 384 PPPPPPPPPPPPPPPPPP 401 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 385 PPPPPPPPPPPPPPPPPP 402 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 386 PPPPPPPPPPPPPPPPPP 403 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 387 PPPPPPPPPPPPPPPPPP 404 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 388 PPPPPPPPPPPPPPPPPP 405 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 389 PPPPPPPPPPPPPPPPPP 406 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 390 PPPPPPPPPPPPPPPPPP 407 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 391 PPPPPPPPPPPPPPPPPP 408 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 392 PPPPPPPPPPPPPPPPPP 409 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 393 PPPPPPPPPPPPPPPPPP 410 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 394 PPPPPPPPPPPPPPPPPP 411 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 395 PPPPPPPPPPPPPPPPPP 412 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 396 PPPPPPPPPPPPPPPPPP 413 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 397 PPPPPPPPPPPPPPPPPP 414 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 398 PPPPPPPPPPPPPPPPPP 415 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 399 PPPPPPPPPPPPPPPPPP 416 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 400 PPPPPPPPPPPPPPPPPP 417 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 401 PPPPPPPPPPPPPPPPPP 418 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 402 PPPPPPPPPPPPPPPPPP 419 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 403 PPPPPPPPPPPPPPPPPP 420 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 404 PPPPPPPPPPPPPPPPPP 421 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 405 PPPPPPPPPPPPPPPPPP 422 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 406 PPPPPPPPPPPPPPPPPP 423 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 407 PPPPPPPPPPPPPPPPPP 424 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 408 PPPPPPPPPPPPPPPPPP 425 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 409 PPPPPPPPPPPPPPPPPP 426 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 410 PPPPPPPPPPPPPPPPPP 427 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 411 PPPPPPPPPPPPPPPPPP 428 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 412 PPPPPPPPPPPPPPPPPP 429 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 413 PPPPPPPPPPPPPPPPPP 430 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 414 PPPPPPPPPPPPPPPPPP 431 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 415 PPPPPPPPPPPPPPPPPP 432 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 416 PPPPPPPPPPPPPPPPPP 433 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 417 PPPPPPPPPPPPPPPPPP 434 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 418 PPPPPPPPPPPPPPPPPP 435 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 419 PPPPPPPPPPPPPPPPPP 436 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 420 PPPPPPPPPPPPPPPPPP 437 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 421 PPPPPPPPPPPPPPPPPP 438 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 422 PPPPPPPPPPPPPPPPPP 439 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 423 PPPPPPPPPPPPPPPPPP 440 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 424 PPPPPPPPPPPPPPPPPP 441 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 425 PPPPPPPPPPPPPPPPPP 442 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 426 PPPPPPPPPPPPPPPPPP 443 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 427 PPPPPPPPPPPPPPPPPP 444 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 428 PPPPPPPPPPPPPPPPPP 445 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 429 PPPPPPPPPPPPPPPPPP 446 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 430 PPPPPPPPPPPPPPPPPP 447 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 431 PPPPPPPPPPPPPPPPPP 448 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 432 PPPPPPPPPPPPPPPPPP 449 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 433 PPPPPPPPPPPPPPPPPP 450 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 434 PPPPPPPPPPPPPPPPPP 451 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 435 PPPPPPPPPPPPPPPPPP 452 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 436 PPPPPPPPPPPPPPPPPP 453 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 437 PPPPPPPPPPPPPPPPPP 454 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 438 PPPPPPPPPPPPPPPPPP 455 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 439 PPPPPPPPPPPPPPPPPP 456 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 440 PPPPPPPPPPPPPPPPPP 457 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 441 PPPPPPPPPPPPPPPPPP 458 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 442 PPPPPPPPPPPPPPPPPP 459 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 443 PPPPPPPPPPPPPPPPPP 460 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 444 PPPPPPPPPPPPPPPPPP 461 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 445 PPPPPPPPPPPPPPPPPP 462 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 446 PPPPPPPPPPPPPPPPPP 463 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 447 PPPPPPPPPPPPPPPPPP 464 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 448 PPPPPPPPPPPPPPPPPP 465 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 449 PPPPPPPPPPPPPPPPPP 466 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 450 PPPPPPPPPPPPPPPPPP 467 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 451 PPPPPPPPPPPPPPPPPP 468 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 452 PPPPPPPPPPPPPPPPPP 469 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 453 PPPPPPPPPPPPPPPPPP 470 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 454 PPPPPPPPPPPPPPPPPP 471 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 455 PPPPPPPPPPPPPPPPPP 472 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 456 PPPPPPPPPPPPPPPPPP 473 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 457 PPPPPPPPPPPPPPPPPP 474 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 458 PPPPPPPPPPPPPPPPPP 475 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 459 PPPPPPPPPPPPPPPPPP 476 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 460 PPPPPPPPPPPPPPPPPP 477 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 461 PPPPPPPPPPPPPPPPPP 478 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 462 PPPPPPPPPPPPPPPPPP 479 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 463 PPPPPPPPPPPPPPPPPP 480 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 464 PPPPPPPPPPPPPPPPPP 481 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 465 PPPPPPPPPPPPPPPPPP 482 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 466 PPPPPPPPPPPPPPPPPP 483 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 467 PPPPPPPPPPPPPPPPPP 484 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 468 PPPPPPPPPPPPPPPPPP 485 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 469 PPPPPPPPPPPPPPPPPP 486 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 470 PPPPPPPPPPPPPPPPPP 487 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 471 PPPPPPPPPPPPPPPPPP 488 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 472 PPPPPPPPPPPPPPPPPP 489 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 473 PPPPPPPPPPPPPPPPPP 490 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 474 PPPPPPPPPPPPPPPPPP 491 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 475 PPPPPPPPPPPPPPPPPP 492 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 476 PPPPPPPPPPPPPPPPPP 493 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 477 PPPPPPPPPPPPPPPPPP 494 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 478 PPPPPPPPPPPPPPPPPP 495 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 479 PPPPPPPPPPPPPPPPPP 496 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 480 PPPPPPPPPPPPPPPPPP 497 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 481 PPPPPPPPPPPPPPPPPP 498 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 482 PPPPPPPPPPPPPPPPPP 499 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 483 PPPPPPPPPPPPPPPPPP 500 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 484 PPPPPPPPPPPPPPPPPP 501 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 485 PPPPPPPPPPPPPPPPPP 502 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 486 PPPPPPPPPPPPPPPPPP 503 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 487 PPPPPPPPPPPPPPPPPP 504 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 488 PPPPPPPPPPPPPPPPPP 505 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 489 PPPPPPPPPPPPPPPPPP 506 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 490 PPPPPPPPPPPPPPPPPP 507 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 491 PPPPPPPPPPPPPPPPPP 508 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 492 PPPPPPPPPPPPPPPPPP 509 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 493 PPPPPPPPPPPPPPPPPP 510 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 494 PPPPPPPPPPPPPPPPPP 511 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 495 PPPPPPPPPPPPPPPPPP 512 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 496 PPPPPPPPPPPPPPPPPP 513 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 497 PPPPPPPPPPPPPPPPPP 514 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 498 PPPPPPPPPPPPPPPPPP 515 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 499 PPPPPPPPPPPPPPPPPP 516 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 500 PPPPPPPPPPPPPPPPPP 517 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 501 PPPPPPPPPPPPPPPPPP 518 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 502 PPPPPPPPPPPPPPPPPP 519 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 503 PPPPPPPPPPPPPPPPPP 520 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 504 PPPPPPPPPPPPPPPPPP 521 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 505 PPPPPPPPPPPPPPPPPP 522 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 506 PPPPPPPPPPPPPPPPPP 523 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 507 PPPPPPPPPPPPPPPPPP 524 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 508 PPPPPPPPPPPPPPPPPP 525 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 509 PPPPPPPPPPPPPPPPPP 526 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 510 PPPPPPPPPPPPPPPPPP 527 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 511 PPPPPPPPPPPPPPPPPP 528 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 512 PPPPPPPPPPPPPPPPPP 529 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 513 PPPPPPPPPPPPPPPPPP 530 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 514 PPPPPPPPPPPPPPPPPP 531 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 515 PPPPPPPPPPPPPPPPPP 532 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 516 PPPPPPPPPPPPPPPPPP 533 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 517 PPPPPPPPPPPPPPPPPP 534 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 518 PPPPPPPPPPPPPPPPPP 535 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 519 PPPPPPPPPPPPPPPPPP 536 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 520 PPPPPPPPPPPPPPPPPP 537 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 521 PPPPPPPPPPPPPPPPPP 538 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 522 PPPPPPPPPPPPPPPPPP 539 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 523 PPPPPPPPPPPPPPPPPP 540 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 524 PPPPPPPPPPPPPPPPPP 541 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 525 PPPPPPPPPPPPPPPPPP 542 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 526 PPPPPPPPPPPPPPPPPP 543 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 527 PPPPPPPPPPPPPPPPPP 544 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 528 PPPPPPPPPPPPPPPPPP 545 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 529 PPPPPPPPPPPPPPPPPP 546 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 530 PPPPPPPPPPPPPPPPPP 547 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 531 PPPPPPPPPPPPPPPPPP 548 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 532 PPPPPPPPPPPPPPPPPP 549 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 533 PPPPPPPPPPPPPPPPPP 550 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 534 PPPPPPPPPPPPPPPPPP 551 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 535 PPPPPPPPPPPPPPPPPP 552 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 536 PPPPPPPPPPPPPPPPPP 553 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 537 PPPPPPPPPPPPPPPPPP 554 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 538 PPPPPPPPPPPPPPPPPP 555 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 539 PPPPPPPPPPPPPPPPPP 556 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 540 PPPPPPPPPPPPPPPPPP 557 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 541 PPPPPPPPPPPPPPPPPP 558 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 542 PPPPPPPPPPPPPPPPPP 559 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 543 PPPPPPPPPPPPPPPPPP 560 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 544 PPPPPPPPPPPPPPPPPP 561 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 545 PPPPPPPPPPPPPPPPPP 562 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 546 PPPPPPPPPPPPPPPPPP 563 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 547 PPPPPPPPPPPPPPPPPP 564 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 548 PPPPPPPPPPPPPPPPPP 565 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 549 PPPPPPPPPPPPPPPPPP 566 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 550 PPPPPPPPPPPPPPPPPP 567 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 551 PPPPPPPPPPPPPPPPPP 568 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 552 PPPPPPPPPPPPPPPPPP 569 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 553 PPPPPPPPPPPPPPPPPP 570 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 554 PPPPPPPPPPPPPPPPPP 571 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 555 PPPPPPPPPPPPPPPPPP 572 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 556 PPPPPPPPPPPPPPPPPP 573 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 557 PPPPPPPPPPPPPPPPPP 574 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 558 PPPPPPPPPPPPPPPPPP 575 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 559 PPPPPPPPPPPPPPPPPP 576 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 560 PPPPPPPPPPPPPPPPPP 577 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 561 PPPPPPPPPPPPPPPPPP 578 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 562 PPPPPPPPPPPPPPPPPP 579 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 563 PPPPPPPPPPPPPPPPPP 580 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 564 PPPPPPPPPPPPPPPPPP 581 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 565 PPPPPPPPPPPPPPPPPP 582 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 566 PPPPPPPPPPPPPPPPPP 583 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 567 PPPPPPPPPPPPPPPPPP 584 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 568 PPPPPPPPPPPPPPPPPP 585 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 569 PPPPPPPPPPPPPPPPPP 586 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 570 PPPPPPPPPPPPPPPPPP 587 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 571 PPPPPPPPPPPPPPPPPP 588 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 572 PPPPPPPPPPPPPPPPPP 589 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 573 PPPPPPPPPPPPPPPPPP 590 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 574 PPPPPPPPPPPPPPPPPP 591 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 575 PPPPPPPPPPPPPPPPPP 592 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 576 PPPPPPPPPPPPPPPPPP 593 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 577 PPPPPPPPPPPPPPPPPP 594 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 578 PPPPPPPPPPPPPPPPPP 595 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 579 PPPPPPPPPPPPPPPPPP 596 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 580 PPPPPPPPPPPPPPPPPP 597 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 581 PPPPPPPPPPPPPPPPPP 598 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 582 PPPPPPPPPPPPPPPPPP 599 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 583 PPPPPPPPPPPPPPPPPP 600 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 584 PPPPPPPPPPPPPPPPPP 601 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 585 PPPPPPPPPPPPPPPPPP 602 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 586 PPPPPPPPPPPPPPPPPP 603 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 587 PPPPPPPPPPPPPPPPPP 604 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 588 PPPPPPPPPPPPPPPPPP 605 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 589 PPPPPPPPPPPPPPPPPP 606 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 590 PPPPPPPPPPPPPPPPPP 607 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 591 PPPPPPPPPPPPPPPPPP 608 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 592 PPPPPPPPPPPPPPPPPP 609 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 593 PPPPPPPPPPPPPPPPPP 610 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 594 PPPPPPPPPPPPPPPPPP 611 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 595 PPPPPPPPPPPPPPPPPP 612 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 596 PPPPPPPPPPPPPPPPPP 613 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 597 PPPPPPPPPPPPPPPPPP 614 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 598 PPPPPPPPPPPPPPPPPP 615 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 599 PPPPPPPPPPPPPPPPPP 616 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 600 PPPPPPPPPPPPPPPPPP 617 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 601 PPPPPPPPPPPPPPPPPP 618 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 602 PPPPPPPPPPPPPPPPPP 619 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 603 PPPPPPPPPPPPPPPPPP 620 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 604 PPPPPPPPPPPPPPPPPP 621 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 605 PPPPPPPPPPPPPPPPPP 622 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 606 PPPPPPPPPPPPPPPPPP 623 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 607 PPPPPPPPPPPPPPPPPP 624 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 608 PPPPPPPPPPPPPPPPPP 625 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 609 PPPPPPPPPPPPPPPPPP 626 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 610 PPPPPPPPPPPPPPPPPP 627 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 611 PPPPPPPPPPPPPPPPPP 628 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 612 PPPPPPPPPPPPPPPPPP 629 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 613 PPPPPPPPPPPPPPPPPP 630 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 614 PPPPPPPPPPPPPPPPPP 631 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 615 PPPPPPPPPPPPPPPPPP 632 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 616 PPPPPPPPPPPPPPPPPP 633 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 617 PPPPPPPPPPPPPPPPPP 634 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 618 PPPPPPPPPPPPPPPPPP 635 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 619 PPPPPPPPPPPPPPPPPP 636 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 620 PPPPPPPPPPPPPPPPPP 637 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 621 PPPPPPPPPPPPPPPPPP 638 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 622 PPPPPPPPPPPPPPPPPP 639 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 623 PPPPPPPPPPPPPPPPPP 640 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 624 PPPPPPPPPPPPPPPPPP 641 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 625 PPPPPPPPPPPPPPPPPP 642 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 626 PPPPPPPPPPPPPPPPPP 643 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 627 PPPPPPPPPPPPPPPPPP 644 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 628 PPPPPPPPPPPPPPPPPP 645 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 629 PPPPPPPPPPPPPPPPPP 646 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 630 PPPPPPPPPPPPPPPPPP 647 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 631 PPPPPPPPPPPPPPPPPP 648 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 632 PPPPPPPPPPPPPPPPPP 649 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 633 PPPPPPPPPPPPPPPPPP 650 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 634 PPPPPPPPPPPPPPPPPP 651 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 635 PPPPPPPPPPPPPPPPPP 652 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 636 PPPPPPPPPPPPPPPPPP 653 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 637 PPPPPPPPPPPPPPPPPP 654 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 638 PPPPPPPPPPPPPPPPPP 655 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 639 PPPPPPPPPPPPPPPPPP 656 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 640 PPPPPPPPPPPPPPPPPP 657 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 641 PPPPPPPPPPPPPPPPPP 658 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 642 PPPPPPPPPPPPPPPPPP 659 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 643 PPPPPPPPPPPPPPPPPP 660 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 644 PPPPPPPPPPPPPPPPPP 661 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 645 PPPPPPPPPPPPPPPPPP 662 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 646 PPPPPPPPPPPPPPPPPP 663 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 647 PPPPPPPPPPPPPPPPPP 664 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 676 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 677 PSPPPPPPPPPPPPPPPP 694 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 689 PPPPPPPPPPPPPPHPPP 706 Score = 78.2 bits (184), Expect = 2e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 690 PPPPPPPPPPPPPHPPPP 707 Score = 77.8 bits (183), Expect = 3e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 693 PPPPPPPPPPHPPPPSPP 710 Score = 77.4 bits (182), Expect = 4e-13 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 230 PPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 290 PPPPPPPPPPPPPPPPPP 307 Score = 77.0 bits (181), Expect = 6e-13 Identities = 33/77 (42%), Positives = 34/77 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Query: 749 PXPXAGPPXPAAPXXXP 799 P P PP P+ P P Sbjct: 698 PPPPPHPPPPSPPPLVP 714 Score = 76.6 bits (180), Expect = 8e-13 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 227 PSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 287 PPPPPPPPPPPPPPPPPP 304 Score = 75.8 bits (178), Expect = 1e-12 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 282 PPPPPPPPPPPPPPPPPP 299 Score = 75.8 bits (178), Expect = 1e-12 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPPPP P PPPP PP P P PPPPP P Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 285 PPPPPPPPPPPPPPPPPP 302 Score = 75.8 bits (178), Expect = 1e-12 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPPPPP P PPPP PP P P PPPPP P Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 286 PPPPPPPPPPPPPPPPPP 303 Score = 75.4 bits (177), Expect = 2e-12 Identities = 33/77 (42%), Positives = 33/77 (42%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP P PPPP PP P P PPPPP PP Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 284 PPPPPPPPPPPPPPPPP 300 Score = 75.4 bits (177), Expect = 2e-12 Identities = 33/77 (42%), Positives = 33/77 (42%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP P PPPP PP P P PPPPP PP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 296 PPPPPPPPPPPPPPPPP 312 Score = 74.9 bits (176), Expect = 2e-12 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 284 PPPPPPPPPPPPPPPPPP 301 Score = 74.9 bits (176), Expect = 2e-12 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 294 PPPPPPPPPPPPPPPPPP 311 Score = 74.1 bits (174), Expect = 4e-12 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 291 PPPPPPPPPPPPPPPPPP 308 Score = 74.1 bits (174), Expect = 4e-12 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPPPP P PPPP PP P P PPPPP P Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 292 PPPPPPPPPPPPPPPPPP 309 Score = 74.1 bits (174), Expect = 4e-12 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPPPPP P PPPP PP P P PPPPP P Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 293 PPPPPPPPPPPPPPPPPP 310 Score = 71.3 bits (167), Expect = 3e-11 Identities = 32/78 (41%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P PPPPP P Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 694 PPPPPPPPPHPPPPSPPP 711 Score = 70.1 bits (164), Expect = 7e-11 Identities = 28/58 (48%), Positives = 28/58 (48%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP P PPPP PP P P PPPPP PP P PP P P PP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 67.7 bits (158), Expect = 4e-10 Identities = 41/136 (30%), Positives = 41/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P P Sbjct: 349 PPPPPPPPPPPPPPPP 364 Score = 66.9 bits (156), Expect = 6e-10 Identities = 41/136 (30%), Positives = 41/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 209 PPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P P Sbjct: 329 PPPPPPPPPPPPPPPP 344 Score = 66.9 bits (156), Expect = 6e-10 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPP PP P PPPP PP P P PPPPP P Sbjct: 214 PPPPPPL--------PPSPPPPSPPPPPPSPPPPLPPPP----PPPPPPPPPPPPPPPPP 261 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 262 PPPPPPPPPPPPPPPPPP 279 Score = 66.9 bits (156), Expect = 6e-10 Identities = 41/136 (30%), Positives = 41/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P P Sbjct: 424 PPPPPPPPPPPPPPPP 439 Score = 66.9 bits (156), Expect = 6e-10 Identities = 41/136 (30%), Positives = 41/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P P Sbjct: 499 PPPPPPPPPPPPPPPP 514 Score = 66.9 bits (156), Expect = 6e-10 Identities = 41/136 (30%), Positives = 41/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P P Sbjct: 574 PPPPPPPPPPPPPPPP 589 Score = 66.9 bits (156), Expect = 6e-10 Identities = 41/136 (30%), Positives = 41/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P P Sbjct: 649 PPPPPPPPPPPPPPPP 664 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Query: 420 PP 415 PP Sbjct: 664 PP 665 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Query: 420 PP 415 PP Sbjct: 665 PP 666 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Query: 420 PP 415 PP Sbjct: 666 PP 667 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Query: 420 PP 415 PP Sbjct: 667 PP 668 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Query: 420 PP 415 PP Sbjct: 668 PP 669 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Query: 420 PP 415 PP Sbjct: 669 PP 670 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Query: 420 PP 415 PP Sbjct: 670 PP 671 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Query: 420 PP 415 PP Sbjct: 671 PP 672 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Query: 420 PP 415 PP Sbjct: 672 PP 673 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Query: 420 PP 415 PP Sbjct: 673 PP 674 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPP 683 Query: 420 PP 415 PP Sbjct: 684 PP 685 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPP 684 Query: 420 PP 415 PP Sbjct: 685 PP 686 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Query: 420 PP 415 PP Sbjct: 687 PP 688 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Query: 420 PP 415 PP Sbjct: 697 PP 698 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Query: 420 PP 415 PP Sbjct: 698 PP 699 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Query: 420 PP 415 PP Sbjct: 700 PP 701 Score = 58.0 bits (134), Expect = 3e-07 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPPP PP P P P PPP PP P PP P P PP Sbjct: 209 PPPPS--PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 58.0 bits (134), Expect = 3e-07 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPP P Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSP 709 Query: 420 PP 415 PP Sbjct: 710 PP 711 Score = 51.2 bits (117), Expect = 3e-05 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP +PPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Query: 421 PPP 413 PPP Sbjct: 683 PPP 685 Score = 50.4 bits (115), Expect = 6e-05 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPP 685 Query: 421 PPP 413 PPP Sbjct: 686 PPP 688 Score = 50.4 bits (115), Expect = 6e-05 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Query: 421 PPP 413 PPP Sbjct: 696 PPP 698 Score = 50.4 bits (115), Expect = 6e-05 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Query: 421 PPP 413 PPP Sbjct: 699 PPP 701 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 47.6 bits (108), Expect = 4e-04 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPS 708 Query: 421 PPP 413 PPP Sbjct: 709 PPP 711 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPPPP P PPP PP PP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P P PPPP P PPP PP PP P Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPPPP P PPP PP Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPP 705 Score = 44.4 bits (100), Expect = 0.004 Identities = 31/114 (27%), Positives = 31/114 (27%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPX 355 P G P P PP PP P P PP PPPP PP Sbjct: 200 PVSTVIGYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPP 259 Query: 354 FFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPPP PP P P P P P Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PP PPP P PPP PP PP P Sbjct: 210 PPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PPPPPP P PPP PP PP P Sbjct: 218 PPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 221 PPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPPPP P PPP PP PP P Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 224 PPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPPP + PPPPP P P PPPP P P P PP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALPP 718 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G P PPP P P PPPP PPPPPPP Sbjct: 206 GYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPP 254 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PPP PP P P P P Sbjct: 658 PPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPALP 717 Query: 420 P 418 P Sbjct: 718 P 718 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PPP PP PP P Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP P P PPPP P P P P Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPPLVPAL 716 Query: 420 PP 415 PP Sbjct: 717 PP 718 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 600 GXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 G P PPPPP P PP PP PP P Sbjct: 206 GYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPP 247 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 76.6 bits (180), Expect = 8e-13 Identities = 38/78 (48%), Positives = 38/78 (48%), Gaps = 5/78 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP----XXXPGPPPPXPPXXGG-XXXPXAPXXXAXPP 733 PPPPP GG PPPPPP P PPPP PP G P P A PP Sbjct: 598 PPPPPALGG----VPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPP 653 Query: 734 PPPXPPXPXAGPPXPAAP 787 PPP PP P AGPP P P Sbjct: 654 PPPPPPLPGAGPPPPPPP 671 Score = 73.7 bits (173), Expect = 5e-12 Identities = 32/70 (45%), Positives = 32/70 (45%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPP P PPPP P G P P A PPPPP P Sbjct: 612 PPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPP 671 Query: 749 PXPXAGPPXP 778 P AGPP P Sbjct: 672 PLSGAGPPPP 681 Score = 65.3 bits (152), Expect = 2e-09 Identities = 36/85 (42%), Positives = 36/85 (42%), Gaps = 12/85 (14%) Frame = +2 Query: 569 PPPPPXXGGGGXX----CXXXXXPPPPPPXXX----PGPPPPXPPXXGG----XXXPXAP 712 PPPPP GG PPPPP P PPPP PP G P P Sbjct: 574 PPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPPPALGAMGAPPPPPPPP 633 Query: 713 XXXAXPPPPPXPPXPXAGPPXPAAP 787 A PPPP PP P AGPP P P Sbjct: 634 PSAAGLPPPPPPPLPGAGPPPPPPP 658 Score = 63.7 bits (148), Expect = 6e-09 Identities = 30/72 (41%), Positives = 30/72 (41%) Frame = -2 Query: 630 GGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP 451 GG PPPP G G PPPPP G P P PPPPPP P Sbjct: 605 GGVPPPPPPPPPPPALGAMGAPPPP-----PPPPPSAAGLPPPPPPPLPGAGPPPPPPPP 659 Query: 450 XXPXXPPPPPPP 415 PPPPPPP Sbjct: 660 LPGAGPPPPPPP 671 Score = 54.4 bits (125), Expect = 4e-06 Identities = 31/91 (34%), Positives = 31/91 (34%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP GG P G PPPP G PPPP G Sbjct: 601 PPALGGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAG--------LPPPPPPPLPGAGP 652 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P P PPPPPP P PPPPPP Sbjct: 653 PPPPPPPLPGAGPPPPPPPPLSGAGPPPPPP 683 Score = 52.0 bits (119), Expect = 2e-05 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP G P PPPPP PPPP Sbjct: 610 PPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPP 669 Query: 421 PPP 413 PPP Sbjct: 670 PPP 672 Score = 51.6 bits (118), Expect = 2e-05 Identities = 27/66 (40%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP----PPPPPXPXXPXXP 433 PPPP GG PPPPP G P P PPPPP P P Sbjct: 599 PPPPALGG------VPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGP 652 Query: 432 PPPPPP 415 PPPPPP Sbjct: 653 PPPPPP 658 Score = 51.2 bits (117), Expect = 3e-05 Identities = 36/116 (31%), Positives = 36/116 (31%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP G P P PPP P PPPPPPP G G P Sbjct: 574 PPPPPCIPGGNLS-PAPASDVCDSAPPPPPALGGVPPPPPPP----PPPPALGAMGAPPP 628 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PG PPP PP P P GP P Sbjct: 629 PP---PPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPP 681 Score = 48.0 bits (109), Expect = 3e-04 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +2 Query: 626 PPPPPPXXXPGP--PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP PG P P P PPPPP PP P A A P P Sbjct: 572 PPPPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPPPALGAMGAPPPPPP 631 Query: 800 PXXGXGG 820 P G Sbjct: 632 PPPSAAG 638 Score = 48.0 bits (109), Expect = 3e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX----PPPPPXXXXXXXT 434 PPPP GG PPPPP G P P PPPPP Sbjct: 598 PPPPPALGGV-----PPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGP 652 Query: 433 PPPPPPP 413 PPPPPPP Sbjct: 653 PPPPPPP 659 Score = 47.2 bits (107), Expect = 5e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 P P PPPP PP G AP PP PP G P P P PP G Sbjct: 565 PTSSPPPPPPPPPPCIPGGNLSPAPASDVCDSAPP-PPPALGGVPPPPPPPPPPPALGAM 623 Query: 818 GA 823 GA Sbjct: 624 GA 625 Score = 47.2 bits (107), Expect = 5e-04 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP G P P PPPP Sbjct: 625 APPPPPPPPPSAAGLP-------PPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAG 677 Query: 430 PPPPPP 413 PPPPPP Sbjct: 678 PPPPPP 683 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/63 (39%), Positives = 25/63 (39%) Frame = +3 Query: 537 GGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 GG P PPPP G G P PPPPPP PPP PP G PP Sbjct: 605 GGVPPPPPP--PPPPPALGAMG----APPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPP 658 Query: 717 GXP 725 P Sbjct: 659 PLP 661 Score = 44.4 bits (100), Expect = 0.004 Identities = 25/65 (38%), Positives = 27/65 (41%), Gaps = 6/65 (9%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX------PPXPXAGPPXPAAP 787 PPPPPP PPPP P P + + PPPPP PP P PP A Sbjct: 569 PPPPPP-----PPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPPPALGAM 623 Query: 788 XXXPP 802 PP Sbjct: 624 GAPPP 628 Score = 41.5 bits (93), Expect = 0.026 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P G PPPP G G PPPP G Sbjct: 617 PPALGAMGAPPPPPPPPPSAAGLPPP----PPPPLPGAG-------PPPPPPPPLPGAGP 665 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPP 430 P P PPPPPP P P Sbjct: 666 PPPPPPPLSGAGPPPPPPMPGLKTKKP 692 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 5/58 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP-----XXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP G P PPPPPP PPP PP G PP Sbjct: 626 PPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPPPPLPGAGPPPPPPPPLSGAGPPPPPP 683 Score = 41.1 bits (92), Expect = 0.035 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXG 688 PPPPP G G PPPPPP PPP PP G Sbjct: 655 PPPPPLPGAG--------PPPPPPPPLSGAGPPPPPPMPG 686 Score = 40.7 bits (91), Expect = 0.046 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 9/69 (13%) Frame = -2 Query: 600 PPPPXXGGGG---GXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX----- 445 PPPP GG PPPPP G P P PPPPPP P Sbjct: 575 PPPPCIPGGNLSPAPASDVCDSAPPPPPALGGV----PPP-----PPPPPPPPALGAMGA 625 Query: 444 -PXXPPPPP 421 P PPPPP Sbjct: 626 PPPPPPPPP 634 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP---XXPPPPPP----XXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP GG A PPPPP P PPP PP G PP Sbjct: 571 PPPPPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPPPPALGAMGAPPPPP 630 Query: 717 GXP 725 P Sbjct: 631 PPP 633 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP G P PPPPP PPPPPPP Sbjct: 575 PPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVP--PPPPPPP 615 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 76.6 bits (180), Expect = 8e-13 Identities = 33/78 (42%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPS 270 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 271 PSPPPPPPPPSPPPAPPP 288 Score = 70.5 bits (165), Expect = 5e-11 Identities = 29/59 (49%), Positives = 31/59 (52%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP P P + PPPPP PP P + PP P P PP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPS-PPPPPPPPPPPSPPPPPPPPSPSPP 265 Score = 69.7 bits (163), Expect = 9e-11 Identities = 28/59 (47%), Positives = 29/59 (49%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP P P PPPPP PP PP P +P PP Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 69.7 bits (163), Expect = 9e-11 Identities = 28/59 (47%), Positives = 29/59 (49%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP P P PPPPP PP P PP P+ PP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 Score = 60.1 bits (139), Expect = 7e-08 Identities = 31/73 (42%), Positives = 32/73 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPPPP P PPPP PP P +P PPPPP P Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSP-PPPPPPPSPSPPPPPPSP----SPPPPPPP 279 Query: 749 PXPXAGPPXPAAP 787 P P PP P P Sbjct: 280 PSPPPAPP-PFVP 291 Score = 58.0 bits (134), Expect = 3e-07 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPP Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPS 281 Query: 420 PP 415 PP Sbjct: 282 PP 283 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 248 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 209 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 55.2 bits (127), Expect = 2e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P PPPPPPP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 54.4 bits (125), Expect = 4e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P P PPPPPPP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 54.4 bits (125), Expect = 4e-06 Identities = 26/59 (44%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP PPPP PP P PP P+ P PP Sbjct: 206 PPPPPPPPPPSPPPPPPP-----------------PPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 54.4 bits (125), Expect = 4e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P P PPPPPPP Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 54.4 bits (125), Expect = 4e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPP P Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 52.8 bits (121), Expect = 1e-05 Identities = 23/61 (37%), Positives = 24/61 (39%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPPPP P P PPPP P P P PP PP Sbjct: 224 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPP 283 Query: 420 P 418 P Sbjct: 284 P 284 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P PPPPPP Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P PPPPPP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 50.0 bits (114), Expect = 8e-05 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP-XPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPP P Sbjct: 211 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PPP PP P P PP PPPP Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PPP PP P P PP PPPP Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 48.0 bits (109), Expect = 3e-04 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPPP Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPP 280 Query: 421 PPP 413 PP Sbjct: 281 SPP 283 Score = 48.0 bits (109), Expect = 3e-04 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP---PXPXXPXXPP 430 PPPP PPPPP P P PPPPP P P P P Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSP 282 Query: 429 PPPPP 415 PP PP Sbjct: 283 PPAPP 287 Score = 47.6 bits (108), Expect = 4e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP P P PPPPPP P P PPP Sbjct: 231 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFV 290 Query: 420 P 418 P Sbjct: 291 P 291 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPP P Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 44.4 bits (100), Expect = 0.004 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PP PP P P PPPPP P P PP PP Sbjct: 230 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPP--PSPPPAPP 287 Query: 420 P 418 P Sbjct: 288 P 288 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PP PPP P PPP PP PP P Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PP P PPP PP PP P Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P P PPPP P PPP PP Sbjct: 239 PSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPP 279 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPPP PPPP PP Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 254 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP-PPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PP PPPP P P P PP PP P Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPP 283 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPP P P P PP PP P Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PPPPPP P PPP P PP P Sbjct: 223 PPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPP 278 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 P PPPP P P PPPP P PPP PP G Sbjct: 250 PPSPPPPPPPPSPS--PPPPPPSPSPPPPPPPPSPPPAPPPFVPG 292 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + P PPP P P PPP PP Sbjct: 244 PPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 Score = 37.1 bits (82), Expect = 0.57 Identities = 27/97 (27%), Positives = 27/97 (27%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXX 313 P P PPP P P P PPPPP PP Sbjct: 196 PQNIVVEPQPPPPPPPPPPPSPPPPPPPPPPP------SPPPPPPPPPPPSPPPPPPPPP 249 Query: 312 XXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 P P PPPP PP P P P P Sbjct: 250 PPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAP 286 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPP +PPP Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSP-----SPPPP---PPPPSPPPA 285 Query: 421 PPP 413 PPP Sbjct: 286 PPP 288 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 76.6 bits (180), Expect = 8e-13 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPPPP P PPPP PP P P PPPPP P Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 468 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 469 PPPSPPPPSPPPPSPPPP 486 Score = 75.4 bits (177), Expect = 2e-12 Identities = 34/79 (43%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP PPPPPP P PPP P PP P P PPPPP Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 314 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P PP P P PP Sbjct: 315 PPPPSPPPPSPPPPSPPPP 333 Score = 72.5 bits (170), Expect = 1e-11 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPP P P PPPP PP P P PPPPP P Sbjct: 340 PPPPPSPPPPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 399 PPPSPPPPSPPPPSPPPP 416 Score = 72.5 bits (170), Expect = 1e-11 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPP P P PPPP PP P P PPPPP P Sbjct: 454 PPPPPSPPPPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 513 PPPSPPPPSPPPPSPPPP 530 Score = 71.3 bits (167), Expect = 3e-11 Identities = 34/84 (40%), Positives = 34/84 (40%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP------GPPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP PPPPPP P PPPP PP P P P Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 348 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PP P PP P P PP Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPP 372 Score = 71.3 bits (167), Expect = 3e-11 Identities = 31/77 (40%), Positives = 32/77 (41%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP P PPPP PP P P PP PP P Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 477 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P+ P PP Sbjct: 478 PPPPSPPPPSPPPPPPP 494 Score = 70.9 bits (166), Expect = 4e-11 Identities = 33/78 (42%), Positives = 36/78 (46%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPXP 748 PPPP PPPPPP P PPPP PP P +P + PPP PP P Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS--PPPPSPPPPSPPPPSPPPP 377 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P +P PP Sbjct: 378 PPPSPPPPPPPSPPPPPP 395 Score = 70.5 bits (165), Expect = 5e-11 Identities = 33/79 (41%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPX 745 PP PP PPPPPP P PPPP PP P +P + PPP PP Sbjct: 433 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS--PPPPSPPPPSPPPPSPPP 490 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P PP P +P PP Sbjct: 491 PPPPSPPPPPPPSPPPPPP 509 Score = 70.1 bits (164), Expect = 7e-11 Identities = 32/78 (41%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXP 748 PPPP PPPPPP P PPPP PP P P PPPP P Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 423 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P +P PP Sbjct: 424 PPPSPPPPPPPSPPPPPP 441 Score = 68.5 bits (160), Expect = 2e-10 Identities = 31/77 (40%), Positives = 32/77 (41%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PP PPP P PPPP PP P P PPPP PP Sbjct: 268 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP-SPPPPPPPSPPPPSPPPPSPP 326 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P +P PP Sbjct: 327 PPSPPPPPPPSPPPPPP 343 Score = 68.5 bits (160), Expect = 2e-10 Identities = 32/78 (41%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPXP 748 PPPP PPPPP P PPPP PP P +P + PPP PP P Sbjct: 374 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPP 431 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P +P PP Sbjct: 432 PPPSPPPPPPPSPPPPPP 449 Score = 68.1 bits (159), Expect = 3e-10 Identities = 32/77 (41%), Positives = 33/77 (42%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP P PPPP PP P P PPPP PP Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPP---PSPPPPSPPPPS--PPPPPPPSPPPPPPPSPPP 291 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P+ P PP Sbjct: 292 PPPPSPPPPSPPPPSPP 308 Score = 68.1 bits (159), Expect = 3e-10 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP PPPP PP P PP P PP P P PPPPP Sbjct: 384 PPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPS 443 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P P P P PP Sbjct: 444 PPPPPPPSPPPPPPPSPPP 462 Score = 68.1 bits (159), Expect = 3e-10 Identities = 33/81 (40%), Positives = 35/81 (43%), Gaps = 4/81 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXX---PXAPXXXAXPPP-P 739 PPPP PPPPPP P PPPP PP P +P + PPP P Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 537 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP P PP P P PP Sbjct: 538 PPPPPPSPPPPSPPPPSPPPP 558 Score = 67.7 bits (158), Expect = 4e-10 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPPPP P PPPP PP P PPPP P Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPP---PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 274 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 275 PPPPPSPPPPPPPSPPPP 292 Score = 67.7 bits (158), Expect = 4e-10 Identities = 31/78 (39%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPPPP P PPPP PP P P PP PP P Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPP---PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPP 525 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P+ P PP Sbjct: 526 SPPPPSPPPPSPPPPPPP 543 Score = 67.7 bits (158), Expect = 4e-10 Identities = 30/78 (38%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPPPPP P PPP PP P +P + PPP P P Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 529 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P P PP Sbjct: 530 PSPPPPSPPPPPPPSPPP 547 Score = 67.3 bits (157), Expect = 5e-10 Identities = 31/78 (39%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPP PP P PPPP PP P PP PP P Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 447 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P +P PP Sbjct: 448 PPPSPPPPPPPSPPPPPP 465 Score = 66.9 bits (156), Expect = 6e-10 Identities = 31/78 (39%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXX-PXAPXXXAXPPPPPXP 748 PPPP PPPPPP P PPPP PP P P + PPP P P Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPP 322 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P P PP Sbjct: 323 PSPPPPSPPPPPPPSPPP 340 Score = 66.5 bits (155), Expect = 8e-10 Identities = 32/78 (41%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PPP P PPPP PP P P PPPP P Sbjct: 438 PPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS----PPPPSPPPPSPPPPPP 493 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 494 PSPPP-PPPPSPPPPPPP 510 Score = 66.1 bits (154), Expect = 1e-09 Identities = 30/78 (38%), Positives = 31/78 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPP P P PPPP PP P PPPP P Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 256 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 257 PPPPPSPPPPSPPPPSPP 274 Score = 65.3 bits (152), Expect = 2e-09 Identities = 32/80 (40%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PPPP PP P +P P PPP P Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP----PPPSPPPPPPPSPPPPP 293 Query: 749 P--XPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 294 PPSPPPPSPPPPSPPPPPPP 313 Score = 65.3 bits (152), Expect = 2e-09 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PP PPP P PPPP PP P PPPP P Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 533 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P+ P PP Sbjct: 534 PPSPPPPPPPSPPPPSPP 551 Score = 64.1 bits (149), Expect = 4e-09 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPX 745 PPPP PPP PP P PP P PP P P PPP PP Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP 356 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 357 PSPPPPSPPPPSPPPPSPP 375 Score = 63.7 bits (148), Expect = 6e-09 Identities = 32/79 (40%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-X 745 PPPPP PP PPP P PPPP PP P +P P PPP Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP----PPPSPPPPPPPSPPPPS 402 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P PP P P PP Sbjct: 403 PPPPSPPPPSPPPPSPPPP 421 Score = 62.5 bits (145), Expect = 1e-08 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-X 745 PP PP P PPPP P PPP PP P +P P PPP Sbjct: 299 PPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPS 358 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P PP P P PP Sbjct: 359 PPPPSPPPPSPPPPSPPPP 377 Score = 61.7 bits (143), Expect = 2e-08 Identities = 39/137 (28%), Positives = 40/137 (29%), Gaps = 1/137 (0%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPP P P P PPPP Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 314 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPP-PPXXXX 244 PP PP P P PP PP Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 374 Query: 243 PPRXPXTPXXPGGPGXP 193 PP P +P P P P Sbjct: 375 PPPPPPSPPPPPPPSPP 391 Score = 60.1 bits (139), Expect = 7e-08 Identities = 38/138 (27%), Positives = 38/138 (27%), Gaps = 2/138 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP--PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP PPPP P P P PPPPPP P P P P Sbjct: 393 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 452 Query: 426 PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 PPPP PP P PPPP Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Query: 246 XPPRXPXTPXXPGGPGXP 193 PP P P P P Sbjct: 513 PPPSPPPPSPPPPSPPPP 530 Score = 59.3 bits (137), Expect = 1e-07 Identities = 26/58 (44%), Positives = 29/58 (50%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPPP PP P +P + PPP P PP P PP P+ P PP Sbjct: 197 PPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPP-PPPPSPPPPSPP 251 Score = 59.3 bits (137), Expect = 1e-07 Identities = 39/136 (28%), Positives = 40/136 (29%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPP P Sbjct: 217 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP---PPPPPPSPPPPSPPPPSP 273 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P PPPP P Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 333 Query: 240 PRXPXTPXXPGGPGXP 193 P P +P P P P Sbjct: 334 P--PPSPPPPPPPSPP 347 Score = 59.3 bits (137), Expect = 1e-07 Identities = 38/136 (27%), Positives = 39/136 (28%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PPP P P P PPPP P P P PPPPP Sbjct: 335 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 395 PPSPPPPSPPPPSPPPPSPPPP-SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 453 Query: 240 PRXPXTPXXPGGPGXP 193 P P +P P P P Sbjct: 454 PPPPPSPPPPPPPSPP 469 Score = 58.8 bits (136), Expect = 2e-07 Identities = 25/58 (43%), Positives = 27/58 (46%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPPP PP P +P + PPP P PP P P P P PP Sbjct: 192 PPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 247 Score = 57.6 bits (133), Expect = 4e-07 Identities = 38/137 (27%), Positives = 38/137 (27%), Gaps = 2/137 (1%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP--PP 424 PPP PPPP P P PPPPPP P P PP PP Sbjct: 197 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 256 Query: 423 PPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXX 244 PPP PP P P PPPP Sbjct: 257 PPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPP 316 Query: 243 PPRXPXTPXXPGGPGXP 193 PP P P P P Sbjct: 317 PPSPPPPSPPPPSPPPP 333 Score = 56.8 bits (131), Expect = 7e-07 Identities = 39/133 (29%), Positives = 40/133 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPP P P P PPPPP Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPPP---SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 294 PPSPPPPSPPPP--SPPPPPPP----SPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 347 Query: 240 PRXPXTPXXPGGP 202 P P +P P P Sbjct: 348 PPPPPSPPPPSPP 360 Score = 56.0 bits (129), Expect = 1e-06 Identities = 38/136 (27%), Positives = 39/136 (28%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P PPPP Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPS 477 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PP P P Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPP-----PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 532 Query: 240 PRXPXTPXXPGGPGXP 193 P P +P P P P Sbjct: 533 P--PPSPPPPPPPSPP 546 Score = 54.8 bits (126), Expect = 3e-06 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPP P PPPP PP P P PPPP PP P PP P P PP Sbjct: 190 PSPPP---PSPPPPSPPPPS----PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240 Score = 54.8 bits (126), Expect = 3e-06 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PPPPPP P P PPP P Sbjct: 496 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 555 Query: 420 PP 415 PP Sbjct: 556 PP 557 Score = 53.6 bits (123), Expect = 6e-06 Identities = 36/136 (26%), Positives = 36/136 (26%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PP PP P P P PPPP P P PPP P Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSP 488 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PP P P Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPP------SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 542 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P Sbjct: 543 PSPPPPSPPPPSPPPP 558 Score = 52.4 bits (120), Expect = 1e-05 Identities = 34/130 (26%), Positives = 34/130 (26%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPP P P P PP PPP P PPPP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 487 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP P P PPPP P Sbjct: 488 PPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPP 547 Query: 240 PRXPXTPXXP 211 P P P Sbjct: 548 PSPPPPSPPP 557 Score = 52.0 bits (119), Expect = 2e-05 Identities = 35/120 (29%), Positives = 36/120 (30%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 T P PPP P P P PPPP P P PPP PPP Sbjct: 186 TPGIPSPPPP--SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP P P PPPP PP P +P P P P Sbjct: 244 SPPPP-----SPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 298 Score = 48.0 bits (109), Expect = 3e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 414 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 469 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPPPP P PPP PP PP Sbjct: 251 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 303 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPPPP P PPP PP PP Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 311 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 315 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 370 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 359 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 414 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPPPP P PPP PP PP P Sbjct: 429 PPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 484 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PP PPP P PPP PP PP P Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 489 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 473 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 528 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PP PP +PPPPPPP Sbjct: 452 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 494 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 258 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 313 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPPP P PPP PP PP P Sbjct: 344 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 399 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPPPPP P PPP PP PP P Sbjct: 405 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 460 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPPPP P PPP PP PP P Sbjct: 406 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 461 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPPP P PPP PP PP P Sbjct: 458 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 513 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 413 PPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 468 Score = 43.6 bits (98), Expect = 0.007 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PPP P PPP PP PP P Sbjct: 223 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 279 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 233 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 289 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PPP P PPP PP PP P Sbjct: 241 PPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 298 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPP PPP P PPP PP PP P Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPP 336 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PPP P PPP PP PP P Sbjct: 342 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 398 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PPP P PPP PP PP P Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PPP P PPP PP PP P Sbjct: 456 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 512 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PP PP +PPPPPPP Sbjct: 202 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P P P P PP PP P Sbjct: 253 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 308 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PP PPP P P P PP PP P Sbjct: 271 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 326 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPP + P PPPPPP P PPP PP Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 347 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PP P P PPPPPP P PPP PP PP Sbjct: 308 PPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 360 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PP PPP P PPP PP PP P Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 375 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PP P P PPPPPP P PPP PP PP Sbjct: 352 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 404 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PP PPP P PPP PP PP P Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 419 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P P P P PP PP P Sbjct: 424 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 479 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PP P P PPPPPP P PPP PP PP Sbjct: 466 PSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPP 518 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PP PPP P PPP PP PP P Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 533 Score = 41.9 bits (94), Expect = 0.020 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PPP P PPP PP PP P Sbjct: 298 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 355 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PP P PP PP PP P Sbjct: 218 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 273 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP PP PP P Sbjct: 235 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 290 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP P PPP PP PP P Sbjct: 336 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 391 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P P PPPP P PPP PP PP P Sbjct: 398 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 453 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP P PPP PP PP P Sbjct: 450 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 505 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PP P PP PP PP P Sbjct: 500 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 555 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPP PPP P PPP PP PP P Sbjct: 275 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 331 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPP P PP PP PP P Sbjct: 213 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 268 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPP P P PPPPP PP PPPP Sbjct: 216 SPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP PP PP P Sbjct: 287 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P P PPP PP PP P Sbjct: 326 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPPPP 380 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 370 PPPSPPPPPPPSP--PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 424 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP P P PPP PP PP P Sbjct: 380 PSPPPPPPPSPPPPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPPPP 434 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PP P PP PP PP P Sbjct: 386 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP PP PP P Sbjct: 394 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PP PPP P PPP PP PP P Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSP 473 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P P PPP PP PP P Sbjct: 440 PPPSPPPPPPPSPPPPPPPSPPPPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPPPP 494 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PP PPP P PPP PP PP P Sbjct: 486 PSPPPPPPPSPPPPPPPSPPPPPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPP 538 Score = 40.3 bits (90), Expect = 0.061 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPX 754 PPP G P PG P P PP P P PPPP PP Sbjct: 161 PPPGLPKGVCSAALFDSQNDCCPISTPGIPSPPPPS------PPPPS-----PPPPSPPP 209 Query: 755 PXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 210 PSPPPPSPPPPSPPPP 225 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPP PPP P PPP PP PP P Sbjct: 204 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 261 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP PP P PP PP PP P Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 325 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP P PPPP P PPP PP PP P Sbjct: 192 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PP PPP P P P PP PP P Sbjct: 219 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPP 274 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPPP P PPP PP PP P Sbjct: 305 PSPPPPPPPSPPPPSPPPPSPPPPSPPPP-PPPSPPPPPPPSPPPPPPPSPPPPSP 359 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPP PPP P PPP PP PP P Sbjct: 395 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 452 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPP P PPP PP PP P Sbjct: 404 PPPSPPPPSPPPPSPPPPSPPPPSPPPPPP--PSPPPPPPPSPPPPPPPSPPPPPP 457 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP PP P PP PP PP P Sbjct: 494 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 550 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPP P P PP PP +PPPP PP Sbjct: 191 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 233 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPP P P PP PP +PPPP PP Sbjct: 196 SPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 238 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPPPPP P P P P PP P Sbjct: 214 PPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 269 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPP P P P P PP PP P Sbjct: 310 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 365 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPP P P P P PP PP P Sbjct: 354 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 409 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPPP P PPP PP PP P Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 445 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPP P P P P PP PP P Sbjct: 468 PPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 523 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPP PPP P PPP PP PP P Sbjct: 240 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 297 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPP PPP P PPP PP PP P Sbjct: 297 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSP 354 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP + P PPP PPP P PPP PP PP Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPP P PPP PP Sbjct: 193 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 233 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPP P PPP PP Sbjct: 198 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 238 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PP PP PP P Sbjct: 200 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPPPP P P P P PP P Sbjct: 266 PSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 321 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPP P PPP PP PP P Sbjct: 292 PPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 347 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPPP P PPP PP PP P Sbjct: 385 PPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PP PP PP P Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 245 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPP-PPXXXXXXXTPPPPPPP 413 P PPP P P PPP PP +PPPP PP Sbjct: 190 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 233 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PP PP PP P Sbjct: 195 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PP PP PP P Sbjct: 208 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSP 263 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP PPP PP PP P Sbjct: 230 PSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPP 285 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP PP PP P Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 293 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP PP PP P Sbjct: 295 PSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 350 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPP P PPP PP PP P Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPP PP P PP PP PP P Sbjct: 332 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 387 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP PP PP P Sbjct: 339 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 394 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P P PPPP P PP PP PP P Sbjct: 393 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 448 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPP P PPP PP PP P Sbjct: 445 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPP PP P PP PP PP P Sbjct: 446 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 501 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP PP PP P Sbjct: 453 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPP 508 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPP P P PPP PP PP P Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPP PP P PP PP PP P Sbjct: 490 PPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSP 545 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PPP PP PP P Sbjct: 248 PSPPPPSPPPPPPPSPPPPSPPPPSPPPP-PPPSPPPPPPPSPPPPPPPSPPPPSP 302 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P P PPPP P PPP PP PP P Sbjct: 349 PPPPSPPPPSPPPPSPPPPSPPPPSPPPP-PPPSPPPPPPPSPPPPPPPSPPPPSP 403 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P P PPPP P PPP PP PP P Sbjct: 463 PPPPSPPPPSPPPPSPPPPSPPPPSPPPP-PPPSPPPPPPPSPPPPPPPSPPPPSP 517 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP--PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P P PPPP P PPP PP PP P Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 346 >UniRef50_Q9L252 Cluster: Putative uncharacterized protein SCO2669; n=1; Streptomyces coelicolor|Rep: Putative uncharacterized protein SCO2669 - Streptomyces coelicolor Length = 604 Score = 75.8 bits (178), Expect = 1e-12 Identities = 49/154 (31%), Positives = 50/154 (32%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 +P P G GA G GGP G GG G GG GA G P GG GG G Sbjct: 230 SPDGPGGSGGPNGAGGFGGPG-GPGGPNGPGGPGGPNGAGGFGGPGGPGGSGGSGGFGGP 288 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 GG GG P GG G P G P PP P Sbjct: 289 GGPGGPSGPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNGPGGPGGPSGPNGPSGPPAP 348 Query: 462 PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 P P P PPPP G GG P Sbjct: 349 PGFGSDPSRPVPPPPGPVPPPPGGAGGPGGPGGP 382 Score = 67.7 bits (158), Expect = 4e-10 Identities = 63/220 (28%), Positives = 64/220 (29%), Gaps = 10/220 (4%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G GP G G GG GG G PG + GG Sbjct: 172 GPGGPAGGPGGPFGPGGSDRPGGSGGPGAPGGPGGPGGPGGFGSPDGPN-RPGGFGGPGS 230 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 P P G GG GG G G GG GG G G F P GG GG Sbjct: 231 PDGPGGSGGPNGAGGFGGPGGPGGPNGPGGPGG----PNGAGGFGG-PGGPGGSGGSGGF 285 Query: 554 XXXXXP--PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP--------PPXPPXXGGXXXP 703 P P P GG P P PG P P P G P Sbjct: 286 GGPGGPGGPSGPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNGPGGPGGPSGPNGPSGP 345 Query: 704 XAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 AP P P PP P PP P G GGA Sbjct: 346 PAPPGFGSDPSRPVPPPPGPVPPPPGGAGGPGGPGGPGGA 385 Score = 64.1 bits (149), Expect = 4e-09 Identities = 56/201 (27%), Positives = 56/201 (27%), Gaps = 1/201 (0%) Frame = +2 Query: 200 PGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPP 379 PG G G G GG GG G PG GG P Sbjct: 192 PGGSGGPGAPGGPGGPGGPGGFGSPDGPNRPGGFGGPGSPDGPGGSGGPNGA-GGFGGPG 250 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXGGGGG-GXXXXXGXGXFXXFPXXXGGGGGXXXVX 556 P G G GG G G GG GG G G P GG GG Sbjct: 251 GPGGPNGPGGPGGPNGAGGFGGPGGPGGSGGSGGFGGPGGPGGPSGPNSPGGPGGYNGPG 310 Query: 557 XXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 P P GG G P P GPP P P P P PP Sbjct: 311 GPGGPNGPNNPGGPGGYNGPGGPGGPSGPNGPSGPPAP-PGFGSDPSRPVPPPPGPVPP- 368 Query: 737 PPXPPXPXAGPPXPAAPXXXP 799 PP GP P P P Sbjct: 369 ---PPGGAGGPGGPGGPGGAP 386 Score = 64.1 bits (149), Expect = 4e-09 Identities = 51/168 (30%), Positives = 53/168 (31%), Gaps = 13/168 (7%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGP--AXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG----G 661 +P P G G GP + G G GG GG G G P G GG G Sbjct: 215 SPDGPNRPGGFGGPGSPDGPGGSGGPNGAGGFGGPGGPGGPNGPGGPGGPNGAGGFGGPG 274 Query: 660 GPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXP--PPPPXXXGXXXKXPXPX 487 GPG G GG G P GG GG P P P G P Sbjct: 275 GPGGSGGSGGFGGPGGPGGPSGPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNGPGGPG 334 Query: 486 XXXXP-----PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PP PP P PPPP G GG G P Sbjct: 335 GPSGPNGPSGPPAPPGFGSDPSRPVPPPPGPVPPPPGGAGGPGGPGGP 382 Score = 58.8 bits (136), Expect = 2e-07 Identities = 59/209 (28%), Positives = 59/209 (28%), Gaps = 2/209 (0%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXX 643 P P G G G G P G GG GG G G P GG GG GGPG Sbjct: 198 PGAPGGPGGPGGPGGFGSP-DGPNRPGGFGGPGSPDGPGGSGGPNGAGGFGGPGGPGGPN 256 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 G GG G P GG GG P P P P Sbjct: 257 GPGGPGGPNGAGGFGGPGGPGGSGGSGGFGGPGGPGGPSGPNSPGG--PGGYNGPGGPGG 314 Query: 462 PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXX 283 P P P P P G G PP F G Sbjct: 315 PNGPNNPGGPGGYNGPGGPGGPSGPNGPSGPPAPPGF--------------------GSD 354 Query: 282 XXGXXPPPPXXXXPPRX-PXTPXXPGGPG 199 PPPP PP P PGGPG Sbjct: 355 PSRPVPPPPGPVPPPPGGAGGPGGPGGPG 383 Score = 56.8 bits (131), Expect = 7e-07 Identities = 59/202 (29%), Positives = 60/202 (29%), Gaps = 4/202 (1%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG P G G G GG G PG G Sbjct: 226 GGPGSPDGPGGSGGPNGAGGFGGPGGPGGPNGPGGPGGPNGAGGFGGPGGPGGSGGSGGF 285 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGG--GXXXXXGXGXFXXFPXXXGGGGGXX 547 P P G GG G G GG GG G G G + GG GG Sbjct: 286 GGPGGPGGPS----GPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNG----PGGPGGPS 337 Query: 548 XVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXP-XAP-XXX 721 PP PP G P PPPP P PPP GG P AP Sbjct: 338 GPNGPSGPPAPPGFGSD------PSRPVPPPPGPVP-PPPGGAGGPGGPGGPGGAPQGYQ 390 Query: 722 AXPPPPPXPPXPXAGPPXPAAP 787 A PP PP P A P P Sbjct: 391 AGPPAPPAFP-QEANRPQQGGP 411 Score = 52.4 bits (120), Expect = 1e-05 Identities = 56/225 (24%), Positives = 57/225 (25%), Gaps = 16/225 (7%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXX 643 PP G G GGP GG GG G G P GG GG GGPG Sbjct: 155 PPFGSDPSGRGGPGGPGGPGGPAGGPGGPFGPGGSDRPGGSGGPGAPGGPGGPGGPGGFG 214 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXP--PPPPXXXGXXXKXPXPXXXXXPP 469 G P GG GG P P P G P Sbjct: 215 SPDGPNRPGGFGGPGSPDGPGGSGGPNGAGGFGGPGGPGGPNGPGGPGGPNGAGGFGGPG 274 Query: 468 PP-----------PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP--PXFFFLXXXXX 328 P P P P P P P G G P P + Sbjct: 275 GPGGSGGSGGFGGPGGPGGPSGPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNGPGGPG 334 Query: 327 XXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P G P P P P P GGPG P Sbjct: 335 GPSGPNGPSGPPAPPGFGSDPSRPVPPPPGPVPPPPGGAGGPGGP 379 Score = 52.4 bits (120), Expect = 1e-05 Identities = 58/213 (27%), Positives = 59/213 (27%), Gaps = 5/213 (2%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAX---GXXXPPXXGGXGG-GGPGX 649 P G G +G G G GG GG GG G G P G GG GGP Sbjct: 183 PFGPGGSDRPGGSGGPGAPGGPGGPGGPGGFGSPDGPNRPGGFGGPGSPDGPGGSGGPNG 242 Query: 648 XXG-GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP 472 G GG GG P P GG G P P G P Sbjct: 243 AGGFGGPGG--------PGGPNGPGGPGGPNGAGGFGGPGGPGGSGGSGGFGGPGGPGG- 293 Query: 471 PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXP 292 P P P P P P G GG P P Sbjct: 294 PSGPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNGPGG----PGGPSGPNGPSGPPAPP 349 Query: 291 GXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 G P PP P P PGGPG P Sbjct: 350 GFGSDPSRPVPPPPGPVPPPPGGAGGPGGPGGP 382 Score = 47.6 bits (108), Expect = 4e-04 Identities = 58/231 (25%), Positives = 60/231 (25%), Gaps = 25/231 (10%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXG---- 361 G P PG G GG GG G PG G Sbjct: 229 GSPDGPGGSGGPNGAGGFGGPGGPGGPNGPGGPGGPNGAGGFGGPGGPGGSGGSGGFGGP 288 Query: 362 -GXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGG-----GXXXXXGXGXFXXFPXX 523 G P P + G GG GG G GG GG G G P Sbjct: 289 GGPGGPSGPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNGPGGPGGPSGPNGPSGPPAP 348 Query: 524 XG-GGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-------- 676 G G V P PPP G GG P P PP P Sbjct: 349 PGFGSDPSRPVPPPPGPVPPPPGGAGGPGGPGGPGGAPQGYQAGPPAPPAFPQEANRPQQ 408 Query: 677 --PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP----PXPAAPXXXPPXXG 811 P GG +P P P P G P P A PP G Sbjct: 409 GGPSVGGDDWVLSPPTSGAPGGPGQGPGQAQGGGYGYPQPGATQAPPPGQG 459 Score = 45.2 bits (102), Expect = 0.002 Identities = 44/150 (29%), Positives = 45/150 (30%) Frame = +2 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 P PP P G GG GG G G GG GG G GG GG Sbjct: 149 PIPPGPPPFGSDPSGRGGPGGPGGPGGPAGGPGGPFGPGG-------SDRPGGSGG---- 197 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 P P GG G P P GP P P GG P P Sbjct: 198 -----PGAPGGPGGPGGPGGFGSPDGPNRPGGFGGPGSPDGP--GGSGGPNGAGGFGGPG 250 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P P P GP P G GG+ Sbjct: 251 GPGGPNGP-GGPGGPNGAGGFGGPGGPGGS 279 Score = 43.6 bits (98), Expect = 0.007 Identities = 53/209 (25%), Positives = 53/209 (25%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P G AG GGP GG GGG G G P GG P Sbjct: 33 PPPPGGGYGFPPPAGPGGPGGPGGGPGGGPG---GPGGEPQLCPQCRTPREGGAPFCEEC 89 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 P P GG PP P G P Sbjct: 90 RWNFLTNTATSYTPAAPRPPASGGPAPH--FGQPPAGPSYGGGDSY----DYQGSRPSQM 143 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PP PPP G GG G P PG Sbjct: 144 NRPAEP-IPPGPPPFGSDPSGRGGPGGPGGPGGPAGGPGGPFGPGGSDRPGGSGGPGAPG 202 Query: 279 XGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P P P GGPG P Sbjct: 203 GPGGPGGPGGFGSPDGPNRPGGFGGPGSP 231 Score = 38.3 bits (85), Expect = 0.25 Identities = 31/112 (27%), Positives = 32/112 (28%), Gaps = 8/112 (7%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXG-FXLXSPXXXGG-------GGGXXXXXPXXX 569 GG GG G GG GG G G +P GG GG P Sbjct: 286 GGPGGPGGPSGPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNGPGGPGGPSGPNGPSGP 345 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPP P P PP P Sbjct: 346 PAPPGFGSDPSRPVPPPPGPVPPPPGGAGGPGGPGGPGGAPQGYQAGPPAPP 397 Score = 37.1 bits (82), Expect = 0.57 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 5/89 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP---PPPXXXPGPPP--PXPPXXGGXXXPXAPXXXAXPP 733 PP P GGG P P PGPPP P GG P P A P Sbjct: 121 PPAGPSYGGGDSYDYQGSRPSQMNRPAEPIPPGPPPFGSDPSGRGGPGGPGGPGGPAGGP 180 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P P P G GG Sbjct: 181 GGPFGPGGSDRPGGSGGPGAPGGPGGPGG 209 Score = 35.9 bits (79), Expect = 1.3 Identities = 31/109 (28%), Positives = 31/109 (28%), Gaps = 6/109 (5%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXG-GGXGXXXG----GGGGGXXGXXAXXPPP-PXXXGGGGXX 563 G PGG P GG G GG G G GG GG G P P G Sbjct: 289 GGPGGPSGPNSPGGPGGYNGPGGPGGPNGPNNPGGPGGYNGPGGPGGPSGPNGPSGPPAP 348 Query: 562 XGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 G P P G P P P PP PP Sbjct: 349 PGFGSDPSRPVPPPPGPVPPPPGGAGGPGGPGGPGGAPQGYQAGPPAPP 397 Score = 35.9 bits (79), Expect = 1.3 Identities = 38/143 (26%), Positives = 41/143 (28%), Gaps = 18/143 (12%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXXGGGGGGX 622 G G +G GP+ G G + PP GG GG GGPG G GG Sbjct: 331 GGPGGPSGPNGPSGPPAPPGFGSDPSRPVPPPPGPVPPPPGGAGGPGGPG---GPGGAPQ 387 Query: 621 XXXXXKXPPP-------------PXXGGGGGXXXXXTXXXP----PPPPXXXGXXXKXPX 493 PP P GG T P P G P Sbjct: 388 GYQAGPPAPPAFPQEANRPQQGGPSVGGDDWVLSPPTSGAPGGPGQGPGQAQGGGYGYPQ 447 Query: 492 PXXXXXPPPPPPXPXXPXXPPPP 424 P PPP P P P P Sbjct: 448 PGATQAPPPGQGFPQQPQRPQQP 470 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PPPPPP P PPP P G GGG Sbjct: 29 PPPPPPPPGGGYGFPPPAGPGGPGGPGGGPGGG 61 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGG 475 G PPPP P F G GG G G GGG G Sbjct: 25 GAVPPPPPPPPPGGGYGFPPPAGPGGPGGPGGGPGGGPG 63 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAP-XXXPPXXGXGG 820 PPPPP PP G P PA P P G GG Sbjct: 29 PPPPPPPPGGGYGFPPPAGPGGPGGPGGGPGG 60 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 715 GGXXWXXXPPXXGGXXGGGXGXXXGGGGG-GXXGXXAXXPPPP 590 GG W PP G G G G GGG G A PPP Sbjct: 414 GGDDWVLSPPTSGAPGGPGQGPGQAQGGGYGYPQPGATQAPPP 456 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 75.8 bits (178), Expect = 1e-12 Identities = 38/89 (42%), Positives = 38/89 (42%), Gaps = 6/89 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPPP PPPP PP GG P P PPPP P Sbjct: 1064 PPPPPMFGGA--------QPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPP 1115 Query: 749 PXPXAGPPXP------AAPXXXPPXXGXG 817 P PP P AP PP G G Sbjct: 1116 PMHGGAPPPPPPPMRGGAPPPPPPPGGRG 1144 Score = 74.9 bits (176), Expect = 2e-12 Identities = 38/90 (42%), Positives = 38/90 (42%), Gaps = 5/90 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPPP PPPP PP GG P P PPPP P Sbjct: 1039 PPPPPMHGGA-------PPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPP 1091 Query: 749 PXPXAGPPXPAAP-----XXXPPXXGXGGA 823 P PP P P PP GGA Sbjct: 1092 PMRGGAPPPPPPPMRGGAPPPPPPPMHGGA 1121 Score = 74.5 bits (175), Expect = 3e-12 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPPP PPPP PP GG P P PPPP P Sbjct: 1076 PPPPPMRGGA--------PPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPP 1127 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P P P Sbjct: 1128 PMRGGAPPPPPPPGGRGP 1145 Score = 72.9 bits (171), Expect = 9e-12 Identities = 39/84 (46%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP--PPPP 742 PPPPP GG PPPPPP PPPP PP GG P P P PPPP Sbjct: 1100 PPPPPMRGGA--------PPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPP 1151 Query: 743 XPPXPXA-GPPXPAAPXXXPPXXG 811 PP A GPP P P PP G Sbjct: 1152 PPPGGRAPGPPPPPGP--RPPGGG 1173 Score = 72.1 bits (169), Expect = 2e-11 Identities = 36/81 (44%), Positives = 36/81 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPPP PPPP PP GG P P PPPP P Sbjct: 1088 PPPPPMRGGA--------PPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPP 1139 Query: 749 PXPXAGPPXPAAPXXXPPXXG 811 P G P AP PP G Sbjct: 1140 P----GGRGPGAPPPPPPPGG 1156 Score = 71.3 bits (167), Expect = 3e-11 Identities = 37/90 (41%), Positives = 37/90 (41%), Gaps = 5/90 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPPP PPP PP GG P P PPPP P Sbjct: 1052 PPPPPMHGGA--------PPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPP 1103 Query: 749 PXPXAGPPXPAAPXXX-----PPXXGXGGA 823 P PP P P PP GGA Sbjct: 1104 PMRGGAPPPPPPPMHGGAPPPPPPPMRGGA 1133 Score = 67.3 bits (157), Expect = 5e-10 Identities = 31/72 (43%), Positives = 31/72 (43%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPPP P PPPP PP G P P PPPP PP Sbjct: 935 PPPPSYGS------PPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPP 988 Query: 752 XPXAGPPXPAAP 787 P G P P P Sbjct: 989 PPSYGSPPPPPP 1000 Score = 67.3 bits (157), Expect = 5e-10 Identities = 37/91 (40%), Positives = 37/91 (40%), Gaps = 6/91 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP GG PPPPPP PPPP P P GG P P PPP Sbjct: 1026 PPPPPMHGGA-------PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPP 1078 Query: 746 PPXPXAGPPXPAAP-----XXXPPXXGXGGA 823 PP PP P P PP GGA Sbjct: 1079 PPMRGGAPPPPPPPMRGGAPPPPPPPMRGGA 1109 Score = 66.5 bits (155), Expect = 8e-10 Identities = 33/81 (40%), Positives = 33/81 (40%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPP P PPPP PP G P P PPPP P Sbjct: 919 PPPPPPPFSNA----HSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPP 974 Query: 749 PXPXAGPPXPAAPXXXPPXXG 811 P P G P P P PP G Sbjct: 975 PPPGYGSPPP--PPPPPPSYG 993 Score = 65.3 bits (152), Expect = 2e-09 Identities = 35/91 (38%), Positives = 35/91 (38%), Gaps = 7/91 (7%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG--XXXPXAPXXXAXPPPPPX 745 PPPP PPPPP PPPP PP GG P P PPPPP Sbjct: 995 PPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPP 1054 Query: 746 PPXPXAGPPXPAAP-----XXXPPXXGXGGA 823 PP PP P P PP GGA Sbjct: 1055 PPMHGGAPPPPPPPMFGGAQPPPPPPMRGGA 1085 Score = 64.9 bits (151), Expect = 2e-09 Identities = 39/96 (40%), Positives = 40/96 (41%), Gaps = 11/96 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXA--XPPPPP 742 PPPPP G PPPPPP PPPP PP G P P + PPPPP Sbjct: 945 PPPPPPPSYGSPP-----PPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPP 999 Query: 743 XPP------XPXAGPPXP---AAPXXXPPXXGXGGA 823 PP P PP P AP PP GGA Sbjct: 1000 PPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGA 1035 Score = 64.9 bits (151), Expect = 2e-09 Identities = 51/169 (30%), Positives = 51/169 (30%), Gaps = 5/169 (2%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXX---PPPPPXX 520 PP GG P GG PPPP GG PPPPP Sbjct: 1016 PPMHGGAPPPPPPPPMHGGA------PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPM 1069 Query: 519 XGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXG--GGGXXXPPXFFF 346 G P P PPPPP P PPPPPPP GG PP Sbjct: 1070 FGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPP---- 1125 Query: 345 LXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPG 199 P PG G PPPP P P P PG Sbjct: 1126 ---PPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPG 1171 Score = 64.9 bits (151), Expect = 2e-09 Identities = 34/75 (45%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXAPXXXA----XPP 733 PPPPP GG PPPPPP G PPPP PP G P P PP Sbjct: 1112 PPPPPMHGGA---------PPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPP 1162 Query: 734 PPPXPPXPXAGPPXP 778 PPP P P GPP P Sbjct: 1163 PPPGPRPPGGGPPPP 1177 Score = 64.1 bits (149), Expect = 4e-09 Identities = 46/137 (33%), Positives = 46/137 (33%), Gaps = 1/137 (0%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 APP P GA P GG GA PP GG P Sbjct: 1035 APPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMRGGAPPPPPPPMR 1094 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXP-XXXXXPPP 466 GG PPPP GG PPPPP G P P PPP Sbjct: 1095 GGA--------PPPPPPPMRGGA---------PPPPPPPMHGGAPPPPPPPMRGGAPPPP 1137 Query: 465 PPPXPXXPXXPPPPPPP 415 PPP P PPPPPPP Sbjct: 1138 PPPGGRGPGAPPPPPPP 1154 Score = 62.9 bits (146), Expect = 1e-08 Identities = 42/95 (44%), Positives = 42/95 (44%), Gaps = 10/95 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXX---AXPP 733 PPPPP GG PPPPPP G PPPP PP GG P P A PP Sbjct: 1013 PPPPPMHGGA--------PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPP 1064 Query: 734 PPPXPPXPXAGPPXP-----AAPXXXPPXXGXGGA 823 PPP P A PP P AP PP GGA Sbjct: 1065 PPP-PMFGGAQPPPPPPMRGGAPPPPPPPM-RGGA 1097 Score = 62.5 bits (145), Expect = 1e-08 Identities = 32/83 (38%), Positives = 32/83 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPP P PPPP PP G P P PPPP P Sbjct: 920 PPPPPPFSNA-----HSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPP 974 Query: 749 PXPXAGPPXPAAPXXXPPXXGXG 817 P P G P P P P G Sbjct: 975 PPPGYGSPPPPPP----PPPSYG 993 Score = 62.1 bits (144), Expect = 2e-08 Identities = 51/168 (30%), Positives = 51/168 (30%), Gaps = 4/168 (2%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXX--PPPPPXXX 517 PP GG P GG PPPP GG PPPPP Sbjct: 1029 PPMHGGAPPPPPPPPMHGGA------PPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPPMR 1082 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGG--GGXXXPPXFFFL 343 G P P PPPPP P PPPPPPP GG PP Sbjct: 1083 GGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPP---- 1138 Query: 342 XXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPG 199 P PG G PPPP P P P G G Sbjct: 1139 -PPGGRGPGAPPPPPPPGGRAPGP-PPPPGPRPPGGGPPPPPMLGARG 1184 Score = 61.7 bits (143), Expect = 2e-08 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXX----PXAPXXXAXPPP 736 PPPPP G G PPPPPP PPPP PP P P PP Sbjct: 971 PPPPPPPGYGSPP------PPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPP 1024 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXG 811 PP PP G P P P PP G Sbjct: 1025 PPPPPPMHGGAPPPPPP---PPMHG 1046 Score = 60.9 bits (141), Expect = 4e-08 Identities = 47/145 (32%), Positives = 47/145 (32%), Gaps = 9/145 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX-PPPPPPXPXXPXXPPPP 424 PPPP GG PPPPP G P P PPPPPP P PPPP Sbjct: 1014 PPPPMHGGA--------PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPP 1065 Query: 423 PPPXXXXXXXXGX----GGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPP 256 PPP GG PP P P G PPPP Sbjct: 1066 PPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPP 1125 Query: 255 XXXX----PPRXPXTPXXPGGPGXP 193 PP P P GPG P Sbjct: 1126 PPPMRGGAPP--PPPPPGGRGPGAP 1148 Score = 60.5 bits (140), Expect = 5e-08 Identities = 41/136 (30%), Positives = 42/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P P PPPPPP P PPPPP Sbjct: 935 PPPPSYGS--------PPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPP 986 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP G PP F + P PPP P Sbjct: 987 PP------PPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAP----PPPPPPPMHGGAP 1036 Query: 240 PRXPXTPXXPGGPGXP 193 P P P G P P Sbjct: 1037 PPPPPPPMHGGAPPPP 1052 Score = 60.5 bits (140), Expect = 5e-08 Identities = 40/120 (33%), Positives = 40/120 (33%), Gaps = 4/120 (3%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX-PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 PPPPP G P P PPPPPP P PPPPPPP GG Sbjct: 1013 PPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMH-------GGAPPPP 1065 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXX---XXPPRXPXTPXXPGGPGXP 193 PP F P P G PPPP P P P G P P Sbjct: 1066 PPPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMHGGAPPPP 1125 Score = 54.0 bits (124), Expect = 5e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P PPPPPPP Sbjct: 921 PPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPP 962 Score = 53.6 bits (123), Expect = 6e-06 Identities = 25/63 (39%), Positives = 26/63 (41%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP G P P PPPPP +PPPP Sbjct: 945 PPPPPPPSYGSPPP------PPPPPPSYGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPP 998 Query: 421 PPP 413 PPP Sbjct: 999 PPP 1001 Score = 51.6 bits (118), Expect = 2e-05 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP G P P PPPPP PPPP Sbjct: 997 PPPPPPFS----HVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPP 1052 Query: 421 PPP 413 PPP Sbjct: 1053 PPP 1055 Score = 50.8 bits (116), Expect = 4e-05 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 P PP P PPPP P P PPPPP PP PP P P PP Sbjct: 910 PSPPVKTAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPP---PPSY 966 Query: 809 G 811 G Sbjct: 967 G 967 Score = 50.4 bits (115), Expect = 6e-05 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX--PPPPPXXXXXXXTPP 428 PPPP G G PPPPP G P P PPPPP PP Sbjct: 971 PPPPPPPGYGSPPP------PPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPP 1024 Query: 427 PPPPP 413 PPPPP Sbjct: 1025 PPPPP 1029 Score = 49.2 bits (112), Expect = 1e-04 Identities = 31/87 (35%), Positives = 34/87 (39%), Gaps = 14/87 (16%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX---PG-----PPPPXPPXXGGXXXPXAPXXXA 724 PPPPP PPPPPP P PPPP PP P + Sbjct: 651 PPPPPLPTYSHYQTSQLPPPPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGTVLP 710 Query: 725 XPPPPPXP---PXPXAG---PPXPAAP 787 PPPPP P P +G PP P+ P Sbjct: 711 PPPPPPLPFSSERPNSGTVLPPPPSPP 737 Score = 48.4 bits (110), Expect = 2e-04 Identities = 28/87 (32%), Positives = 29/87 (33%), Gaps = 6/87 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP---- 433 PPPP T PPPPP + P PPPPPP P P Sbjct: 648 PPPPPPPPLPTYSHYQTSQLPPPPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGT 707 Query: 432 --PPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPPP G PP Sbjct: 708 VLPPPPPPPLPFSSERPNSGTVLPPPP 734 Score = 47.6 bits (108), Expect = 4e-04 Identities = 36/128 (28%), Positives = 37/128 (28%), Gaps = 8/128 (6%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP----XXPXXPPPPPP----PXXXXXX 397 T PPPPP P PPPPP P P PPPPPP P Sbjct: 916 TAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPP 975 Query: 396 XXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPX 217 G G PP + P PPP PP P P Sbjct: 976 PPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIP----PPPPPPPMHGGAPPPPPPPPM 1031 Query: 216 XPGGPGXP 193 G P P Sbjct: 1032 HGGAPPPP 1039 Score = 47.6 bits (108), Expect = 4e-04 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP P P PPPPP + PPP Sbjct: 958 PPPPPPPS-----YGSPPPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPP 1012 Query: 421 PPP 413 PPP Sbjct: 1013 PPP 1015 Score = 47.2 bits (107), Expect = 5e-04 Identities = 30/84 (35%), Positives = 31/84 (36%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP--PXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPPP P P P P G P P A PPPPP Sbjct: 864 PPPPPFSPLNTTKANDYILPPPPLPYTSIAPSPSVKILPLHGISSAPSPPVKTAPPPPPP 923 Query: 743 XPPXPXA----GPPXPAAPXXXPP 802 PP A PP P+ PP Sbjct: 924 -PPFSNAHSVLSPPPPSYGSPPPP 946 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 5/71 (7%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXX---PPPPPXXXGEXXKXPXXPXXXXX--PPPPPXXXX 446 A PPPP GG PPPPP G P P PPPPP Sbjct: 1097 APPPPPPPMRGGAPPPPPPPMHGGAPPPPPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGG 1156 Query: 445 XXXTPPPPPPP 413 PPPPP P Sbjct: 1157 RAPGPPPPPGP 1167 Score = 46.0 bits (104), Expect = 0.001 Identities = 33/103 (32%), Positives = 33/103 (32%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P GG PPPP GG PPPPP PGPPPP P Sbjct: 1115 PPMHGGAPPPPPPPMRGGAPPPPPPPGGRG--PGAPPPPPPPGGRAPGPPPPPGP----- 1167 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P PPPP A P A P G G A Sbjct: 1168 ----RPPGGGPPPPPMLGARGAAVDPRGAGRGRGLPRPGFGSA 1206 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P PPPPP +PPPPPPP Sbjct: 920 PPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPP 962 Score = 44.4 bits (100), Expect = 0.004 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXP--XXXXXPPPPPXXXXXXX 437 A PPPP GG PPPPP G P P PPPPP Sbjct: 1121 APPPPPPPMRGGA--------PPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPGG 1172 Query: 436 TPPPPP 419 PPPPP Sbjct: 1173 GPPPPP 1178 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP-----XXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP G P PPPPPP PPP PP GG PP Sbjct: 1023 PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPMFGGAQPPPPPP 1080 Score = 43.2 bits (97), Expect = 0.009 Identities = 26/69 (37%), Positives = 28/69 (40%), Gaps = 15/69 (21%) Frame = +2 Query: 626 PPPPPPXXXPG---------PPPPXPPXXGGXXXPXAPXXXAXPPPPPXP---PXPXAG- 766 PPPPPP P PPPP PP P + PPPPP P P +G Sbjct: 648 PPPPPPPPLPTYSHYQTSQLPPPPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGT 707 Query: 767 --PPXPAAP 787 PP P P Sbjct: 708 VLPPPPPPP 716 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP G P PPPPP PPP PP GG PP Sbjct: 1010 PPPPPPPPMHGGA-------PPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPP 1055 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPX---XXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 918 PPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPP 963 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP + P PPPPP PPP PP GG PP Sbjct: 990 PSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPP 1042 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPPP P PPP PP G PP Sbjct: 944 PPPPPPPP-------SYGSPPPPPPPPPSYGSPPPPPPPPPGYGSPPPPPPPP 989 Score = 41.1 bits (92), Expect = 0.035 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G + PPPP G PPPP P P PPPP Sbjct: 978 GYGSPPPPPPPPPS-----YGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMH 1032 Query: 439 XTPPPPPPP 413 PPPPPP Sbjct: 1033 GGAPPPPPP 1041 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPP P PPPPP PPPPPPP Sbjct: 934 SPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPP 976 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP G + P PPPPP P PPP PP G PP Sbjct: 956 PPPPPPPPPSYG-----SPPPP-PPPPPGYGSPPPPPPPPPSYGSPPPPPPPP 1002 Score = 39.9 bits (89), Expect = 0.081 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 3/44 (6%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXX---PXPPPXXPPXXGG 692 PPPP GG G A PPPPPP P PPP P GG Sbjct: 1134 PPPPPPPGGRGPGAP----PPPPPPGGRAPGPPPPPGPRPPGGG 1173 Score = 39.5 bits (88), Expect = 0.11 Identities = 25/78 (32%), Positives = 26/78 (33%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G P P PPPP PP PPPPP P Sbjct: 765 PPPPPAYYSVGQKSSDLQTSQLPSP-----PPPPPPPPFASV---RRNSETLLPPPPPPP 816 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P A + PP Sbjct: 817 PPPFASVRRNSETLLPPP 834 Score = 39.5 bits (88), Expect = 0.11 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 16/77 (20%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-----------PPPPXPPXXGGXXXPX--- 706 PPPPP PPPPPP P PPPP PP Sbjct: 791 PPPPPPPFASVRRNSETLLPPPPPPPPPPFASVRRNSETLLPPPPPPPPWKSLYASTFET 850 Query: 707 --APXXXAXPPPPPXPP 751 A + PPPPP PP Sbjct: 851 HEACSTSSSPPPPPPPP 867 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 11/60 (18%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPP----PPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 PPPP G G P PP PPPP P PPP PP GG PP Sbjct: 970 PPPPPPPPGYGSPPPPPPPPPSYGSPPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPP 1029 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXN------PPPPPPP 414 PPPPP + P PPPPP PPPPPPP Sbjct: 791 PPPPPPPFASVRRNSETLLPPPPPPPPPPFASVRRNSETLLPPPPPPP 838 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Frame = +3 Query: 558 PXXXPPPPXXXGGG------GXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPPP P PPP PP G PP Sbjct: 918 PPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPPP 976 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 10/52 (19%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP----------XXPPPPPPP 415 PPPPP K P PPPP P P PPPPPPP Sbjct: 765 PPPPPAYYSVGQKSSDLQTSQLPSPPPPPPPPPFASVRRNSETLLPPPPPPP 816 Score = 35.1 bits (77), Expect = 2.3 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 19/77 (24%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---------PPPPXPPXXG----GXXXPX- 706 PPPPP PPPPPP PPPP PP P Sbjct: 692 PPPPPPFSSERPNSGTVLPPPPPPPLPFSSERPNSGTVLPPPPSPPWKSVYASALAIPAI 751 Query: 707 -----APXXXAXPPPPP 742 AP PPPPP Sbjct: 752 CSTSQAPTSSPTPPPPP 768 Score = 34.7 bits (76), Expect = 3.0 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 12/75 (16%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT---- 434 PPPP PPPPP + PPPPP T Sbjct: 792 PPPPPPFASVRRNSETLLPPPPPPPPPPFASVRRNSETLLPPPPPPPPWKSLYASTFETH 851 Query: 433 --------PPPPPPP 413 PPPPPPP Sbjct: 852 EACSTSSSPPPPPPP 866 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP P P PP P PPPPPPP Sbjct: 910 PSPPVKTAPPPPPPPPFSNAHSVLSPPPPSYGSPPPPPPPP 950 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 8/28 (28%) Frame = -2 Query: 474 PPPPPPXPXXPXX--------PPPPPPP 415 PPPPPP P P PPPPPPP Sbjct: 647 PPPPPPPPPLPTYSHYQTSQLPPPPPPP 674 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 641 PXXXPGPPPPXPPXXG-GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P PPPP P G PPPP PP P A + PP Sbjct: 758 PTSSPTPPPPPPAYYSVGQKSSDLQTSQLPSPPPPPPPPPFASVRRNSETLLPPP 812 Score = 34.3 bits (75), Expect = 4.0 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 14/76 (18%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP------------ 457 PPPP T PPPPP PPPPPP Sbjct: 791 PPPPPPPFASVRRNSETLLPPPPPPPPPPFASVRRNSETLLPPPPPPPPWKSLYASTFET 850 Query: 456 --XPXXPXXPPPPPPP 415 PPPPPPP Sbjct: 851 HEACSTSSSPPPPPPP 866 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 9/50 (18%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP---------XXXPXPPPXXPP 680 P PPPP + P PPPPPP P PPP PP Sbjct: 648 PPPPPPPPLPTYSHYQTSQLPPPPPPPPPFSSERPNSGTVLPPPPPPPPP 697 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 6/47 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP------PPXXPP 680 P PPPP P PPPPPP P PP PP Sbjct: 669 PPPPPPPPFSSERPNSGTVLPPPPPPPPPFSSERPNSGTVLPPPPPP 715 >UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: FH2 domain protein - Entamoeba histolytica HM-1:IMSS Length = 1212 Score = 74.5 bits (175), Expect = 3e-12 Identities = 36/84 (42%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX-AXPPPPPX 745 PPPPP G PPPPPP PPPP PP G P P PPPPP Sbjct: 624 PPPPPPPGASSVP------PPPPPPGASSVPPPPPPPGMPGMPPPPPPPGMPGMPPPPPL 677 Query: 746 PPXPXAGPPXPAAPXXXPPXXGXG 817 P P PP P P PP G G Sbjct: 678 PGMPGMPPPPPGMPGMPPPPPGFG 701 Score = 63.7 bits (148), Expect = 6e-09 Identities = 33/86 (38%), Positives = 33/86 (38%), Gaps = 3/86 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX---PPPPP 742 PPPP G PPPPPP PPPP PP P P PPPPP Sbjct: 613 PPPPPPGASSVP------PPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPPPPPP 666 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P P PP G G Sbjct: 667 GMPGMPPPPPLPGMPGMPPPPPGMPG 692 Score = 62.1 bits (144), Expect = 2e-08 Identities = 32/78 (41%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPPP PG PPP PP G P P P PP P Sbjct: 636 PPPPPPPGASSV-------PPPPPPPGMPGMPPPPPPP-GMPGMPPPPPLPGMPGMPPPP 687 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P PP Sbjct: 688 PGMPGMPPPPPGFGFRPP 705 Score = 57.2 bits (132), Expect = 5e-07 Identities = 27/62 (43%), Positives = 28/62 (45%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G + PPPPP P P PPPPPP P P PPPPP Sbjct: 613 PPPPPPGAS-------SVPPPPPPPGASSVPPPPPPPGASSVPPPPPP-PGMPGMPPPPP 664 Query: 420 PP 415 PP Sbjct: 665 PP 666 Score = 56.8 bits (131), Expect = 7e-07 Identities = 31/84 (36%), Positives = 32/84 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G + PPPPP P P PPPPPP P P PPPPP Sbjct: 625 PPPPPPGAS-------SVPPPPPPPGASSVPPPPPPPGMPGMPPPPPP-PGMPGMPPPPP 676 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFF 349 P G G PP F Sbjct: 677 LPGMPGMPPPPPGMPGMPPPPPGF 700 Score = 52.8 bits (121), Expect = 1e-05 Identities = 38/120 (31%), Positives = 38/120 (31%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 T PPPPP P P PPPPP P PPPPPPP G G Sbjct: 609 TATAPPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPP----------GMPG 658 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP P G PPPP P P P PG P P Sbjct: 659 MPPPP---------------------PPPGMPGMPPPPPLPGMPGMPPPPPGMPGMPPPP 697 Score = 50.8 bits (116), Expect = 4e-05 Identities = 32/73 (43%), Positives = 32/73 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPPP PG PPP PP G P P PPPP Sbjct: 648 PPPPPPPGMPGMP------PPPPPP-GMPGMPPP-PPLPGMPGMPPPPPGMPGMPPPP-- 697 Query: 749 PXPXAGPPXPAAP 787 P G P AP Sbjct: 698 --PGFGFRPPGAP 708 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/51 (39%), Positives = 22/51 (43%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPP PPP PP P P + PPPP PP + PP P P Sbjct: 604 PPPSNTATAPPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPP 654 Score = 47.6 bits (108), Expect = 4e-04 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 5/62 (8%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP-----PXPXAGPPXPAAPXXX 796 PPP PPPP P P P + PPPPP P P P P P P Sbjct: 604 PPPSNTATAPPPPPPGASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPPP 663 Query: 797 PP 802 PP Sbjct: 664 PP 665 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P P PPPPP P Sbjct: 610 ATAPPPPPP--------GASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGM-P 660 Query: 430 PPPPPP 413 PPPPPP Sbjct: 661 PPPPPP 666 Score = 36.7 bits (81), Expect = 0.75 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 9/61 (14%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPP-----PPPXXXP----XPPPXXPPXXGGXXXXXXPPGX 722 PPPP G + P PPP PPP P PPP PP G PPG Sbjct: 613 PPPPPP----GASSVPPPPPPPGASSVPPPPPPPGASSVPPPPPPPGMPGMPPPPPPPGM 668 Query: 723 P 725 P Sbjct: 669 P 669 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P PPPPP PPPPPPP Sbjct: 604 PPPSNTATAPPPPPPGASSVPPPPPPP---GASSVPPPPPPP 642 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 74.5 bits (175), Expect = 3e-12 Identities = 36/78 (46%), Positives = 36/78 (46%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG G PPPPPP GPPPP PP G AP PPPPP Sbjct: 843 PPPPPPPGGKGAP---PPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAP----PPPPPPGG 895 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 896 PRPPGPPPPPGGAPPLPP 913 Score = 72.1 bits (169), Expect = 2e-11 Identities = 40/90 (44%), Positives = 40/90 (44%), Gaps = 5/90 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP GG PPPPPP PG PPPP PP GG P PP Sbjct: 808 PPPPPPPPGGSK--TLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAP-------PPP 858 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PPP PP GPP P P PP G A Sbjct: 859 PPPPPPGSKTGPPPP--PPPPPPGAKTGSA 886 Score = 67.7 bits (158), Expect = 4e-10 Identities = 36/90 (40%), Positives = 36/90 (40%), Gaps = 5/90 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPP PPPP PP G P PPPPP P Sbjct: 826 PPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGP-------PPPPPPPP 878 Query: 749 PXPXAG-----PPXPAAPXXXPPXXGXGGA 823 P G PP P P P GGA Sbjct: 879 PGAKTGSAPPPPPPPGGPRPPGPPPPPGGA 908 Score = 63.7 bits (148), Expect = 6e-09 Identities = 28/67 (41%), Positives = 28/67 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPPP G PP PP GG P P PP P Sbjct: 855 PPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPPLPPG 914 Query: 749 PXPXAGP 769 P P GP Sbjct: 915 PRPPGGP 921 Score = 62.1 bits (144), Expect = 2e-08 Identities = 39/112 (34%), Positives = 39/112 (34%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP G P P PPPPP P PPPPPPP G G P Sbjct: 808 PPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPG-------GKGAPPPPPP 860 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 P P PG PPPP PR P P PGG Sbjct: 861 PP----PPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGG-PRPPGPPPPPGG 907 Score = 60.9 bits (141), Expect = 4e-08 Identities = 45/133 (33%), Positives = 45/133 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG PPPPP G P PPPPPP P PPPPP Sbjct: 810 PPPPPPGGS---KTLPRPPPPPPPPPPPGGKSAPP-------PPPPPPPPGGKGAPPPPP 859 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP G G PP P PG PPPP P Sbjct: 860 PP-----PPPGSKTGPPPPPPP----PPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPP 910 Query: 240 PRXPXTPXXPGGP 202 P P PGGP Sbjct: 911 --LPPGPRPPGGP 921 Score = 54.8 bits (126), Expect = 3e-06 Identities = 32/87 (36%), Positives = 32/87 (36%), Gaps = 7/87 (8%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-------PPPPPXPXXP 442 PPPP GG G PPPPP G P P P PPPPP P P Sbjct: 844 PPPPPPGGKGAPP-------PPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGP 896 Query: 441 XXPPPPPPPXXXXXXXXGXGGGGXXXP 361 P PPPPP G G P Sbjct: 897 RPPGPPPPPGGAPPLPPGPRPPGGPDP 923 Score = 52.0 bits (119), Expect = 2e-05 Identities = 25/55 (45%), Positives = 26/55 (47%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 P PPPP PP G P P PPPPP PP + PP P P PP G G Sbjct: 806 PPPPPPPPPPGGSKTLPRPP----PPPPPPPPPGGKSAPPPPPPP---PPPGGKG 853 Score = 52.0 bits (119), Expect = 2e-05 Identities = 31/82 (37%), Positives = 32/82 (39%), Gaps = 10/82 (12%) Frame = -2 Query: 630 GGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-----PP 466 GG PPPP GG + PPPPP G P P P PP Sbjct: 816 GGSKTLPRPPPPPPPPPPPGGK----SAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPP 871 Query: 465 PPPXPXXP-----XXPPPPPPP 415 PPP P P PPPPPPP Sbjct: 872 PPPPPPPPGAKTGSAPPPPPPP 893 Score = 51.2 bits (117), Expect = 3e-05 Identities = 31/93 (33%), Positives = 31/93 (33%), Gaps = 1/93 (1%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP GG P GG PPPP G PPPP G Sbjct: 831 PPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPP-----GSKTGPPPPPPPPPPGAKTGS 885 Query: 510 XXKXPXPXXXXXPPPPPPXP-XXPXXPPPPPPP 415 P P PP PPP P P PP P PP Sbjct: 886 APPPPPPPGGPRPPGPPPPPGGAPPLPPGPRPP 918 Score = 50.4 bits (115), Expect = 6e-05 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPPP PPP PP G PP P Sbjct: 806 PPPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPP 861 Score = 49.2 bits (112), Expect = 1e-04 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P P PPPPP P Sbjct: 803 AFVPPPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPP----PPPPPPGGKGAPPPP 858 Query: 430 PPPPPP 413 PPPPPP Sbjct: 859 PPPPPP 864 Score = 46.8 bits (106), Expect = 7e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP PPPPPPP Sbjct: 806 PPPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPP 847 Score = 44.4 bits (100), Expect = 0.004 Identities = 22/69 (31%), Positives = 22/69 (31%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G PPPP G P P P PPP Sbjct: 850 GGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAP 909 Query: 439 XTPPPPPPP 413 PP P PP Sbjct: 910 PLPPGPRPP 918 Score = 43.6 bits (98), Expect = 0.007 Identities = 25/72 (34%), Positives = 26/72 (36%), Gaps = 3/72 (4%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX---PPPPPXXX 449 G + PPPP GG PPPP G P P PPPPP Sbjct: 835 GGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPG 894 Query: 448 XXXXTPPPPPPP 413 PP PPPP Sbjct: 895 GPR--PPGPPPP 904 Score = 42.3 bits (95), Expect = 0.015 Identities = 28/88 (31%), Positives = 28/88 (31%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP GG G P G PPPP G PPPPP G Sbjct: 846 PPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSA---------PPPPPPPGGP 896 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 P P PP PP P P P P Sbjct: 897 RPPGP-PPPPGGAPPLPPGPRPPGGPDP 923 Score = 39.5 bits (88), Expect = 0.11 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG--XXXXXXPPGXP 725 P PPPP G PPPPPP P PP PP G PPG P Sbjct: 870 PPPPPPPPPPGAKTG------SAPPPPPPPGGPRPPGPPPPPGGAPPLPPGPRPPGGP 921 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Frame = +3 Query: 609 AXXPXXPPPPPP------XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPPPPP P PPP PP GG PP P Sbjct: 803 AFVPPPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPP 847 Score = 37.5 bits (83), Expect = 0.43 Identities = 31/96 (32%), Positives = 31/96 (32%), Gaps = 4/96 (4%) Frame = -2 Query: 474 PPPPPPXPXX----PXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXX 307 PPPPPP P P PPPPPPP GG PP Sbjct: 808 PPPPPPPPGGSKTLPRPPPPPPPPPPP---------GGKSAPPP--------------PP 844 Query: 306 XXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPG 199 P PG PPPP P P P PG Sbjct: 845 PPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPG 880 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 PPPPP PP P P P PP GG Sbjct: 806 PPPPPPPPPPGGSKTLPRPPPPPPPPPPPGG 836 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 73.7 bits (173), Expect = 5e-12 Identities = 36/79 (45%), Positives = 36/79 (45%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP G G PPPPPP PG PPPP PP G P P PPPP Sbjct: 617 PPPPPPPGMPGM-------PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 669 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 670 PGMPGMPPPPPGMPGMPPP 688 Score = 73.3 bits (172), Expect = 7e-12 Identities = 38/85 (44%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP G G PPPPPP PG PPPP PP G P P PPPPP Sbjct: 629 PPPPPPPGMPGM-------PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPG 681 Query: 746 PPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P P PP G G Sbjct: 682 MPG-MPPPPPPGMPGMPPPPPGMPG 705 Score = 73.3 bits (172), Expect = 7e-12 Identities = 38/84 (45%), Positives = 38/84 (45%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPPP PG PPP PP G P P PPPPP P Sbjct: 641 PPPPPPPGMPG-------MPPPPPPPGMPGMPPPPPPGMPG-MPPPPPGMPGMPPPPP-P 691 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P P PP G G Sbjct: 692 GMPGMPPPPPGMPGMPPPPPGMPG 715 Score = 66.9 bits (156), Expect = 6e-10 Identities = 36/86 (41%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP--PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G P PPPPP PG PPP PP G P P PPPPP Sbjct: 643 PPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPP-PPGMPGMPPPPPPGMPGMPPPPP 701 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P P PP G G Sbjct: 702 G--MPGMPPPPPGMPGMPPPPPGGFG 725 Score = 65.7 bits (153), Expect = 1e-09 Identities = 38/89 (42%), Positives = 38/89 (42%), Gaps = 5/89 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXAPXXX-AXPPPPP 742 PPPPP G PPPPPP PG PPPP PP G P P PPPPP Sbjct: 605 PPPPPPPGASSI-------PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 657 Query: 743 ---XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P PP P P PP G G Sbjct: 658 PPGMPGMPP--PPPPGMPGMPPPPPGMPG 684 Score = 64.5 bits (150), Expect = 3e-09 Identities = 46/136 (33%), Positives = 48/136 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G + PPPPP G P P PPPPPP P P PPPPP Sbjct: 606 PPPPPPGAS-------SIPPPPPPPGMPGMPPPPPPPGMPGMPPPPPP-PGMPGMPPPPP 657 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP G G PP + P P G PPPP P Sbjct: 658 PP--------GMPGMPPPPPPG---MPGMPPPPPGMPGMPPPPPPGMPGMPPPPP--GMP 704 Query: 240 PRXPXTPXXPGGPGXP 193 P P PG P P Sbjct: 705 GMPPPPPGMPGMPPPP 720 Score = 61.7 bits (143), Expect = 2e-08 Identities = 41/120 (34%), Positives = 42/120 (35%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 T PPPPP P P PPPPPP P P PPPPPPP G G Sbjct: 603 TMPPPPPPPGASSIPPPPPPPGMPGMPPPPPP-PGMPGMPPPPPPP----------GMPG 651 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP + P P G PPPP P P P PG P P Sbjct: 652 MPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPG-MPPPPPPGMPGMPPPPPGMPGMPPPP 710 Score = 51.2 bits (117), Expect = 3e-05 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 8/81 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-- 736 PPPPP G G P PPPP PG PPP PP G P PPP Sbjct: 653 PPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPG 712 Query: 737 ----PPXPPXPXAGPPXPAAP 787 PP PP PAAP Sbjct: 713 MPGMPPPPPGGFGF--RPAAP 731 Score = 49.6 bits (113), Expect = 1e-04 Identities = 39/123 (31%), Positives = 39/123 (31%), Gaps = 1/123 (0%) Frame = -2 Query: 711 GAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPP- 535 GA PP G G P G G PPPP G G P Sbjct: 612 GASSIPPPPPPPGMPGMPPPPPPPGMPG-------MPPPPPPPGMPGMPPPPPPPGMPGM 664 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPX 355 PPP G P P PPPPP P P PPPPP G G P Sbjct: 665 PPPPPPGMPGMPPPPPGMPGMPPPPP-PGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGG 723 Query: 354 FFF 346 F F Sbjct: 724 FGF 726 Score = 41.1 bits (92), Expect = 0.035 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPP PG PPP P G P P P P P Sbjct: 676 PPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPGMPG--MPPPPPGGFGFRPAAPKP 733 Score = 40.7 bits (91), Expect = 0.046 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGG----GXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPPP P PP PP G PPG P Sbjct: 626 PGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPG--MPPPPPGMP 683 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP-PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP G G P PPPP PG PPP P G P AP A P P Sbjct: 686 PPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGGFG--FRPAAPKPNAYVTMLPKP 743 Score = 39.1 bits (87), Expect = 0.14 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P P PPPP P PP PP G PPG P Sbjct: 650 PGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPPGMPG--MPPPPPGMP 704 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G PPPPP G P P PPPPP Sbjct: 671 GMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPG---MPPPPPGMPGMPPPPPGGFGFR 727 Query: 439 XTPPPP 422 P P Sbjct: 728 PAAPKP 733 Score = 35.5 bits (78), Expect = 1.7 Identities = 29/98 (29%), Positives = 29/98 (29%) Frame = -2 Query: 711 GAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPP 532 G G PP G G P G G PPPP G PPP Sbjct: 648 GMPGMPPPPPPPGMPGMPPPPPPGMPG--------MPPPPPGMPGMPPPPPPGMPGMPPP 699 Query: 531 PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP G P P PPPP P P P Sbjct: 700 PPGMPGM----PPPPPGMPGMPPPPPGGFGFRPAAPKP 733 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP------PXXPPXXGGXXXXXXPPG 719 PPPP G P PPPPPP PP PP G PPG Sbjct: 667 PPPPGMPGMPPPPPGMPGMPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPG 722 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 73.7 bits (173), Expect = 5e-12 Identities = 32/77 (41%), Positives = 33/77 (42%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPP P P PPPP PP P P + PPPPP PP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 286 PPPPPPPPPPPPPPPPP 302 Score = 73.3 bits (172), Expect = 7e-12 Identities = 32/78 (41%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPPPPP P PPPP PP P P PPPP P Sbjct: 223 PPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 283 PPPPPPPPPPPPPPPPPP 300 Score = 70.1 bits (164), Expect = 7e-11 Identities = 32/73 (43%), Positives = 32/73 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPS------PPPPPPPPPPPPPPPP 292 Query: 749 PXPXAGPPXPAAP 787 P P PP P P Sbjct: 293 PPPPPPPPPPVYP 305 Score = 68.5 bits (160), Expect = 2e-10 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PPP P PPPP PP P P PPPPP P Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P P Sbjct: 288 PPPPPPPPPPPPPPPVYP 305 Score = 61.3 bits (142), Expect = 3e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Query: 420 PP 415 PP Sbjct: 298 PP 299 Score = 61.3 bits (142), Expect = 3e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Query: 420 PP 415 PP Sbjct: 299 PP 300 Score = 61.3 bits (142), Expect = 3e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PPPPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Query: 420 PP 415 PP Sbjct: 301 PP 302 Score = 59.7 bits (138), Expect = 9e-08 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P PPPP PP P P PPP P PP P PP P P PP Sbjct: 215 PNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 58.8 bits (136), Expect = 2e-07 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PP P P P PPPP PP P P PPPP PP P PP P P P Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 58.0 bits (134), Expect = 3e-07 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PPPPP P P PPPPPP P P PPPPP Sbjct: 223 PPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Query: 420 PP 415 PP Sbjct: 283 PP 284 Score = 58.0 bits (134), Expect = 3e-07 Identities = 25/62 (40%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP + PPPPP P P PPPPPP P P PPPPP Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Query: 420 PP 415 PP Sbjct: 296 PP 297 Score = 55.6 bits (128), Expect = 2e-06 Identities = 24/58 (41%), Positives = 25/58 (43%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P P P PP PP P +P PPPP PP P PP P P PP Sbjct: 211 PLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPP 268 Score = 51.2 bits (117), Expect = 3e-05 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPPP Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Query: 421 PPP 413 PPP Sbjct: 300 PPP 302 Score = 48.0 bits (109), Expect = 3e-04 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP PPPPP P P PPPPP PPPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Query: 421 PPP 413 PPP Sbjct: 294 PPP 296 Score = 48.0 bits (109), Expect = 3e-04 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPPPP P PPP PP PP P Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP P P PPPPPP P P PPPPPP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPP 258 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PP PPP P PPP PP PP P Sbjct: 223 PPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPP 278 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + P PPPPPP P PPP PP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPPPP P PPP PP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 44.4 bits (100), Expect = 0.004 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP P P PPPPP P P PP PPPP Sbjct: 215 PNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPP 256 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPPPP P PPP PP PP P Sbjct: 219 PSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPP 274 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P + P PPPPPP P PPP PP PP P Sbjct: 231 PPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP P PP P Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PP PP PP P Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP PPPPPPP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPP------PPPPPPP 301 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPPP P P PPPPP PPPPPPP Sbjct: 225 SPPPPPPPS-------PPPSPPPPPPPPPPSPPPSPPPPPPPP 260 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPP PP P PPP PP PP P Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P P P PP PP P Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPPPP P PPP P Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 40.7 bits (91), Expect = 0.046 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP 433 PPPPP P P PPPPPP P P P Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVYP 305 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPPP PPPPPPP Sbjct: 226 PPPPPPPSPPPSPPPPP-----PPPPPSPPPSPPPPPPPPPP 262 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P P PPPPP PPPPPPP Sbjct: 224 PSPPPPPPPSPPPSPPPP-----PPPPPPSPPPSPPPPPPPPP 261 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T P P P P PP PPP P P PPP PP Sbjct: 209 TLPLPLPNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPP 254 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PP P P PPPPP P PP PP PP P Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPP PP PP P Sbjct: 215 PNAPPSPLPPSPPPPPPPSPPPSPPPPPPPPPPSPP 250 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 72.5 bits (170), Expect = 1e-11 Identities = 31/78 (39%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P P PPPP P PPPP PP P P PPPP P Sbjct: 28 PPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSP 87 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 88 PSPPPSPPPPSPPPPSPP 105 Score = 65.3 bits (152), Expect = 2e-09 Identities = 30/78 (38%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PP PPP P PPPP PP P +P + PPP P P Sbjct: 50 PPPSPPPSPPPPLPPPSPSPPSPPP---PSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPP 106 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P +P PP Sbjct: 107 PSPPPPSPPPPSPPPSPP 124 Score = 64.5 bits (150), Expect = 3e-09 Identities = 32/80 (40%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PP 742 PPP P PPPP PP P PPPP PP P +P + PPP PP Sbjct: 63 PPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPP 120 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 121 PSPPPSPSPPSPPPPSPPPP 140 Score = 61.7 bits (143), Expect = 2e-08 Identities = 32/88 (36%), Positives = 34/88 (38%), Gaps = 5/88 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-----PPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP P PPPP P P P P PP P +P + PP Sbjct: 163 PPPPPPPWWQAPSAS----PSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPP 218 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP PP P PP P P P G Sbjct: 219 PPPPPPPPPPSPPSPNPPPSASPSPPFG 246 Score = 61.3 bits (142), Expect = 3e-08 Identities = 29/70 (41%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +2 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-PPPXPPXPXAGPP 772 GG PPP PP P PPPP PP P +P + PP PPP P P PP Sbjct: 13 GGAYATPPSPPPPSPPP--PSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPP 70 Query: 773 XPAAPXXXPP 802 P P PP Sbjct: 71 SPPPPSPPPP 80 Score = 61.3 bits (142), Expect = 3e-08 Identities = 28/78 (35%), Positives = 31/78 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPPP P PPPP PP P +P + PPP P P Sbjct: 52 PSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPP 111 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P+ P P Sbjct: 112 PSPPPPSPPPSPPPSPSP 129 Score = 59.7 bits (138), Expect = 9e-08 Identities = 30/83 (36%), Positives = 31/83 (37%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP PPPPP P PPP P P P A P Sbjct: 146 PPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPS 205 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P + PP P P PP Sbjct: 206 PPPPSPPPPSPPPPPPPPPPPPP 228 Score = 59.3 bits (137), Expect = 1e-07 Identities = 28/79 (35%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPX-APXXXAXPPPPPX 745 PP PP PPPP P PPPP PP P +P + PPP P Sbjct: 79 PPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPP 138 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP PP P P P Sbjct: 139 PPSISPSPPPPPPPWWQAP 157 Score = 58.0 bits (134), Expect = 3e-07 Identities = 26/65 (40%), Positives = 27/65 (41%) Frame = +2 Query: 608 CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 C PP PP P PP P PP P P P PPP PP P PP P+ P Sbjct: 12 CGGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLP-PPSPSPP 70 Query: 788 XXXPP 802 PP Sbjct: 71 SPPPP 75 Score = 56.8 bits (131), Expect = 7e-07 Identities = 26/66 (39%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = +2 Query: 569 PPPP---PXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPP P PPPPPP P PP P PP P + PPPP Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPP 256 Query: 740 PXPPXP 757 P PP P Sbjct: 257 PPPPPP 262 Score = 56.0 bits (129), Expect = 1e-06 Identities = 25/59 (42%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-PPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPP PP P +P PP PPP P P PP P P PP Sbjct: 27 PPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPP 85 Score = 54.4 bits (125), Expect = 4e-06 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPP PP P P PP P P P P PPP P Sbjct: 91 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPP 150 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P +P PP Sbjct: 151 PPWWQAPSASPSPPPPPP 168 Score = 54.4 bits (125), Expect = 4e-06 Identities = 29/78 (37%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP P PPPP P PPP P PP P P + PPPP P Sbjct: 94 PPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPP--PPSISPSPPPPPP 151 Query: 749 PXPXAGPPXPAAPXXXPP 802 P A P+ P PP Sbjct: 152 PWWQAPSASPSPPPPPPP 169 Score = 52.4 bits (120), Expect = 1e-05 Identities = 32/116 (27%), Positives = 32/116 (27%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPP P P P PPP PP P P PPPP PP P Sbjct: 23 PPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSP 82 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPPP P P P P P P Sbjct: 83 P-----PPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPP 133 Score = 52.4 bits (120), Expect = 1e-05 Identities = 36/138 (26%), Positives = 36/138 (26%), Gaps = 2/138 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXPPP 427 PPPP PPP P P P PPP PPP P P PPP Sbjct: 58 PPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPP 117 Query: 426 PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 PPP PP P PPPP Sbjct: 118 SPPPSPPPSPSPPSPPPPSPPPPSI-----SPSPPPPPPPWWQAPSASPSPPPPPPPWWQ 172 Query: 246 XPPRXPXTPXXPGGPGXP 193 P P P P P Sbjct: 173 APSASPSPPPPSISPSPP 190 Score = 52.0 bits (119), Expect = 2e-05 Identities = 34/136 (25%), Positives = 36/136 (26%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PP PP P P PPP PP P PPPPP Sbjct: 91 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPP 150 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP ++ P PP P Sbjct: 151 PP---WWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPP 207 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P P Sbjct: 208 PPSPPPPSPPPPPPPP 223 Score = 51.2 bits (117), Expect = 3e-05 Identities = 34/115 (29%), Positives = 35/115 (30%), Gaps = 2/115 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP-PPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 PP PP P P PPP PPP P P PP PPPP Sbjct: 19 PPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPP 78 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPP-PPXXXXPPRXPXTPXXPGGP 202 PP P P PP PP PP P +P P P Sbjct: 79 PPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPP 133 Score = 50.8 bits (116), Expect = 4e-05 Identities = 31/87 (35%), Positives = 32/87 (36%), Gaps = 9/87 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP--- 739 PP PP P PPPP P PPPP PP P A PPPP Sbjct: 116 PPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQA---PSASPSPPPPPPPWWQ 172 Query: 740 -----PXPPXPXAGPPXPA-APXXXPP 802 P PP P P P+ A PP Sbjct: 173 APSASPSPPPPSISPSPPSSASPTPPP 199 Score = 48.8 bits (111), Expect = 2e-04 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + P PPP P P PPPPPP P P PP P Sbjct: 180 PPPPSISPS-----PPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPN 234 Query: 420 PP 415 PP Sbjct: 235 PP 236 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 5/59 (8%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-----PXPPXPXAGPPXPAAP 787 PPP PP P PPPP PP P A P PP PP P PP P P Sbjct: 207 PPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPGLP 265 Score = 48.4 bits (110), Expect = 2e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP P P PP PPP P PPPP Sbjct: 27 PPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPS 86 Query: 420 PP 415 PP Sbjct: 87 PP 88 Score = 48.0 bits (109), Expect = 3e-04 Identities = 36/140 (25%), Positives = 36/140 (25%), Gaps = 4/140 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX----PXXPXXP 433 PPPP PP P P P PPPPPP P P Sbjct: 104 PPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSP 163 Query: 432 PPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPX 253 PPPPPP PP P PP P Sbjct: 164 PPPPPPWWQAP------SASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPP 217 Query: 252 XXXPPRXPXTPXXPGGPGXP 193 PP P P P P P Sbjct: 218 -PPPPPPPPPPPSPPSPNPP 236 Score = 47.6 bits (108), Expect = 4e-04 Identities = 26/82 (31%), Positives = 28/82 (34%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 P PP PPPP P PPPP PP P P + PPP P Sbjct: 187 PSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPP-----PPPPPPSPPSPNPPPSASP 241 Query: 752 XPXAGPPXPAAPXXXPPXXGXG 817 P G + P PP G Sbjct: 242 SPPFGRSLRSPPPPPPPPPPPG 263 Score = 47.2 bits (107), Expect = 5e-04 Identities = 27/85 (31%), Positives = 30/85 (35%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP---- 736 PPPP PPPP PP P PP PP +P PPP Sbjct: 114 PPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQA 173 Query: 737 ---PPXPPXPXAGPPXPAAPXXXPP 802 P PP P P P++ PP Sbjct: 174 PSASPSPPPPSISPSPPSSASPTPP 198 Score = 46.4 bits (105), Expect = 0.001 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXA--XPPPPP 742 PPP P PP P P P P PP P P P A P PP Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPP 164 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P P A+P PP Sbjct: 165 PPPPPWWQAP-SASPSPPPP 183 Score = 43.2 bits (97), Expect = 0.009 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX-PXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP + P PPP P P P PPPP P P P PP Sbjct: 32 PPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPP 91 Query: 423 PPP 415 P P Sbjct: 92 PSP 94 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PPP P PPP PP PP P Sbjct: 110 PPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPP 167 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PPP PP PP P Sbjct: 60 PPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 115 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX----PXXP 433 PPPP PPPPP P P P PP P P Sbjct: 197 PPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPP 256 Query: 432 PPPPPP 415 PPPPPP Sbjct: 257 PPPPPP 262 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 528 GGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPP-PPPPXXXPXPPPXXPP 680 GG P PPPP P PP PPPP P PPP PP Sbjct: 13 GGAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPP 64 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPP PPPPP P P P P +P Sbjct: 193 ASPTPPPPSASPSPPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSP 252 Query: 430 PPPPPP 413 PPPPPP Sbjct: 253 PPPPPP 258 Score = 39.5 bits (88), Expect = 0.11 Identities = 30/108 (27%), Positives = 30/108 (27%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXX 337 G P P PPP PP P P PPP PPP PP L Sbjct: 14 GAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPP------PSPPPP---LPP 64 Query: 336 XXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P PP PP P P P P Sbjct: 65 PSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPP 112 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P P PP PP P PP PP PP P Sbjct: 54 PPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPP 110 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PP PP +PPPP PP Sbjct: 73 PPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 115 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PP PP P PP PP PP P Sbjct: 45 PPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPP 100 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPP-PPXXXXXXXTPPPP 422 PPP PPPP P P PPP PP +PPP Sbjct: 63 PPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPS 122 Query: 421 PPP 413 PPP Sbjct: 123 PPP 125 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPP P PPP PP PP P Sbjct: 65 PSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 120 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P P PPP +PP PPPP Sbjct: 33 PPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPP 75 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP P P PP PP +PPPP PP Sbjct: 46 PPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPP 88 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PP PP P P P P P PPP Sbjct: 22 PPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPPS 81 Query: 421 PPP 413 PPP Sbjct: 82 PPP 84 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPP PP P PP PP PP P Sbjct: 72 PPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSP 127 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXP-PPPPXXLXXXXNPPPPPPP 414 +PPPP P P P PPPP +PPPP PP Sbjct: 57 SPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPP 100 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP P P PP PP PP P Sbjct: 95 PPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPP 150 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = -1 Query: 619 GXXAXXP-PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXX 443 G A P PPP PPP P P P PP P Sbjct: 14 GAYATPPSPPPPSPPPPSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPP 73 Query: 442 XXTPPPPPPP 413 +PPPP PP Sbjct: 74 PPSPPPPSPP 83 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP PP PP P P PPP P +PPP Sbjct: 67 PSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPS 126 Query: 421 PPP 413 P P Sbjct: 127 PSP 129 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPP P PPP PP P P Sbjct: 75 PSPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPP 130 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPP P P PP PP PP Sbjct: 100 PPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPP 152 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PP PPPPPPP Sbjct: 219 PPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPP 261 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PP PPP P PP P PP P Sbjct: 97 PSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPP 152 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P P PP PP PP P PP Sbjct: 88 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPP 130 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPP P P P PPPP PPP PP Sbjct: 53 SPPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPP 95 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPP 680 P PP P P PPP PPP P P P PP Sbjct: 92 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPP 133 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP-PPXXXGXXXKXPXPXXXXX---PPPPPPXPXXPXXP 433 PPPP PPP PP P P PPPPPP P P P Sbjct: 206 PPPPSPPPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPPPPGLP 265 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP P PPPP P P PP PP Sbjct: 35 PSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPP 75 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXX---PPPPPXXXXXXXTPPPPPPP 413 PPP P P P PP PP +PP PPPP Sbjct: 90 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXX-----PXPPPXXPPXXGGXXXXXXPP 716 PPPP + P PPPPPP P PPP PP PP Sbjct: 132 PPPPSPP----PPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPP 181 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 72.1 bits (169), Expect = 2e-11 Identities = 36/84 (42%), Positives = 36/84 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPPP PPPP PP G P P PPPPP Sbjct: 610 PPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPG-MPPPPPGMPGMPPPPPG- 667 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P P PP G G Sbjct: 668 -MPGMPPPPPGMPGMPPPPPGMPG 690 Score = 64.5 bits (150), Expect = 3e-09 Identities = 38/102 (37%), Positives = 39/102 (38%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P G G + PPPPP G PPPPPP PG PPP P G Sbjct: 612 PPPPPGMPGMPGMPGMPPPPPPPGMPG---------MPPPPPPPGMPGMPPPPPGMPG-- 660 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P PPPPP P PP P P PP G G Sbjct: 661 MPPPPPGMPGMPPPPPG--MPGMPPPPPGMPGMPPPPPGMPG 700 Score = 64.5 bits (150), Expect = 3e-09 Identities = 36/89 (40%), Positives = 36/89 (40%), Gaps = 5/89 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP-PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP- 742 PPPPP G G P PPPP PG PPP P G P P PPPPP Sbjct: 640 PPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPG--MPPPPPGMPGMPPPPPG 697 Query: 743 ---XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P PP P P PP G G Sbjct: 698 MPGMPGMPGMPPPPPGMPGMPPPPPGMPG 726 Score = 62.9 bits (146), Expect = 1e-08 Identities = 45/141 (31%), Positives = 45/141 (31%), Gaps = 5/141 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP--- 430 PPPP G G PPPPP G P P PPPPP P P PP Sbjct: 610 PPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMP 669 Query: 429 --PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPP 256 PPPPP G G PP PG PPPP Sbjct: 670 GMPPPPPGMPGMPPPPPGMPGMPPPP------------------PGMPGMPGMPGMPPPP 711 Query: 255 XXXXPPRXPXTPXXPGGPGXP 193 P P P PG P P Sbjct: 712 -PGMPGMPPPPPGMPGMPPPP 731 Score = 62.5 bits (145), Expect = 1e-08 Identities = 34/89 (38%), Positives = 34/89 (38%), Gaps = 5/89 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX-----PGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G PPPPPP PG PPP PP P P Sbjct: 598 PPPPPPPGASSVP------PPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGM 651 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 PPP P P PP P P PP G G Sbjct: 652 PPPPPGMPGMPPPPPGMPGMPPPPPGMPG 680 Score = 60.1 bits (139), Expect = 7e-08 Identities = 38/122 (31%), Positives = 39/122 (31%), Gaps = 6/122 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPX------PXXPXXPPPPPPPXXXXXXXXGXGG 379 PPPPP P P PPPPP P P PPPPPPP Sbjct: 587 PPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPP 646 Query: 378 GGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPG 199 G PP + P P PPP PP P P PG PG Sbjct: 647 GMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPG 706 Query: 198 XP 193 P Sbjct: 707 MP 708 Score = 59.7 bits (138), Expect = 9e-08 Identities = 36/92 (39%), Positives = 36/92 (39%), Gaps = 9/92 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP---- 739 PPPP G PPPPPP PPPP PP G P P PPPP Sbjct: 587 PPPPPPGASSIP------PPPPPPGASSVPPPPPPPGMPGM--PGMPGMPPPPPPPGMPG 638 Query: 740 --PXPP---XPXAGPPXPAAPXXXPPXXGXGG 820 P PP P PP P P PP G G Sbjct: 639 MPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPG 670 Score = 59.7 bits (138), Expect = 9e-08 Identities = 34/86 (39%), Positives = 34/86 (39%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXG-GXXXPXAPXXXAXP-PPPP 742 PPPPP G PPPPP PG PPP P G P P P PPP Sbjct: 652 PPPPPGMPGMPPPPPGMPGMPPPPPG-MPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPP 710 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P PP P P PP G G Sbjct: 711 PPGMPGMPPPPPGMPGMPPPPPGGFG 736 Score = 50.0 bits (114), Expect = 8e-05 Identities = 35/104 (33%), Positives = 35/104 (33%), Gaps = 5/104 (4%) Frame = -2 Query: 711 GAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPP 532 GA PP G P G G PPPP G G PPP Sbjct: 593 GASSIPPPPPPPG-ASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPG---------MPPP 642 Query: 531 PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP-----PPPPP 415 PP P P PPPPP P P PP PPPPP Sbjct: 643 PPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 686 Score = 48.8 bits (111), Expect = 2e-04 Identities = 46/162 (28%), Positives = 46/162 (28%), Gaps = 3/162 (1%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 APP P G A G G G PP G G P Sbjct: 586 APPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPP 645 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 G G PPPP G PPPPP G P P PPPP Sbjct: 646 PGMPG--------MPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPP--PPPGMPGMPPPP 695 Query: 462 PPXPXXPXX---PPPPPPPXXXXXXXXGXGGGGXXXPPXFFF 346 P P P PPPPP G G P F F Sbjct: 696 PGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGGFGF 737 Score = 43.6 bits (98), Expect = 0.007 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 5/80 (6%) Frame = -1 Query: 637 GGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPP 458 G G G PPPP G P PP G P P PPPPP Sbjct: 617 GMPGMPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPP 676 Query: 457 XXXXXXXTPP-----PPPPP 413 PP PPPPP Sbjct: 677 GMPGMPPPPPGMPGMPPPPP 696 Score = 43.6 bits (98), Expect = 0.007 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP-PXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPP P PPP P G PPG P Sbjct: 659 PGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMP 715 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 5/54 (9%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP-----PXXXXXXXTPPPPPPP 413 G PPPPP P P PPPP P PPPPPPP Sbjct: 581 GTSSLAPPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPP 634 Score = 39.9 bits (89), Expect = 0.081 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP-PXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPP P P PP G PPG P Sbjct: 669 PGMPPPPPGMPGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMP 725 Score = 38.3 bits (85), Expect = 0.25 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP-----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G PP PPPP PG PP PP G P AP Sbjct: 692 PPPPPGMPGMPGMPGMPPPPPGMPGMPPPPPGMPGMPP--PPPGGFGFRPAAPVINGLVD 749 Query: 734 PPPXP 748 P P Sbjct: 750 TLPKP 754 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +3 Query: 579 PXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P G + P PPPPP PPP PP PPG P Sbjct: 574 PKGVSVSGTSSLAP---PPPPPGASSIPPPPPPPGASSVPPPPPPPGMP 619 Score = 35.1 bits (77), Expect = 2.3 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 4/49 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP--PXXXPXPP--PXXPPXXGG 692 P PPPP G G P PPPPP P P PP P PP G Sbjct: 689 PGMPPPPPGMPGMPG----MPGMPPPPPGMPGMPPPPPGMPGMPPPPPG 733 Score = 33.1 bits (72), Expect = 9.3 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-----PPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP G P P PPPPP PPP PP G PPG Sbjct: 679 PGMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPPGMPGMPPP--PPGMPG--MPPPPPG 733 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 72.1 bits (169), Expect = 2e-11 Identities = 31/63 (49%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAP----XXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPPPPP P PPPP PP GG P P PPPPP PP P GPP P P Sbjct: 418 PPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPG 477 Query: 794 XPP 802 P Sbjct: 478 GGP 480 Score = 67.3 bits (157), Expect = 5e-10 Identities = 36/78 (46%), Positives = 36/78 (46%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G GG PPPPPP GPPPP PP G P PPPPP P Sbjct: 429 PPPPPPPGMGGAP----PPPPPPPPGMGGGPPPPPPPPPGPGGGP--------PPPPPPP 476 Query: 749 PXPXAGPPXPAAPXXXPP 802 GPP P P PP Sbjct: 477 GGGPPGPPPP--PAQLPP 492 Score = 54.4 bits (125), Expect = 4e-06 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAP---XXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 GPPPP PP G P P A PPPPP PP GPP P P PP G G Sbjct: 415 GPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPP---PPGPGGG 468 Score = 54.4 bits (125), Expect = 4e-06 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP P PPPPPP G GGG P Sbjct: 419 PPPPPGGVPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPP-----PPPGPGGGPPPPP 473 Query: 360 P 358 P Sbjct: 474 P 474 Score = 54.0 bits (124), Expect = 5e-06 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G GG PPPP G P P PPPPP P P PPP Sbjct: 430 PPPPPPGMGGAPPPPP----PPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPP 485 Query: 420 PP 415 PP Sbjct: 486 PP 487 Score = 51.6 bits (118), Expect = 2e-05 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP GGG P PPPPPP PPP PP GG PP Sbjct: 441 PPPPPPPPPGMGGG------PPPPPPPPPGPGGGPPPPPPPPGGGPPGPPPPP 487 Score = 49.2 bits (112), Expect = 1e-04 Identities = 36/106 (33%), Positives = 36/106 (33%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP P P PPPPPP P PPPPPPP G GGG PP Sbjct: 416 PPPP---------PPPPGGVPPPPPPPPPGMGGAPPPPPPPPP------GMGGGPPPPPP 460 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTP 220 PG PPPP PP P P Sbjct: 461 P-------------------PPGPGGGPPPPPPPPGGGPPGPPPPP 487 Score = 49.2 bits (112), Expect = 1e-04 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 2/83 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-PP-PPPXPXXPXXPPP 427 PPPP GG PPPPP G P P PP PPP P P PP Sbjct: 418 PPPPPPGG-------VPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPP 470 Query: 426 PPPPXXXXXXXXGXGGGGXXXPP 358 PPPP G G G PP Sbjct: 471 PPPP------PPGGGPPGPPPPP 487 Score = 49.2 bits (112), Expect = 1e-04 Identities = 24/64 (37%), Positives = 25/64 (39%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G GG PPPP G P P PPPPP PPP Sbjct: 429 PPPPPPPGMGG---APPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPP 485 Query: 421 PPPE 410 PP + Sbjct: 486 PPAQ 489 Score = 48.8 bits (111), Expect = 2e-04 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 1/88 (1%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP GG P G GG PPPP G GGG PPPPP G Sbjct: 420 PPPPGGVPPPPPPPPPGMGGA------PPPPPPPPPGMGGGPPPP-----PPPPPGPGGG 468 Query: 510 XXKXPXPXXXXXP-PPPPPXPXXPXXPP 430 P P P PPPPP P P Sbjct: 469 PPPPPPPPGGGPPGPPPPPAQLPPGFAP 496 Score = 48.4 bits (110), Expect = 2e-04 Identities = 36/101 (35%), Positives = 36/101 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP PPPPPPP G GGG P Sbjct: 416 PPPPP---------PPPGGVPPPPPPPPPGMGGAPPPPPPPP-------PGMGGGPPPPP 459 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP 238 P P PG G PPPP PP Sbjct: 460 P------PPPGPGGGPPPPPPPPGGGPPG--PPPPPAQLPP 492 Score = 48.0 bits (109), Expect = 3e-04 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP GG A P PPPP P PPP PP GG PP Sbjct: 427 PPPPPPPPPGMGG----APPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPP 475 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPP--XXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP GG P PPPPPP P PPP PP GG PP Sbjct: 416 PPPPPPPPGG-----VPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPP 461 Score = 42.3 bits (95), Expect = 0.015 Identities = 25/55 (45%), Positives = 25/55 (45%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P G GGG P PPPP GGG P PPPPP P PPP PP Sbjct: 446 PPPPGMGGG-----PPPPPPPPPGPGGG------PPPPPPPPGGGPPGPPP--PP 487 Score = 37.5 bits (83), Expect = 0.43 Identities = 35/103 (33%), Positives = 35/103 (33%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG PPPP P G GG G GGG P G GG Sbjct: 424 GGVPPPPPPPPP--------GMGGAPPPPPPPPPGMGGGPPPPP--------PPPPGPGG 467 Query: 539 GXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP 667 G PPPPP GGG PPPPP PG P Sbjct: 468 G--------PPPPPPPPGGG------PPGPPPPPAQLPPGFAP 496 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 72.1 bits (169), Expect = 2e-11 Identities = 38/87 (43%), Positives = 38/87 (43%), Gaps = 3/87 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G PPPPPP G PPPP PP GG P P PPPP Sbjct: 588 PPPPPPPGAS------LVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPP 641 Query: 740 PXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P PP P AP PP G G Sbjct: 642 PGVP---GIPPPPGAPGLPPPPPGVPG 665 Score = 69.3 bits (162), Expect = 1e-10 Identities = 36/87 (41%), Positives = 36/87 (41%), Gaps = 6/87 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP---- 736 PPPPP G G PPPPPP G PP PP G P P PPP Sbjct: 601 PPPPPPPGAAGLV------PPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAP 654 Query: 737 --PPXPPXPXAGPPXPAAPXXXPPXXG 811 PP PP PP P AP PP G Sbjct: 655 GLPPPPPGVPGIPPPPGAPGLPPPPPG 681 Score = 64.5 bits (150), Expect = 3e-09 Identities = 43/136 (31%), Positives = 43/136 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP G P PPPPPP P PPPP Sbjct: 550 PPPPPPGAS------LVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPPPP 603 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP G G PP P P G PPP P Sbjct: 604 PP------PPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAPGLP 657 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P PG P Sbjct: 658 PPPPGVPGIPPPPGAP 673 Score = 64.1 bits (149), Expect = 4e-09 Identities = 37/95 (38%), Positives = 37/95 (38%), Gaps = 12/95 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP----PPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXX 721 PPPPP G G PPPPP PG PPPP PP G P P Sbjct: 562 PPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPP 621 Query: 722 AX---PPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPPPP PP PP P P PP G Sbjct: 622 GAGGIPPPPP-PPGAGIPPPPPGVPGIPPPPGAPG 655 Score = 61.3 bits (142), Expect = 3e-08 Identities = 37/95 (38%), Positives = 37/95 (38%), Gaps = 11/95 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPPP PPPP PP P P A PPP P Sbjct: 538 PPPPPPPG-------LVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPP 590 Query: 749 PXPXAG-------PPXPAA----PXXXPPXXGXGG 820 P P PP P A P PP G GG Sbjct: 591 PPPPGASLVPPPPPPPPGAAGLVPPPPPPPPGAGG 625 Score = 58.4 bits (135), Expect = 2e-07 Identities = 38/123 (30%), Positives = 38/123 (30%), Gaps = 3/123 (2%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP---PXXXXXXXXGXG 382 T PPPPP P P PPPPPP P P P PPP Sbjct: 535 TAPPPPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPP 594 Query: 381 GGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 G PP P PG PPPP PP P P P P Sbjct: 595 GASLVPPPP---PPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPP 651 Query: 201 GXP 193 G P Sbjct: 652 GAP 654 Score = 58.0 bits (134), Expect = 3e-07 Identities = 35/93 (37%), Positives = 36/93 (38%), Gaps = 8/93 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX---AXPPPP 739 PPPPP G PPPPPP PG P PP G P P + PPP Sbjct: 549 PPPPPPPGAS------LVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPPP 602 Query: 740 PXPPXPXAG-----PPXPAAPXXXPPXXGXGGA 823 P PP AG PP P PP GA Sbjct: 603 PPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGA 635 Score = 54.4 bits (125), Expect = 4e-06 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP--PPXPXXPXXPPP 427 PPPP G G PPPPP G P P PPPP P P P P Sbjct: 602 PPPPPPGAAG-----LVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAPGL 656 Query: 426 PPPPXXXXXXXXGXGGGGXXXPP 358 PPPP G G PP Sbjct: 657 PPPPPGVPGIPPPPGAPGLPPPP 679 Score = 52.8 bits (121), Expect = 1e-05 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP-XPXAGP-PXPAAPXXXPP 802 PPPP PPPP PP P P PPPPP PP P P P P A PP Sbjct: 529 PPPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPP 587 Score = 52.8 bits (121), Expect = 1e-05 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 7/79 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-----PPXXGGXXXPXAPXXXAXPP 733 PPPPP G GG PPPPPP PPPP PP P P PP Sbjct: 615 PPPPPPPGAGGIP------PPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPP 668 Query: 734 PP--PXPPXPXAGPPXPAA 784 PP P P P G AA Sbjct: 669 PPGAPGLPPPPPGMRRNAA 687 Score = 51.2 bits (117), Expect = 3e-05 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP PPPP PP P A PPPPP P PP AA PP Sbjct: 537 PPPPPPPPGLVPPPPPPP-------PGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPP 588 Score = 50.0 bits (114), Expect = 8e-05 Identities = 27/66 (40%), Positives = 27/66 (40%), Gaps = 6/66 (9%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP------PPXPXXPX 439 PPPP GG PPPPP G P P PPPP PP P P Sbjct: 618 PPPPGAGGIPPPPPPPGAGIPPPPPGVPGI---PPPPGAPGLPPPPPGVPGIPPPPGAPG 674 Query: 438 XPPPPP 421 PPPPP Sbjct: 675 LPPPPP 680 Score = 48.8 bits (111), Expect = 2e-04 Identities = 27/66 (40%), Positives = 28/66 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP P PPPP P G P P PPPP P + PP A PP Sbjct: 539 PPPPPPGLVPPPPPPPP---GASLVPPPP-----PPPPGAPGLVPSPPPGAAGLVPPPPP 590 Query: 806 XGXGGA 823 GA Sbjct: 591 PPPPGA 596 Score = 42.3 bits (95), Expect = 0.015 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G PPPPP G P P PPPP Sbjct: 580 GAAGLVPPPPPPPPPGA---SLVPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAG 636 Query: 439 XTPPPPPPP 413 PPPP P Sbjct: 637 IPPPPPGVP 645 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXP---PPPPXXXXXXXTPP 428 PPP PPPPP G P P P P PP PP Sbjct: 529 PPPPSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPP 588 Query: 427 PPPPP 413 PPPPP Sbjct: 589 PPPPP 593 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP G P PPPPPP PPP PP PP P Sbjct: 571 PGLVPSPPP-----GAAGLVPPPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPPPP 621 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPP 458 A PPPP G G PPPPP G P P PPPPP Sbjct: 635 AGIPPPPPGVPGIPPPPGAPGL-PPPPPGVPG----IPPPPGAPGLPPPPP 680 Score = 33.9 bits (74), Expect = 5.3 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 8/64 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP--------PPXXPPXXGGXXXXXXP 713 P PPPP G P PPP P P P PP PP G P Sbjct: 544 PGLVPPPPPPPPGASL-VPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPPPPPGASLVPPP 602 Query: 714 PGXP 725 P P Sbjct: 603 PPPP 606 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 71.7 bits (168), Expect = 2e-11 Identities = 38/86 (44%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX--AXPPPPP 742 PPPPP G PPPPPP PGPPPP PP G P P A PPPP Sbjct: 180 PPPPPPPGA-----RPGPPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPP 234 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 PP G P P PP G GG Sbjct: 235 PPPSTRLGAPPP------PPPPGAGG 254 Score = 68.1 bits (159), Expect = 3e-10 Identities = 35/89 (39%), Positives = 36/89 (40%), Gaps = 5/89 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP PPPP PP P +P PPPPP P Sbjct: 129 PPPPPLPAA---RFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPP 185 Query: 749 PXPXAGPPXP-----AAPXXXPPXXGXGG 820 P GPP P A P PP GG Sbjct: 186 PGARPGPPPPPPPPGARPGPPPPPPPPGG 214 Score = 66.9 bits (156), Expect = 6e-10 Identities = 39/92 (42%), Positives = 39/92 (42%), Gaps = 11/92 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP--------PPPPPXXXPG-PPPPXPPXXGG--XXXPXAPX 715 PPPPP GG P PPPPP G PPPP PP GG P AP Sbjct: 205 PPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPG 264 Query: 716 XXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPPP PP A PP P P PP G Sbjct: 265 GRLGGPPPPPPPGGRA-PPPPRGPGAPPPPGG 295 Score = 65.3 bits (152), Expect = 2e-09 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP G PP PP P P PPPPP P Sbjct: 143 PPPPPPP----TTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPP 198 Query: 749 PXPXAGPPXPAAPXXXPP 802 P GPP P P P Sbjct: 199 PGARPGPPPPPPPPGGRP 216 Score = 64.1 bits (149), Expect = 4e-09 Identities = 35/83 (42%), Positives = 36/83 (43%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP-----PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G GG PPPPP P P PPPP PP P P PP Sbjct: 30 PPPPPRSGVGGNT---PPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPP-----PP 81 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P + P A PP Sbjct: 82 PPPPPPPPPSAPSSRAFSSAPPP 104 Score = 62.9 bits (146), Expect = 1e-08 Identities = 30/77 (38%), Positives = 30/77 (38%), Gaps = 4/77 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXA----XPPP 736 PPPPP PPPPPP PPPP PP P P A PPP Sbjct: 85 PPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPP 144 Query: 737 PPXPPXPXAGPPXPAAP 787 PP PP P P P Sbjct: 145 PPPPPTTHFNAPPPPPP 161 Score = 61.7 bits (143), Expect = 2e-08 Identities = 32/83 (38%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G PPPPPP G PP P PP +P PP Sbjct: 8 PPPPPLMSFGAQTRTFVPPPPPPPPPPRSGVGGNTPPAPPPPPLRSTVPAISP----PPP 63 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P +G P P P PP Sbjct: 64 PPPPPLKPSSGAPCPPPPPPPPP 86 Score = 61.3 bits (142), Expect = 3e-08 Identities = 46/146 (31%), Positives = 46/146 (31%), Gaps = 14/146 (9%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P P PPPPPP P PPPPP Sbjct: 159 PPPPPITRSGAPPSPPPPPSPPPPP---------PPPGARPGPPPPPPPPGARPGPPPPP 209 Query: 420 PP------XXXXXXXXGXGGGGXXXPPXFFFL-----XXXXXXXXXXXXXXPXPGXXXXG 274 PP G PP L P PG G Sbjct: 210 PPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGGRLGG 269 Query: 273 XXPPPP---XXXXPPRXPXTPXXPGG 205 PPPP PPR P P PGG Sbjct: 270 PPPPPPPGGRAPPPPRGPGAPPPPGG 295 Score = 60.5 bits (140), Expect = 5e-08 Identities = 31/82 (37%), Positives = 33/82 (40%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G C PPPPPP P P P P + PPPPP P Sbjct: 64 PPPPPLKPSSGAPCPPPPPPPPPPPP--PSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPP 121 Query: 749 PXPXAG----PPXPAAPXXXPP 802 P + PP PAA PP Sbjct: 122 PISHSNAPPPPPLPAARFNAPP 143 Score = 60.5 bits (140), Expect = 5e-08 Identities = 35/88 (39%), Positives = 35/88 (39%), Gaps = 5/88 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX---PPPP 739 PPPPP GG P PPP PPPP PP P P A PPPP Sbjct: 206 PPPPPPPGG-----RPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPP 260 Query: 740 PXPPXPXAGPPXPAAP--XXXPPXXGXG 817 P P GPP P P PP G G Sbjct: 261 PAPGGRLGGPPPPPPPGGRAPPPPRGPG 288 Score = 60.1 bits (139), Expect = 7e-08 Identities = 38/115 (33%), Positives = 38/115 (33%), Gaps = 3/115 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP---XXXXXXXXGXGGGGX 370 PPPPP P P PPPPPP P PPPPPPP GG Sbjct: 157 PPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPPPGGRP 216 Query: 369 XXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 PP P P G PPPP R P P PGG Sbjct: 217 SAPP------LPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPGG 265 Score = 59.3 bits (137), Expect = 1e-07 Identities = 35/91 (38%), Positives = 35/91 (38%), Gaps = 7/91 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPPP P PP PP P P PP P Sbjct: 192 PPPPPPPPG----ARPGPPPPPPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPP 247 Query: 749 PXPXAG---PPXPAAP----XXXPPXXGXGG 820 P P AG PP P AP PP GG Sbjct: 248 PPPGAGGRAPPPPPAPGGRLGGPPPPPPPGG 278 Score = 57.6 bits (133), Expect = 4e-07 Identities = 30/79 (37%), Positives = 33/79 (41%), Gaps = 6/79 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG------PPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP PPPPPP P PPPP PP P + + P Sbjct: 46 PPPPPLRS---TVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAP 102 Query: 731 PPPPXPPXPXAGPPXPAAP 787 PPPP PP + PP P P Sbjct: 103 PPPPPPPLLRSVPPPPPPP 121 Score = 57.2 bits (132), Expect = 5e-07 Identities = 40/138 (28%), Positives = 40/138 (28%), Gaps = 2/138 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX-PPPPPPXPXXPXXPPPP 424 PPPP PPPPP P P PPPPP P PPP Sbjct: 85 PPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPP 144 Query: 423 PPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXX 244 PPP PP P P G PPPP Sbjct: 145 PPPPPTTHF---NAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGA 201 Query: 243 PPRXPXTPXXPGG-PGXP 193 P P P PGG P P Sbjct: 202 RPGPPPPPPPPGGRPSAP 219 Score = 55.2 bits (127), Expect = 2e-06 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 5/90 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX-----AXPP 733 PPPPP PPP P PPPP PP P P PP Sbjct: 117 PPPPPPISHSNAP-----PPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPP 171 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PP PP P PP P A PP GA Sbjct: 172 SPPPPPSPPPPPPPPGARPGPPPPPPPPGA 201 Score = 54.8 bits (126), Expect = 3e-06 Identities = 34/91 (37%), Positives = 35/91 (38%), Gaps = 6/91 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP-XXXPGPPPPXPPXXGGXXXPXAPXXXA----XPP 733 PPPPP PPPPPP PPPP P P P PP Sbjct: 102 PPPPPPP----PLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPP 157 Query: 734 PPPXPPXPXAG-PPXPAAPXXXPPXXGXGGA 823 PPP PP +G PP P P PP GA Sbjct: 158 PPPPPPITRSGAPPSPPPPPSPPPPPPPPGA 188 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G GG PPPP P G PPP PP GG P P PPPP Sbjct: 244 PPPPPPPGAGGRA-----PPPPPAPGGRLGGPPPPPP-PGG-RAPPPPRGPGAPPPPGGN 296 Query: 749 PXPXAG 766 P G Sbjct: 297 PSSLIG 302 Score = 52.8 bits (121), Expect = 1e-05 Identities = 30/68 (44%), Positives = 30/68 (44%), Gaps = 6/68 (8%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX------PXXPX 439 PPPP G GG T PPPPP P P PPPPPP P P Sbjct: 30 PPPPPRSGVGGN----TPPAPPPPPLRSTVPAISPPP-----PPPPPPLKPSSGAPCPPP 80 Query: 438 XPPPPPPP 415 PPPPPPP Sbjct: 81 PPPPPPPP 88 Score = 48.8 bits (111), Expect = 2e-04 Identities = 46/179 (25%), Positives = 46/179 (25%), Gaps = 13/179 (7%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXX----GGGGGXXXXXTXXXPPPPP- 526 PP G GG P PPPP G PPPPP Sbjct: 32 PPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPS 91 Query: 525 ------XXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 P P PPPPPP P PPPPP Sbjct: 92 APSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPP----PPP 147 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPG-XXXXGXXPPPPXXXXPPRXPXTPXXPGG-PGXP 193 PP F P PPPP P P P PG PG P Sbjct: 148 PPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPP 206 Score = 48.0 bits (109), Expect = 3e-04 Identities = 24/63 (38%), Positives = 25/63 (39%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP G P P PPPP +PPPP Sbjct: 9 PPPPLMSFGAQTRTFVPPPPPPPPPPRSGVGGNTPPAP-----PPPPLRSTVPAISPPPP 63 Query: 421 PPP 413 PPP Sbjct: 64 PPP 66 Score = 47.6 bits (108), Expect = 4e-04 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP P PPPPP PPPP Sbjct: 65 PPPPLKPSSGAPCPPPPPPPPPPPPP------SAPSSRAFSSAPPPPPPPPLLRSVPPPP 118 Query: 421 PPP 413 PPP Sbjct: 119 PPP 121 Score = 47.6 bits (108), Expect = 4e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPPP P P PP G PP P Sbjct: 156 PPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPGARPGPPPPPPP 211 Score = 47.6 bits (108), Expect = 4e-04 Identities = 35/110 (31%), Positives = 35/110 (31%), Gaps = 5/110 (4%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKX-----PPPPXXGGGGGXXXXXTXXXPPPPP 526 PP GG P GG PPPP G GG PPPPP Sbjct: 209 PPPPGGRPSAPPLPPPGGRASAPPPPPPPSTRLGAPPPPPPPGAGGRA-------PPPPP 261 Query: 525 XXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 G P P PPP P P P PPPP G G G Sbjct: 262 APGGRLGGPPPP-----PPPGGRAPPPPRGPGAPPPPGGNPSSLIGRGRG 306 Score = 46.8 bits (106), Expect = 7e-04 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXP---XXXXXPPPPPXXXXXXXTP 431 PPPP PPPPP P P PPPPP P Sbjct: 83 PPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPLPAARFNAP 142 Query: 430 PPPPPP 413 PPPPPP Sbjct: 143 PPPPPP 148 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 156 PPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPP 198 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P P PPPPP P Sbjct: 155 APPPPPPPPITRSGAPPS-----PPPPP----SPPPPPPPPGARPGPPPPPPPPGARPGP 205 Query: 430 PPPPPP 413 PPPPPP Sbjct: 206 PPPPPP 211 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGX 695 P G P PPPP G A PPPPPP P PPP PP G Sbjct: 162 PPITRSGAPPSPPPPPSPPPPPPPPG-----ARPGPPPPPPPPGARPGPPPPPPPPGGRP 216 Query: 696 XXXXXPP 716 PP Sbjct: 217 SAPPLPP 223 Score = 45.2 bits (102), Expect = 0.002 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 2/74 (2%) Frame = -1 Query: 628 GXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP--PX 455 G G PPPP PPPPP P P PPPP P Sbjct: 37 GVGGNTPPAPPPPPLRSTVPAIS--PPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPS 94 Query: 454 XXXXXXTPPPPPPP 413 PPPPPPP Sbjct: 95 SRAFSSAPPPPPPP 108 Score = 44.0 bits (99), Expect = 0.005 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP-----PXXXPXPPPXXPPXXGGXXXXXXPPGX 722 P PPPP G GG P PPPPP P P PPP PP PP Sbjct: 26 PPPPPPPPPRSGVGG---NTPPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPP 82 Query: 723 P 725 P Sbjct: 83 P 83 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXP--XXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 118 PPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPP 162 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P PPPPP L PPPPPPP Sbjct: 83 PPPPPPPPSAPSSRAFSSAPPPPPPPP--LLRSVPPPPPPPP 122 Score = 43.2 bits (97), Expect = 0.009 Identities = 35/117 (29%), Positives = 35/117 (29%), Gaps = 5/117 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX-----PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PPPPP P P PPPPPP P PP PPP G Sbjct: 129 PPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGA 188 Query: 375 GXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 PP P PG PPPP P P P PGG Sbjct: 189 RPGPPP-----------------PPPPPGARPGPPPPPPPPGGRPSAPPLPP--PGG 226 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGX 695 P G P PPPP PPPPPP PPP PP Sbjct: 67 PPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHS 126 Query: 696 XXXXXPP 716 PP Sbjct: 127 NAPPPPP 133 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPP G + P P PPPP + P PPPPP Sbjct: 9 PPPPLMSFGAQTRTFVPPPPPPPPPPRSGVGGNTPPAPPPPP 50 Score = 41.9 bits (94), Expect = 0.020 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT---- 434 PPPP G G G PPPPP P P PPPPP Sbjct: 29 PPPPPPRSGVG---GNTPPAPPPPPLRSTVPAISPPPP-----PPPPPLKPSSGAPCPPP 80 Query: 433 PPPPPPP 413 PPPPPPP Sbjct: 81 PPPPPPP 87 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP + P PPPPP N PP PPP Sbjct: 7 PPPPPPLMSFGAQTRTFVPPPPPPPPPPRSGVGGNTPPAPPP 48 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 8/61 (13%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--------XPPPXXPPXXGGXXXXXXP 713 P PPPP G P PPPPPP P PPP PP P Sbjct: 61 PPPPPPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPP 120 Query: 714 P 716 P Sbjct: 121 P 121 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPPP A PPPPPP PP PP PP Sbjct: 74 GAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPP 133 Query: 720 XP 725 P Sbjct: 134 LP 135 Score = 39.5 bits (88), Expect = 0.11 Identities = 26/101 (25%), Positives = 28/101 (27%), Gaps = 7/101 (6%) Frame = -2 Query: 474 PPPPPPXPXXPXX-------PPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXX 316 PPPPPP P PPPPPPP G PP + Sbjct: 5 PPPPPPPPLMSFGAQTRTFVPPPPPPPPPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPP 64 Query: 315 XXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PPPP PP P + P P Sbjct: 65 PPPPLKPSSGAPCPPPPPPPPPPPPPSAPSSRAFSSAPPPP 105 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXP-PG 719 P P P GG + P PPPPP PPP PP GG P PG Sbjct: 212 PGGRPSAPPLPPPGGRASAPP--PPPPPSTRLGAPPPPPPPGAGGRAPPPPPAPG 264 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPPP PP PP PP P Sbjct: 5 PPPPPPPPLMSFGAQTRTFVPPPPPPPPPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPP 64 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP-----XXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP P PP PPP P PPP P G PPG Sbjct: 142 PPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPPPG 200 Score = 36.7 bits (81), Expect = 0.75 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPP 680 P G GG P PPPP A P PPPPPP P PPP PP Sbjct: 32 PPPRSGVGGNT---PPAPPPPPLR---STVPAISPPPPPPPPPLKPSSGAPCPPPPPPP 84 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PP PPPPPPP Sbjct: 144 PPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPP 186 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPP P P PP P +PPPP Sbjct: 129 PPPPPLPAA---RFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPP---SPPPP 182 Query: 421 PPP 413 PPP Sbjct: 183 PPP 185 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 5/57 (8%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPP-----PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP A P PPP PP P P P PP G PP P Sbjct: 142 PPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPPPPPPP 198 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 9/65 (13%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP----XXPPPPPP-----XXXPXPPPXXPPXXGGXXXXXX 710 P PPPP P PPPPPP P PPP P G Sbjct: 115 PPPPPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAPPSPP 174 Query: 711 PPGXP 725 PP P Sbjct: 175 PPPSP 179 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 70.9 bits (166), Expect = 4e-11 Identities = 33/78 (42%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPXP 748 PPPP PPPPPP P PPPP PP P +P + PPP PP P Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPS--PPPPSPPPPSPPPPSPPPP 240 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 241 PPPSPPPPSPPPPSPPPP 258 Score = 69.7 bits (163), Expect = 9e-11 Identities = 32/80 (40%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPPP PP P PPPP PP P PPPP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPS 236 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P PP P+ P PP Sbjct: 237 PPPPPPPSPPPPSPPPPSPP 256 Score = 68.1 bits (159), Expect = 3e-10 Identities = 27/59 (45%), Positives = 28/59 (47%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP P PPPPP P P PP P+ P PP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPP 233 Score = 67.7 bits (158), Expect = 4e-10 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPP P PP P P PPPPP PP P PP P P PP Sbjct: 176 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPP 235 Score = 66.5 bits (155), Expect = 8e-10 Identities = 31/78 (39%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PPPP PP P P PP PP P Sbjct: 175 PPPPPPPS---------PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 225 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P+ P PP Sbjct: 226 SPPPPSPPPPSPPPPPPP 243 Score = 55.2 bits (127), Expect = 2e-06 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P P PPPP P P PPPPP Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPP 242 Query: 420 P 418 P Sbjct: 243 P 243 Score = 54.0 bits (124), Expect = 5e-06 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PPPPPP P P PPP P Sbjct: 196 PPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Query: 420 PP 415 PP Sbjct: 256 PP 257 Score = 51.6 bits (118), Expect = 2e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPP PP P P PPPPPP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 215 Score = 51.6 bits (118), Expect = 2e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P P PPP PPP Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPP 224 Score = 51.6 bits (118), Expect = 2e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPPPP P P PPP PPP Sbjct: 188 PPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPP 229 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P PPPP PP Sbjct: 177 PPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPP 218 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPPPP P PPPP PP Sbjct: 187 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 228 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP PP P P PPPPPP P P P PPPP Sbjct: 180 PPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPP 220 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P P PPPP P P PPP PPP Sbjct: 193 PPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPP 234 Score = 46.8 bits (106), Expect = 7e-04 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPP + P PPPPPP P PPP PP PP Sbjct: 172 GASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPS 231 Query: 720 XP 725 P Sbjct: 232 PP 233 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/63 (33%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP PPPPP P P PP PP +PPPP Sbjct: 181 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240 Query: 421 PPP 413 PPP Sbjct: 241 PPP 243 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PPP P P P PPPP P P P P PPP Sbjct: 198 PPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 257 Query: 420 P 418 P Sbjct: 258 P 258 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +3 Query: 537 GGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 G P PPPP P PPPPPP P PPP PP Sbjct: 172 GASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 219 Score = 43.6 bits (98), Expect = 0.007 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP PP P PPP PP PP P Sbjct: 181 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP 238 Score = 43.6 bits (98), Expect = 0.007 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 187 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 243 Score = 43.2 bits (97), Expect = 0.009 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 528 PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P G P P PPPP P P P P PPPPP Sbjct: 168 PVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 205 Score = 43.2 bits (97), Expect = 0.009 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PPPPP P PP PP Sbjct: 201 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP----PPPPPSPPPPSPPPPSPP 256 Query: 420 PP 415 PP Sbjct: 257 PP 258 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 R +PPPPP P P PPPP +PPPPPPP Sbjct: 171 RGASPPPPPPPSPPPPPPPSPPP-PSPPPPSPPPPPPPSPPPPPPP 215 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPP PPP P PPP PP PP Sbjct: 205 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 258 Score = 41.1 bits (92), Expect = 0.035 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +2 Query: 677 PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P G P P PPPPP PP P PP P+ P PP Sbjct: 168 PVTRGASPPPPPPPSPPPPPPPSPPPP--SPPPPSPPPPPPP 207 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP PP P PP PP PP P Sbjct: 199 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 255 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +2 Query: 674 PPXXGGXXXPXAPXXXAXPPP----PPXPPXPXAGPPXPAAPXXXPP 802 P G P P PPP PP PP P PP P +P PP Sbjct: 168 PVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 214 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +3 Query: 579 PXXXGGGGXXAXXPXXPPPPPP-XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P G P PPPPPP P PPP PP PP P Sbjct: 168 PVTRGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 217 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPP PP P PP PP PP P Sbjct: 194 PSPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 250 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 70.9 bits (166), Expect = 4e-11 Identities = 37/82 (45%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXG-GGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 P GG G G GG G GG GGGG G G P GG GGGGP GGG Sbjct: 342 PASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGG 401 Query: 633 GGGXXXXXXKXPPPPXXGGGGG 568 GGG PP GGGGG Sbjct: 402 GGGPPGGGGGGPPGSGGGGGGG 423 Score = 69.3 bits (162), Expect = 1e-10 Identities = 35/81 (43%), Positives = 35/81 (43%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 P GG GA G GG G G GGGGG G G PP GG G G G GGGG Sbjct: 365 PEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGG 424 Query: 630 GGXXXXXXKXPPPPXXGGGGG 568 G P GGGGG Sbjct: 425 GPPEGGGGSDGAPGRGGGGGG 445 Score = 64.1 bits (149), Expect = 4e-09 Identities = 33/75 (44%), Positives = 33/75 (44%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP GG G GG G GG GGGGG G G P GG GGGG G G Sbjct: 394 PPGGGGGGGGGPPGGGGGGPPGSGGGGGGGG-GPPEGGGGSDGAPGRGGGGGGGGGPPGG 452 Query: 639 GGGGGXXXXXXKXPP 595 GGGGG PP Sbjct: 453 GGGGGGPPGGGGDPP 467 Score = 62.9 bits (146), Expect = 1e-08 Identities = 34/78 (43%), Positives = 35/78 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG A+G GG G GGGGG G G P GG GGG PG GGGGGG Sbjct: 337 GGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPG--GGGGGGGP 394 Query: 621 XXXXXKXPPPPXXGGGGG 568 P GGGGG Sbjct: 395 PGGGGGGGGGPPGGGGGG 412 Score = 62.1 bits (144), Expect = 2e-08 Identities = 36/85 (42%), Positives = 36/85 (42%), Gaps = 7/85 (8%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGG-------GGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 GG G G GGP G GG GGG G G G PP GG G PG Sbjct: 382 GGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGG 441 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGGG PP GGGGG Sbjct: 442 GGGGGGG---------PPGGGGGGG 457 Score = 58.4 bits (135), Expect = 2e-07 Identities = 43/131 (32%), Positives = 43/131 (32%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGGGGG G G GGGGGG G G P GGGGG PP GGG Sbjct: 345 GGGGGGPPGRGGGGGGGGGPPE--GGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGG 402 Query: 599 GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 G PP GPP GG P P GPP Sbjct: 403 GG----------PPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGG 452 Query: 779 AAPXXXPPXXG 811 PP G Sbjct: 453 GGGGGGPPGGG 463 Score = 57.6 bits (133), Expect = 4e-07 Identities = 37/114 (32%), Positives = 38/114 (33%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G GG + G G GGGGG G G P GG GGG PG GG G Sbjct: 358 GGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSG 417 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 PP GG G P G P P PP P Sbjct: 418 GGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGGGP-PGGGGDPPGVP 470 Score = 56.4 bits (130), Expect = 9e-07 Identities = 49/149 (32%), Positives = 49/149 (32%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G GPPG G G GG GGG PG GG Sbjct: 347 GGGGPPGRGGGGGGGGGPPEGGGGSDGA----PGRGGGGGGPPGGGGGGGGPPGGGGGGG 402 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 PP GGGGGG G G GGGGGG G G P GGGGG Sbjct: 403 GGPP-----------GGGGGGPPGSGGGGGGGGG--PPEGGGGSDGAPGRGGGGGGGGG- 448 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPP 640 PP GGGG PP P Sbjct: 449 -------PPGGGGGGGGPPGGGGDPPGVP 470 Score = 55.2 bits (127), Expect = 2e-06 Identities = 48/144 (33%), Positives = 48/144 (33%), Gaps = 4/144 (2%) Frame = -2 Query: 777 GXGGPAXGX----GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXX 610 G GPA G G GGGG G G PP GG G PG GGGGGG Sbjct: 331 GDNGPAGGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGR--GGGGGG----- 383 Query: 609 XKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PP GGGGG PP G P P PP P Sbjct: 384 ----PPGGGGGGGG------------PPGGGGGGGGGP-PGGGGGGPPGSGGGGGGGGGP 426 Query: 429 PPPPPXXXXXXXXGXGGGGXXXPP 358 P G GGGG PP Sbjct: 427 PEGGGGSDGAPGRGGGGGGGGGPP 450 Score = 50.8 bits (116), Expect = 4e-05 Identities = 40/134 (29%), Positives = 40/134 (29%), Gaps = 7/134 (5%) Frame = +2 Query: 362 GXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGG-------GGGGXXXXXGXGXFXXFPX 520 G PP GGGGGGG G GG GGGG G G P Sbjct: 337 GGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPG 396 Query: 521 XXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXX 700 GGGGG PP GGGG P G P GG Sbjct: 397 GGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGG 456 Query: 701 PXAPXXXAXPPPPP 742 P PP P Sbjct: 457 GGPPGGGGDPPGVP 470 Score = 39.9 bits (89), Expect = 0.081 Identities = 29/99 (29%), Positives = 29/99 (29%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 G P G P GG GG G GGGGG G PP GGG G Sbjct: 363 GPPEGGGGSDGAPGRGGGGGGPPG-GGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGG 421 Query: 544 XPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP 428 PP G P PP PP Sbjct: 422 GGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGGGPP 460 Score = 39.1 bits (87), Expect = 0.14 Identities = 30/94 (31%), Positives = 32/94 (34%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXX 590 + GGGGGG GGGGG G +P GGGGG PP Sbjct: 343 ASGGGGGGPPGRGGGGGGGGGPPEGGGGSD---GAPGRGGGGGG----------PPGGGG 389 Query: 591 GGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 GGGG PP PP GG Sbjct: 390 GGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGG 423 Score = 36.7 bits (81), Expect = 0.75 Identities = 26/94 (27%), Positives = 27/94 (28%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXX 590 +GG G GGGGG G G P GGG PP Sbjct: 329 TGGDNGPAGGRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGG 388 Query: 591 GGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 GGGG PP PP GG Sbjct: 389 GGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGG 422 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 70.5 bits (165), Expect = 5e-11 Identities = 32/81 (39%), Positives = 35/81 (43%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP---P 739 PP PP PPPP P P PPPP P G P +P + PPP P Sbjct: 517 PPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPP 576 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP P + PP P P PP Sbjct: 577 PSPPPPPSPPPSPPPPPSPPP 597 Score = 62.1 bits (144), Expect = 2e-08 Identities = 27/60 (45%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG-PPXPAAPXXXPP 802 P PPPP P PPP PP P +P PPPPP PP A PP P P PP Sbjct: 513 PSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPP 572 Score = 60.9 bits (141), Expect = 4e-08 Identities = 32/78 (41%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PP PPP P PPPP PP P +P PPP P P Sbjct: 547 PPPPPSPPPGSAARPPSPPPPSPPP---PSPPPPSPP------PPPSPPPSPPPPPSPPP 597 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 598 PSPPP-PPVVVVPSSPPP 614 Score = 56.0 bits (129), Expect = 1e-06 Identities = 22/53 (41%), Positives = 25/53 (47%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPP P P PPP PP P +P + P PPP P P PP P +P Sbjct: 501 PPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSP 553 Score = 56.0 bits (129), Expect = 1e-06 Identities = 24/59 (40%), Positives = 26/59 (44%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP P PPP PP P +P + PPP PP P P A P PP Sbjct: 508 PPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPP 566 Score = 55.6 bits (128), Expect = 2e-06 Identities = 27/62 (43%), Positives = 29/62 (46%), Gaps = 4/62 (6%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP----PPPXPPXPXAGPPXPAAPXXX 796 P PPP P PPPP PP P P + PP PPP PP P + PP AA Sbjct: 505 PSPPPSPPPSPPPPSPP-PSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPS 563 Query: 797 PP 802 PP Sbjct: 564 PP 565 Score = 54.8 bits (126), Expect = 3e-06 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP P P PPP PP P +P PP PP PP P PP P PP Sbjct: 496 PPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPP 554 Score = 54.0 bits (124), Expect = 5e-06 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 7/79 (8%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPG-------PPPPXPPXXGGXXXPXAPXXXAXP 730 PPPP PPPPP PG PPPP PP P P + P Sbjct: 528 PPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPS-PPPPSPPPPPSPP 586 Query: 731 PPPPXPPXPXAGPPXPAAP 787 P PP PP P PP P P Sbjct: 587 PSPPPPPSPP--PPSPPPP 603 Score = 54.0 bits (124), Expect = 5e-06 Identities = 25/64 (39%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXPPP 427 PPPP PPPP G + P P PPP PPP P P PPP Sbjct: 528 PPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPP 587 Query: 426 PPPP 415 PPP Sbjct: 588 SPPP 591 Score = 50.8 bits (116), Expect = 4e-05 Identities = 24/62 (38%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G + P PPP P P PPP PP P P P PPP Sbjct: 547 PPPPPSPPPGSAARPPSPPPPSPPPPSP----PPPSPPPPPSPPPSPPPPPSPPPPSPPP 602 Query: 420 PP 415 PP Sbjct: 603 PP 604 Score = 49.6 bits (113), Expect = 1e-04 Identities = 24/59 (40%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P P P PP P +P P PPPP PP P PP P+ P PP Sbjct: 493 PTAPPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPP--PPSPSPPPSPPP 549 Score = 49.2 bits (112), Expect = 1e-04 Identities = 32/116 (27%), Positives = 33/116 (28%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PP P P P PPP PP P P PPP P P G P Sbjct: 502 PPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARP 561 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPPP PP P +P P P P Sbjct: 562 P-------------------SPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPP 598 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPP P P PPPP PP P +P P P Sbjct: 565 PPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPPPVLVNDMYPPP 624 Query: 749 PXPXAG 766 P AG Sbjct: 625 PVMSAG 630 Score = 43.2 bits (97), Expect = 0.009 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A P PPPP P PPP PP PP P Sbjct: 544 PPSPPPPPSPPPGS---AARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPP 596 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP G P PPP P P PPP P P PPP Sbjct: 543 PPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPP 602 Query: 418 PP 413 PP Sbjct: 603 PP 604 Score = 41.5 bits (93), Expect = 0.026 Identities = 28/84 (33%), Positives = 31/84 (36%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP------PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 PP PP PPPP PP P PPP PP P +P + P Sbjct: 550 PPSPPPGSAARPPSPPPPSPPPPSPPPPSPP-PPPSPPPSPPP-------PPSPPPPS-P 600 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P + PP PP Sbjct: 601 PPPPVVVVPSSPPPVLVNDMYPPP 624 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PP P P PPPP P P PPP P G PP Sbjct: 513 PSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPP 565 Score = 39.9 bits (89), Expect = 0.081 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PP P G PPP PP P P PPPP P P P Sbjct: 550 PPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVP 609 Query: 429 PPPPP 415 PPP Sbjct: 610 SSPPP 614 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX----PXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPPP P PPP PP PP P Sbjct: 511 PPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPP 570 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP-PXXGGXXXXXXPPG 719 P PPP + P PP PPP P PPP P P PPG Sbjct: 502 PPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPG 556 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPP-PPPXXLXXXXNPPPPPPP 414 +PPPP P P PP PPP +PPPP PP Sbjct: 527 SPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPP 570 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPP PPP P PP PP PP P Sbjct: 497 PVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSP 553 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P G P PPPP P PPPPP P PP P Sbjct: 551 PSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPP 604 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 6/62 (9%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX------PXPPPXXPPXXGGXXXXXXPPG 719 P PPPP P PPPPP P PPP PP PP Sbjct: 524 PPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPP 583 Query: 720 XP 725 P Sbjct: 584 SP 585 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP + P PPP P P PPP PP PP Sbjct: 561 PPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVVPSSPP 613 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 G P PP P P PPP PP PPP PP Sbjct: 556 GSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPP 602 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP PPPPP P P P PPP PPPP Sbjct: 569 PPPPSPPPPSPPPPPSPPPSPPPPPSPP--PPSPPPPPVVVVPSSPPPVLVNDMYPPPP 625 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPP---PXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 PPP G PPPP P P P PPPP Sbjct: 549 PPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPPPVVVV 608 Query: 430 PPPPPP 413 P PPP Sbjct: 609 PSSPPP 614 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +P PPP P P PPPP +PP PPPP Sbjct: 504 SPSPPPSPPPSPPPPSPPPSPPPSPPPP-------SPPSPPPP 539 >UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP4 protein - Volvox carteri f. nagariensis Length = 1143 Score = 70.1 bits (164), Expect = 7e-11 Identities = 32/79 (40%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-PPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP PPPP P P PPPP PP P +P PPPPP Sbjct: 525 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 584 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P P + PP P P PP Sbjct: 585 PRHPPSPPPRPRPPRPQPP 603 Score = 66.5 bits (155), Expect = 8e-10 Identities = 30/79 (37%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-PPXXGGXXXPXAPXXXAXPPPPPX 745 PPP P P PP P P PPPP PP P +P PPPPP Sbjct: 501 PPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 560 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P + PP P+ P P Sbjct: 561 PPPPPSPPPPPSPPPPPSP 579 Score = 62.9 bits (146), Expect = 1e-08 Identities = 31/79 (39%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-PPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP PPPP P P PPPP PP P +P PPP P Sbjct: 537 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPR 596 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P PP P +P P Sbjct: 597 PPRPQ--PPSPPSPSPPSP 613 Score = 60.9 bits (141), Expect = 4e-08 Identities = 25/59 (42%), Positives = 26/59 (44%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP P PPP PP P P + PPPP PP P PP P PP Sbjct: 522 PPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 580 Score = 50.4 bits (115), Expect = 6e-05 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-PPPPPXPXXPXXPPPP 424 P PP PPPPP P P P PPPPP P P PPPP Sbjct: 523 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPP 582 Query: 423 PPP 415 P P Sbjct: 583 PSP 585 Score = 49.2 bits (112), Expect = 1e-04 Identities = 33/115 (28%), Positives = 34/115 (29%), Gaps = 2/115 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP-PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 PPP P P P P PPPPP P P PPPPP P Sbjct: 501 PPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPS 560 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPR-XPXTPXXPGGP 202 PP P P PP PPR P +P P P Sbjct: 561 PPP----PPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSPPSPSPP 611 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP P PPP P P PPP PP P P PP PP Sbjct: 515 PRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 574 Query: 420 PP 415 PP Sbjct: 575 PP 576 Score = 48.4 bits (110), Expect = 2e-04 Identities = 23/62 (37%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPP-PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP + PP PPP P P PPP PP P P PP P Sbjct: 532 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSP 591 Query: 423 PP 418 PP Sbjct: 592 PP 593 Score = 48.0 bits (109), Expect = 3e-04 Identities = 31/109 (28%), Positives = 32/109 (29%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP + P P PP PP P P PP PPPP PP Sbjct: 500 PPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 559 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXP 211 P P PPPP PP P P P Sbjct: 560 ----------SPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPP 598 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-PPPPPXPXXPXXPPPP 424 P PP PPPPP P P P PPPPP P P PPP Sbjct: 535 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPR 594 Query: 423 PPP 415 P P Sbjct: 595 PRP 597 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T PP P P P PP PPP P P P PPPPP Sbjct: 508 TSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 553 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPP--PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP + PP PPP P P PP PPP P P PP Sbjct: 544 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPP 603 Query: 426 PPP 418 PP Sbjct: 604 SPP 606 Score = 44.0 bits (99), Expect = 0.005 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 6/68 (8%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPP--PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP-- 433 PPPP + PP PPP P P PP PPP P P P Sbjct: 526 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 585 Query: 432 --PPPPPP 415 PP PPP Sbjct: 586 RHPPSPPP 593 Score = 43.2 bits (97), Expect = 0.009 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPP P P P PPPPP P PP P Sbjct: 537 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPR 596 Query: 420 PP 415 PP Sbjct: 597 PP 598 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PP P PPPP P P PPPPP PPPP Sbjct: 512 PPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 571 Query: 421 PPP 413 PP Sbjct: 572 SPP 574 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPPP PPPP PP Sbjct: 538 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 580 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP-PXPXXPXXPPPP 424 P PP PPPPP P P P PPP P P P P PP Sbjct: 547 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSPP 606 Query: 423 PP 418 P Sbjct: 607 SP 608 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPP PP P PPP PP PP Sbjct: 527 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 581 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPP PP P PPP PP PP Sbjct: 539 PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPP 593 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXP-PXPXAGPPXPAAPXXXP 799 PPPP P P + P PPP P P P PP P +P P Sbjct: 500 PPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPP 547 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP P PP PPP P PPP PP PP Sbjct: 523 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 575 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PPPPP P P P PP PP P Sbjct: 525 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 580 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PPPPP P P P PP PP P Sbjct: 537 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPP 592 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP--PPPPXPXXPXXPPP 427 PPPP PPP P P P PP P PP P P P P Sbjct: 549 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSPPSP 608 Query: 426 PPP 418 PP Sbjct: 609 SPP 611 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P + P PPPPP P P P PP PP P Sbjct: 513 PSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 568 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PP PPP P PPP PP PP Sbjct: 522 PPSPPPPPSPP-----PPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 569 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 R +P PP P P PPPPP PPPP PP Sbjct: 511 RPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPP 556 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP PPPPP P P PP P P P P PP Sbjct: 553 PSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPPRPQPPSPPSPSPPS 612 Query: 420 P 418 P Sbjct: 613 P 613 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP PP PP P Sbjct: 518 PRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSP 573 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPPP PP P PP Sbjct: 556 PPPPSPPPPPSPPPPPSPPPPPSPPPPPSPRHPPSPPPRPRPP 598 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P P PP + P PPPPP P P P PP PP Sbjct: 531 PPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPPSPPPPP 583 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PP P P PPPP PPP PPP Sbjct: 510 PRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSPPPPPSPPP 551 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P P PP P P PPP PP PP P Sbjct: 497 PFVPPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPP--PPSPPPPPSPPPPPSPP 550 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXP-PPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPP +PPPPP P Sbjct: 500 PPPPSPLLTSPRPPSPRPPRPSPPSPPPPPSPPPPPSPPPPPSP 543 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 70.1 bits (164), Expect = 7e-11 Identities = 34/88 (38%), Positives = 35/88 (39%), Gaps = 3/88 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX---PPXXGGXXXPXAPXXXAXPPPP 739 PPPPP GG PPPPPP PP PP G P PPPP Sbjct: 609 PPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPP 668 Query: 740 PXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P PP P PP P PP G G + Sbjct: 669 PPPPPPPPPPPPPRMGNGPPPPPGKGAS 696 Score = 60.1 bits (139), Expect = 7e-08 Identities = 39/103 (37%), Positives = 39/103 (37%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P G G PPPPP GG G PPP P PG PPP GG Sbjct: 610 PPPPGYKAGGSASSAPLPPPPPP-PGGSGVSSPPAGLPPPHP----PGLPPP----TGGP 660 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P P PPPPP PP P PP PP G GA Sbjct: 661 KQPPPP-----PPPPPPPPPPPPPPPRMGNGPPPPPGKGASGA 698 Score = 56.8 bits (131), Expect = 7e-07 Identities = 30/83 (36%), Positives = 31/83 (37%), Gaps = 2/83 (2%) Frame = -2 Query: 657 PGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPP--PXXXGXXXKXPXPXX 484 P G GG PPPP GG G P PP P G + P P Sbjct: 609 PPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPP 668 Query: 483 XXXPPPPPPXPXXPXXPPPPPPP 415 PPPPPP P PPPPP Sbjct: 669 PPPPPPPPPPPPPRMGNGPPPPP 691 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/80 (36%), Positives = 29/80 (36%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG G PP PP P PPPPPP P P PPPPP Sbjct: 627 PPPPPPPGGSGVSSPPAGLPPPHPPGLP-----PPTGGPKQPPPPPPPPPPPPPPPPPPP 681 Query: 420 PPXXXXXXXXGXGGGGXXXP 361 G G G P Sbjct: 682 RMGNGPPPPPGKGASGAAAP 701 Score = 56.0 bits (129), Expect = 1e-06 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP---PPPPXPXXPXXPP 430 PPPP G G PPPPP P PP PP P P PP Sbjct: 608 PPPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPP 667 Query: 429 PPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPP G G PP Sbjct: 668 PPPPPPPPPPPPPPRMGNGPPPPP 691 Score = 48.8 bits (111), Expect = 2e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = -1 Query: 640 GGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXX--KXPXXPXXXXXPP 467 G G A PPPP GG G PP PP K P P PP Sbjct: 614 GYKAGGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPP 673 Query: 466 PPPXXXXXXXTPPPPPPP 413 PPP PPPPP Sbjct: 674 PPPPPPPPRMGNGPPPPP 691 Score = 48.4 bits (110), Expect = 2e-04 Identities = 27/76 (35%), Positives = 27/76 (35%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P GG G PP PP G PPPPPP P PPPP PP G Sbjct: 629 PPPPPGGSGVSSPPAGLPPPHPP---GLPPPTGGPKQPPPPPPPPPPPPPPPPPPPRMGN 685 Query: 695 XXPXAPXXXAXPPPPP 742 P P A P Sbjct: 686 GPPPPPGKGASGAAAP 701 Score = 47.6 bits (108), Expect = 4e-04 Identities = 38/126 (30%), Positives = 38/126 (30%), Gaps = 8/126 (6%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXK--XPXPXXXXXPPPPPP------XPXXPXXPPPPPPPXXXXXX 397 T PPPPP P P PPPPPP PPPPPPP Sbjct: 580 TAPPPPPPPASSATAPTAVGPAPPPGLPPPPPPPGYKAGGSASSAPLPPPPPPP------ 633 Query: 396 XXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPX 217 GG G PP P PPPP PPR P Sbjct: 634 ----GGSGVSSPPA-GLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPPRMGNGPP 688 Query: 216 XPGGPG 199 P G G Sbjct: 689 PPPGKG 694 Score = 47.6 bits (108), Expect = 4e-04 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP G P PP P PPPP Sbjct: 607 PPPPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPP 666 Query: 421 PPP 413 PPP Sbjct: 667 PPP 669 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 8/64 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-------PPXXXPXP-PPXXPPXXGGXXXXXXP 713 P PPP GG A P PPPP PP P P PP PP GG P Sbjct: 607 PPPPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPP 666 Query: 714 PGXP 725 P P Sbjct: 667 PPPP 670 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXP--PPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 P PPP PP P A P PPPP PP AG +AP PP G Sbjct: 579 PTAPPPPPPPASSATAPTAVGPAPPPGLPPPPPPPGYKAGGSASSAPLPPPPPPPGG 635 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 2/83 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXP--PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP P PPPP G PPPPPP PP Sbjct: 584 PPPPPASSATAPTAVGPAPPPGLPPPPPPPGYKAGGSASSAPLPPPPPPPGGSGVSSPPA 643 Query: 426 PPPPXXXXXXXXGXGGGGXXXPP 358 PP GG PP Sbjct: 644 GLPPPHPPGLPPPTGGPKQPPPP 666 Score = 35.5 bits (78), Expect = 1.7 Identities = 31/113 (27%), Positives = 31/113 (27%), Gaps = 11/113 (9%) Frame = -2 Query: 498 PXPXXXXXPPPPP----------PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFF 349 P P PPPP P P P PPPPPPP PP Sbjct: 577 PTPTAPPPPPPPASSATAPTAVGPAP-PPGLPPPPPPPGYKAGGSASSAPLPPPPPPPGG 635 Query: 348 FLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG-GPGXP 193 P PPPP PP P P P G G P Sbjct: 636 SGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPPPPPPRMGNGPP 688 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 70.1 bits (164), Expect = 7e-11 Identities = 35/83 (42%), Positives = 35/83 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPPP G PPP PP P P PPPPP P Sbjct: 1037 PPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPP-------PPPPGGFGGPPPPPPP 1089 Query: 749 PXPXAGPPXPAAPXXXPPXXGXG 817 P GPP P P PP G Sbjct: 1090 PGGFGGPPPPPPP---PPGGAFG 1109 Score = 68.5 bits (160), Expect = 2e-10 Identities = 37/88 (42%), Positives = 37/88 (42%), Gaps = 4/88 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX--PGPPPPXPP--XXGGXXXPXAPXXXAXPPP 736 PPPPP G G PPPPPP P PPPP PP GG P P PP Sbjct: 1038 PPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPP 1097 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 PP PP P G P PP GG Sbjct: 1098 PPPPPPP--GGAFGVPPPPPPPGTVIGG 1123 Score = 63.3 bits (147), Expect = 8e-09 Identities = 32/70 (45%), Positives = 32/70 (45%), Gaps = 5/70 (7%) Frame = +2 Query: 626 PPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPX 790 PPPPPP PG PPPP PP P A PPPPP PP P G P P Sbjct: 1018 PPPPPPPAHPGLSGAAPPPPPPPPP-----PPPGAGAAPPPPPPPPPPPPGGLGGPPPPP 1072 Query: 791 XXPPXXGXGG 820 PP G GG Sbjct: 1073 PPPPPGGFGG 1082 Score = 60.5 bits (140), Expect = 5e-08 Identities = 28/65 (43%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXG---XXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPPP G G PPPPP G P P PPPPPP P PP Sbjct: 1038 PPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPP 1097 Query: 429 PPPPP 415 PPPPP Sbjct: 1098 PPPPP 1102 Score = 60.1 bits (139), Expect = 7e-08 Identities = 31/75 (41%), Positives = 31/75 (41%), Gaps = 2/75 (2%) Frame = -2 Query: 633 GGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX 454 G G PPPP GG GG PPPP G P P PPPPPP Sbjct: 1046 GAGAAPPPPPPPPPPPPGGLGGPPPPPP---PPPPGGFGGPPPPPPPPGGFGGPPPPPPP 1102 Query: 453 PXXP--XXPPPPPPP 415 P PPPPPPP Sbjct: 1103 PPGGAFGVPPPPPPP 1117 Score = 59.3 bits (137), Expect = 1e-07 Identities = 32/81 (39%), Positives = 32/81 (39%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP G P P PPPPPP P PPPPP Sbjct: 1018 PPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPP-----PPPPPPPPGGLGGPPPPP 1072 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 PP G GG PP Sbjct: 1073 PP----PPPGGFGGPPPPPPP 1089 Score = 55.6 bits (128), Expect = 2e-06 Identities = 28/65 (43%), Positives = 28/65 (43%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX--PPPPPXXXXXXXTPP 428 PPPP GG G G PPPPP G P P PPPPP PP Sbjct: 1056 PPPPPPPGGLG---GPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPP 1112 Query: 427 PPPPP 413 PPPPP Sbjct: 1113 PPPPP 1117 Score = 54.4 bits (125), Expect = 4e-06 Identities = 27/57 (47%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG-PPXPAAPXXXPPXXGXGG 820 P PPPP PP G P PPPPP PP P AG P P P PP G GG Sbjct: 1016 PPPPPPPPPAHPGLSGAAPP-----PPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGG 1067 Score = 54.4 bits (125), Expect = 4e-06 Identities = 36/111 (32%), Positives = 36/111 (32%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP G P P PPPP P PPPPPPP G GG P Sbjct: 1020 PPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPP------PGGLGGPPPPPP 1073 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG 208 P P PG PPPP P P PG Sbjct: 1074 P------PPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVPPPPPPPG 1118 Score = 53.6 bits (123), Expect = 6e-06 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPPP G G P PPPPPP PPP PP G PP Sbjct: 1028 GLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPP 1087 Query: 720 XP 725 P Sbjct: 1088 PP 1089 Score = 53.6 bits (123), Expect = 6e-06 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G G P PPPPP PPP PP GG PP P Sbjct: 1035 PPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPP 1090 Score = 53.2 bits (122), Expect = 8e-06 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP---XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G G P PPPPPP P PPP PP GG PP P Sbjct: 1017 PPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPP 1075 Score = 53.2 bits (122), Expect = 8e-06 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXG-EXXKXPXXPXXXXXPPPPPXXXXXXXTPPP 425 PPPP G G PPPP G P P PPPPP PPP Sbjct: 1039 PPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPP 1098 Query: 424 PPPP 413 PPPP Sbjct: 1099 PPPP 1102 Score = 50.4 bits (115), Expect = 6e-05 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P P PPPPP P Sbjct: 1014 AAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAP--PPPPPPPPPPPGGLGGPPPP 1071 Query: 430 PPPPPP 413 PPPPPP Sbjct: 1072 PPPPPP 1077 Score = 50.4 bits (115), Expect = 6e-05 Identities = 26/70 (37%), Positives = 26/70 (37%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGX 695 P G G P PPPP GG P PPPPPP PPP PP G Sbjct: 1041 PPPPPGAGAAPPPPPPPPPPPPGGLGG------PPPPPPPPPPGGFGGPPPPPPPPGGFG 1094 Query: 696 XXXXXPPGXP 725 PP P Sbjct: 1095 GPPPPPPPPP 1104 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP PPPPPPP Sbjct: 1018 PPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPPPP 1059 Score = 42.7 bits (96), Expect = 0.011 Identities = 30/94 (31%), Positives = 30/94 (31%), Gaps = 4/94 (4%) Frame = -2 Query: 474 PPPPPPXPXXP----XXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXX 307 PPPPPP P P PPPPPPP G PP Sbjct: 1017 PPPPPPPPAHPGLSGAAPPPPPPPPPPPP----GAGAAPPPPPPPPPPPPGGLGGPPPPP 1072 Query: 306 XXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 P PG PPPP P P PGG Sbjct: 1073 PPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGG 1106 Score = 40.3 bits (90), Expect = 0.061 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P GG GG P PPPP GG P PPPPP PPP PP Sbjct: 1074 PPPPGGFGG-----PPPPPPPPGGFGG------PPPPPPPPPGGAFGVPPPPPPP 1117 Score = 37.5 bits (83), Expect = 0.43 Identities = 33/98 (33%), Positives = 33/98 (33%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P GAA P GG GG PP GG GG P Sbjct: 1037 PPPPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPPP------PPPPPGGFGGPPPPPPPP 1090 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPP 526 GG GG PPPP G G PPPPP Sbjct: 1091 GGFGGPPPP----PPPPPGGAFG-------VPPPPPPP 1117 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 609 AXXPXXPPPPP-----PXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPPPP P PPP PP G PP P Sbjct: 1014 AAPPPPPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPPPPP 1057 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 69.7 bits (163), Expect = 9e-11 Identities = 33/77 (42%), Positives = 33/77 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPPP PPPP PP G P P PPPP Sbjct: 522 PPPPPPPGAGA--------PPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGT 573 Query: 749 PXPXAGPPXPAAPXXXP 799 P P A P PA P Sbjct: 574 PPPPAAAPAPAGGLVKP 590 Score = 66.1 bits (154), Expect = 1e-09 Identities = 34/81 (41%), Positives = 34/81 (41%), Gaps = 4/81 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP G G PPPPPP PPPP PP G P P PPPP P Sbjct: 511 PPAPPLPGAG--------VPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPP 562 Query: 749 ----PXPXAGPPXPAAPXXXP 799 P P AG P P A P Sbjct: 563 PARAPPPPAGTPPPPAAAPAP 583 Score = 64.9 bits (151), Expect = 2e-09 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP G PPP PP G P P PPPPP PP PP P P PP Sbjct: 511 PPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPP 568 Score = 60.1 bits (139), Expect = 7e-08 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P P PPPPPP P PPPPP Sbjct: 502 PPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPP 561 Query: 420 PP 415 PP Sbjct: 562 PP 563 Score = 59.7 bits (138), Expect = 9e-08 Identities = 34/80 (42%), Positives = 34/80 (42%), Gaps = 3/80 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPPP PPPPPP P PPP PP P P PPPPP Sbjct: 98 PPPPPPKSDAPPP--PPARPPPPPPTAPPATPPPPPP---NHPPPPPPKSNDIPPPPPAA 152 Query: 743 -XPPXPXAGPPXPAAPXXXP 799 PP P A P PAAP P Sbjct: 153 IPPPAPPATP--PAAPPKKP 170 Score = 58.4 bits (135), Expect = 2e-07 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 12/74 (16%) Frame = +2 Query: 626 PPPPPPXXXPG------------PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP 769 P PPP PG PPPP PP G P P A PPPPP PP A P Sbjct: 499 PSAPPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPP 558 Query: 770 PXPAAPXXXPPXXG 811 P P PP G Sbjct: 559 PPPPPARAPPPPAG 572 Score = 52.4 bits (120), Expect = 1e-05 Identities = 26/69 (37%), Positives = 26/69 (37%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G PPPPP G P P PPPPP Sbjct: 496 GEAPSAPPPPSAPGVPPAPPLPGAGVPPPPPPP-GAGAPPPPPPPAGGAPPPPPPPPPKG 554 Query: 439 XTPPPPPPP 413 PPPPPPP Sbjct: 555 GAPPPPPPP 563 Score = 50.0 bits (114), Expect = 8e-05 Identities = 30/70 (42%), Positives = 31/70 (44%), Gaps = 11/70 (15%) Frame = +2 Query: 626 PPPPPPXXXPGPP-----PPXPPXXGGXXXPXAPXXXAXPPPP--PXPPXPXAG---PPX 775 P PPP P PP PP PP P AP PPPP P PP P + PP Sbjct: 90 PAAPPPARPPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPPPNHPPPPPPKSNDIPPPP 149 Query: 776 PAA-PXXXPP 802 PAA P PP Sbjct: 150 PAAIPPPAPP 159 Score = 50.0 bits (114), Expect = 8e-05 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP--P 427 PPPP G G PPPPP G P P PPPPP P PP Sbjct: 523 PPPPPPGAGA---------PPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGT 573 Query: 426 PPPP 415 PPPP Sbjct: 574 PPPP 577 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P P PPP PP P A PPPPP P PP P P PP Sbjct: 86 PAPAPAAPPPARPPPPPPKSDAPPPPPA----RPPPPPPTAPPATPPPPPPNHPPPPPP 140 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P PPP P P A PPPPP P P A PP P PP Sbjct: 81 PAEEPPAPAPAAPPPARPPPPPPKSDAPPPPPARPPPPP-PTAPPATPPPPPPNHPPPP 138 Score = 46.0 bits (104), Expect(2) = 2e-05 Identities = 35/121 (28%), Positives = 35/121 (28%), Gaps = 7/121 (5%) Frame = +2 Query: 461 GGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPP---PXXGGGGXXCXXXXXPP 631 GGGGG G PPP P Sbjct: 19 GGGGGLVKPTDDALQALIAKRKANAGKKPANPPPAKPPPKKAAPMDLNAALKARFNKNKA 78 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP--PXPPXPXAGP--PXPAAPXXXP 799 P P P P P PP P P A PPPP P PP P A P P P P P Sbjct: 79 PAPAEEPPAPAPAAPPP--ARPPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPPPNHPP 136 Query: 800 P 802 P Sbjct: 137 P 137 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G G PPPPP G P P PPPPP P Sbjct: 519 AGVPPPPPPPGAGAP--------PPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPP 570 Query: 430 PPPPPP 413 PPP Sbjct: 571 AGTPPP 576 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PP P G P P PPPPP PPPPPPP+ Sbjct: 511 PPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPK 553 Score = 42.7 bits (96), Expect = 0.011 Identities = 34/111 (30%), Positives = 34/111 (30%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP G P P PPPPPP P PPPPPP GG PP Sbjct: 502 PPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAP---PPPPPP----------AGGAPPPPP 548 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 P PPPP PP P GG Sbjct: 549 P------------PPPKGGAPPPPPPPARAPPPPAG-TPPPPAAAPAPAGG 586 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPPPP P P PPPPPP Sbjct: 99 PPPPPKSDA-----PPPPPARPPPPPPTAP--PATPPPPPP 132 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP G PPPPP P P PPPP P P P P Sbjct: 525 PPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGTPPPPAAAPAP 583 Score = 41.5 bits (93), Expect = 0.026 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 6/62 (9%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG----PPXPA--APXXXPPXXGXG 817 G P PP P AP PPP PP P AG PP PA AP PP G Sbjct: 496 GEAPSAPPPPSAPGVPPAPPLPGAGVPPPPPP-PGAGAPPPPPPPAGGAPPPPPPPPPKG 554 Query: 818 GA 823 GA Sbjct: 555 GA 556 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/66 (33%), Positives = 23/66 (34%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G PPPPP + P P PPPP Sbjct: 518 GAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPP------A 571 Query: 439 XTPPPP 422 TPPPP Sbjct: 572 GTPPPP 577 Score = 39.9 bits (89), Expect = 0.081 Identities = 29/108 (26%), Positives = 29/108 (26%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXX 337 G P P PP PP P PPPPPP GG PP Sbjct: 496 GEAPSAPPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPP------- 548 Query: 336 XXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P PPPP PP TP P P Sbjct: 549 -------------PPPPKGGAPPPPPPPARAPPPPAGTPPPPAAAPAP 583 Score = 39.5 bits (88), Expect = 0.11 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP-- 433 + PPPP PPPPP P P PPPP P P Sbjct: 97 RPPPPPPKSDA----PPPPPARPPPPPPTAPPATPPPPPPNHPPPPPPKSNDIPPPPPAA 152 Query: 432 -PPPPPP 415 PPP PP Sbjct: 153 IPPPAPP 159 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXX---XPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXX 686 P G G P PPPP GG P PPPP P PP P Sbjct: 525 PPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPPARAPPPPAGTPPPPAAAPAPA 584 Query: 687 GG 692 GG Sbjct: 585 GG 586 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPP P PP P Sbjct: 108 PPPPPARPPPPPPTAPPATPPPPPPNHP-----PPPPPKSNDIPPPPPAAIPPPAPPATP 162 Query: 420 P 418 P Sbjct: 163 P 163 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP---PPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P P PP G P PPPPP PPP PP GG PP Sbjct: 508 PGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPP 563 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPP PP P PPP PP PP Sbjct: 95 PARPPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPPPNHPPPPPPKSNDIPPP 148 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP---XPXXPXXPP--PPPPP 415 PP P + P P PPPPP P P PP PPPPP Sbjct: 85 PPAPAPAAPPPARPPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPP 131 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 PPPPP P P PPPPP TPPPPPP Sbjct: 98 PPPPPPKSDAPPPPPARP-----PPPPPTAPPA--TPPPPPP 132 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 4/64 (6%) Frame = +3 Query: 513 SPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX----PXPPPXXPP 680 +P G G P PPP GG P PPPPPP P PP PP Sbjct: 513 APPLPGAGVPPPPPPPGAGAPPPPPPPAGGA----PPPPPPPPPKGGAPPPPPPPARAPP 568 Query: 681 XXGG 692 G Sbjct: 569 PPAG 572 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P P PPP P P PPPPPP Sbjct: 79 PAPAEEPPAPAPAAPPPARPPPPPPKSDAPPPPPARPPPPPP 120 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPP PP P PP P Sbjct: 115 PPPPPPTAPPATPPPPPPNHPPPPPPKSNDI---PPPPPAAIPPPAPP-ATPPAAPPKKP 170 Score = 35.1 bits (77), Expect = 2.3 Identities = 28/101 (27%), Positives = 28/101 (27%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXX 325 K P PP P P P PPPPPP PP Sbjct: 75 KNKAPAPAEEPPAPAPAAPPPARPPPPPPKSDAPPPPPA-------RPPPPPPTAPPATP 127 Query: 324 XXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 P P PPPP PP P TP P P Sbjct: 128 PPPPPNHPPPPPPKSNDIPPPPPAAIPPPAPPATP--PAAP 166 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPP G P PPPPP PP PP GG PP Sbjct: 502 PPPPSAPGVPPAPPLPGAGVPPPPPPPGAGAPPPPPPPAGGAPPPPPPP 550 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -3 Query: 542 APPP--PPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPP--PPPP 414 APPP PP P P PPPP PPP PPPP Sbjct: 92 APPPARPPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPPPNHPPPP 138 Score = 34.7 bits (76), Expect = 3.0 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPP Sbjct: 98 PPPPPPKSDAPPPP---PARPPPPPPTAPPATPPPPPPNH---PPPPPPKSNDIPPPPPA 151 Query: 421 --PPP 413 PPP Sbjct: 152 AIPPP 156 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPP PP P PP P Sbjct: 111 PPARPPPPPPTAPPATPPPPPPNHPPPPPPKSNDIPPPPPAAIPPPAPPATPPAAP 166 Score = 25.8 bits (54), Expect(2) = 2e-05 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 374 PPPPXPXXXXXXFXGGGGG 430 PPPP P GGGGG Sbjct: 5 PPPPPPPPPCTANHGGGGG 23 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 69.3 bits (162), Expect = 1e-10 Identities = 36/87 (41%), Positives = 36/87 (41%), Gaps = 4/87 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX----PPXXGGXXXPXAPXXXAXPPP 736 PPPPP GG PPPPP P PPPP PP GG P P PP Sbjct: 488 PPPPPPPGG-----KLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPP 542 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PP PP GP P PP G G Sbjct: 543 PPPPPPGKLGPGGGPPPPPPPPPRGLG 569 Score = 65.7 bits (153), Expect = 1e-09 Identities = 35/88 (39%), Positives = 35/88 (39%), Gaps = 4/88 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPP PPPPPP PPPP PP GG P P PPPPP Sbjct: 469 PPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPP-PGGKLPPPPPPPGKAPPPPPGG 527 Query: 743 --XPPXPXAGPPXPAAPXXXPPXXGXGG 820 PP P G P P P G GG Sbjct: 528 KLPPPPPPGGKGAPPPPPPPPGKLGPGG 555 Score = 59.7 bits (138), Expect = 9e-08 Identities = 33/85 (38%), Positives = 33/85 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PPPP GG P P PPP P Sbjct: 467 PPPPPPAA-------ERLPAPPPPPVKLPPPPPP----PGGKLPPPPPPPPGGKLPPPPP 515 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGGA 823 P A PP P PP G GA Sbjct: 516 PPGKAPPPPPGGKLPPPPPPGGKGA 540 Score = 56.4 bits (130), Expect = 9e-07 Identities = 27/66 (40%), Positives = 27/66 (40%), Gaps = 2/66 (3%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP--XXPXXP 433 K PPPP GG PPP G P P PPPPPP P P Sbjct: 497 KLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGG 556 Query: 432 PPPPPP 415 PPPPPP Sbjct: 557 PPPPPP 562 Score = 54.0 bits (124), Expect = 5e-06 Identities = 35/103 (33%), Positives = 35/103 (33%), Gaps = 1/103 (0%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP P PPPPPPP G P Sbjct: 467 PPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLP--PPPPPPPGGKLPPPPPPPGKAPPPP 524 Query: 360 PXFFF-LXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPR 235 P P PG G PPPP PPR Sbjct: 525 PGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPPPP-PPPPPR 566 Score = 47.2 bits (107), Expect = 5e-04 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGG--GXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP 428 PPPP GG PPPPP P PPPPP PP Sbjct: 499 PPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPP 558 Query: 427 PPPPP 413 PPPPP Sbjct: 559 PPPPP 563 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 7/68 (10%) Frame = +2 Query: 629 PPPPPXXXPGPPPP-------XPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 P PP P PPPP PP P P PPPPP PP PP P Sbjct: 459 PLPPSATLPPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPG 518 Query: 788 XXXPPXXG 811 PP G Sbjct: 519 KAPPPPPG 526 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 5/68 (7%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPP-----PPPXXXXXXX 437 PPPP G PPPPP G+ P P PP PPP Sbjct: 481 PPPPVKLPPPPPPPGGKLPPPPPPP-PGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKG 539 Query: 436 TPPPPPPP 413 PPPPPPP Sbjct: 540 APPPPPPP 547 Score = 46.0 bits (104), Expect = 0.001 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 5/69 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPPP-----PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPX 790 P PP P PPP P PP P P PPPP PP PP P P Sbjct: 459 PLPPSATLPPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPG 518 Query: 791 XXPPXXGXG 817 PP G Sbjct: 519 KAPPPPPGG 527 Score = 44.8 bits (101), Expect = 0.003 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP----XXPPXXGGXXXXXXPPG 719 P PPPP GG P PPPPP P PPP PP GG PPG Sbjct: 484 PVKLPPPPPPPGG-----KLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPG 536 Score = 43.6 bits (98), Expect = 0.007 Identities = 31/102 (30%), Positives = 31/102 (30%), Gaps = 2/102 (1%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXX 319 P P PPPPP P P PPPPP GG PP Sbjct: 459 PLPPSATLPPPPP--PAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPP----PPGGKLPP 512 Query: 318 XXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG--GPG 199 P G PPPP P P PG GPG Sbjct: 513 PPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPPGKLGPG 554 Score = 43.6 bits (98), Expect = 0.007 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 2/61 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPP GG G PPPPP PG PPPP PP G P P Sbjct: 530 PPPPPPGGKGAP----PPPPPPPGKLGPGGGPPPPPPPPPRGLGSLGVSALGGPKAPVPK 585 Query: 746 P 748 P Sbjct: 586 P 586 Score = 42.3 bits (95), Expect = 0.015 Identities = 29/84 (34%), Positives = 29/84 (34%) Frame = -2 Query: 702 GXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPX 523 G PP GG P G K PPPP GG G PPPPP Sbjct: 496 GKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGA---------PPPPPP 546 Query: 522 XXGXXXKXPXPXXXXXPPPPPPXP 451 G P PPPPPP P Sbjct: 547 PPGKLGPGGGP-----PPPPPPPP 565 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP---XXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPP A P PPPPPP PPP PP G PPG Sbjct: 462 PSATLPPPPPPAAERLPAPPPPPVKLPPPPPPPGGKLPPPPPPPPGGKLPPPPPPPG 518 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP----XXPPXXGGXXXXXXPPGXP 725 P PPP GG PPPPPP P PPP PP GG PP P Sbjct: 494 PGGKLPPPPPPPPGG-----KLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPPPPPPP 548 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP G PPPPPP PP PP G PP P Sbjct: 511 PPPPPPPGKAPPPPPGGKLPPPPPP-GGKGAPPPPPPPPGKLGPGGGPPPPP 561 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP----PXXXPXPPPXXPP 680 P PPP GG G P PPPPP P P PPP PP Sbjct: 525 PGGKLPPPPPPGGKGA----PPPPPPPPGKLGPGGGPPPPPPPPP 565 Score = 36.7 bits (81), Expect = 0.75 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 6/68 (8%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXX---PXPPPPPXXLXXXXNPPPPPP---PXXXXXXXXXXG 381 APPPPP G P P PPPPP L PPPPPP G Sbjct: 520 APPPPPG--GKLPPPPPPGGKGAPPPPPPPPGKLGPGGGPPPPPPPPPRGLGSLGVSALG 577 Query: 380 GGGXXXPR 357 G P+ Sbjct: 578 GPKAPVPK 585 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 68.9 bits (161), Expect = 2e-10 Identities = 28/59 (47%), Positives = 31/59 (52%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPP PP P P + PPPPP PP P + PP P+ P PP Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPS-PPPPPPPPPPPSPPPPPSPPPPSPP 263 Score = 62.1 bits (144), Expect = 2e-08 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP P Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPP-------PPPPS----PPPPPSP 257 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 258 PPP--SPPLPPPSIPSPP 273 Score = 58.8 bits (136), Expect = 2e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 249 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPP 246 Score = 57.6 bits (133), Expect = 4e-07 Identities = 28/73 (38%), Positives = 29/73 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P P PP PP P P PPP P P Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPP-------PPPPPPSPPPPPSPPP 259 Query: 749 PXPXAGPPXPAAP 787 P P PP +P Sbjct: 260 PSPPLPPPSIPSP 272 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 52.4 bits (120), Expect = 1e-05 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P PP PP Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPP--------PPPPPSPPPPPPPPPPPSPPPPPSPP 258 Query: 420 PP 415 PP Sbjct: 259 PP 260 Score = 52.0 bits (119), Expect = 2e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P PPPPPP P PPPPPPP Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPP 247 Score = 52.0 bits (119), Expect = 2e-05 Identities = 24/64 (37%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-- 427 PPPP + PPPPP P P PPPP P P P PPP Sbjct: 210 PPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSI 269 Query: 426 PPPP 415 P PP Sbjct: 270 PSPP 273 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPPPP P PPP PP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPP 245 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 207 PPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSP 262 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPPPP P PPP PP PP P Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPP 263 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP +PPPP Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP-------SPPPP 260 Query: 421 PPP 413 PP Sbjct: 261 SPP 263 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP P PP PPP P PPP PP PP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPP 253 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP P P PPPP P PP PP PP P Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSP 257 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPPPP P P P PP PP P Sbjct: 215 PSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIP 270 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 674 PPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P P PPP PP P + PP P P P Sbjct: 197 PTSRASKYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSP 239 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP PPPPP P P PP PP P P Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIP 270 Query: 421 PPP 413 PP Sbjct: 271 SPP 273 >UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; Dictyostelium discoideum|Rep: Wiscott-Aldrich syndrome protein - Dictyostelium discoideum AX4 Length = 399 Score = 68.5 bits (160), Expect = 2e-10 Identities = 36/86 (41%), Positives = 37/86 (43%), Gaps = 1/86 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP G PPPPP PPP PP P P PPPPP P Sbjct: 249 PPAPPSSNQPGRSA------PPPPPSVGKSAPPPPPPSHKTPAAP--PSGGGAPPPPPPP 300 Query: 749 PXPXAGPPXPAAP-XXXPPXXGXGGA 823 P P +GPP P P PP G GGA Sbjct: 301 PPPSSGPPPPPPPMASAPPSSGGGGA 326 Score = 51.6 bits (118), Expect = 2e-05 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P PPPPPP P PPPPP Sbjct: 264 PPPPSVGKSA----------PPPPPP--SHKTPAAPPSGGGAPPPPPPPPPPSSGPPPPP 311 Query: 420 PPXXXXXXXXGXGG 379 PP G GG Sbjct: 312 PPMASAPPSSGGGG 325 Score = 48.4 bits (110), Expect = 2e-04 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 PPPP P PPPPPP P PPPPPP G G G Sbjct: 274 PPPPPPSHKTPAAPPSGGGAPPPPPPPPPPSSGPPPPPPPMASAPPSSGGGGASG 328 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXP----PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPP G + P PPPP G P P P PP P PP Sbjct: 239 PPPTQPGRSAPPAPPSSNQPGRSAPPPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPP 298 Query: 429 PPPPP 415 PPPPP Sbjct: 299 PPPPP 303 Score = 43.2 bits (97), Expect = 0.009 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX--AXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPP P P PP G P P A PPPPP P A P AP P Sbjct: 239 PPPTQPGRSAPPAPPSSNQPGRSAPPPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPP 298 Query: 800 P 802 P Sbjct: 299 P 299 Score = 41.1 bits (92), Expect = 0.035 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX-PPPPPXXXXXXXTPPP 425 PPPP G PPPPP K P P PPPPP PPP Sbjct: 263 PPPPPSVGKSAP--------PPPPPSH-----KTPAAPPSGGGAPPPPPPPPPPSSGPPP 309 Query: 424 PPPP 413 PPPP Sbjct: 310 PPPP 313 Score = 39.9 bits (89), Expect(2) = 0.002 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPP G P P P PPP P PPPPPP GGG P Sbjct: 239 PPPTQPGRSAP-PAPPSSNQPGRSAPPPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPP 297 Query: 360 P 358 P Sbjct: 298 P 298 Score = 37.5 bits (83), Expect(2) = 0.023 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPP P PPPP PPPPPP GG P Sbjct: 239 PPPTQPGRSAPPAPPSSNQPGRSAPPPPPSVGKSAPPPPPPSHKTPAAPPSGGGAPPPPP 298 Query: 360 P 358 P Sbjct: 299 P 299 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXX----PPXXGG 692 P P GGG P PPPPPP P PPP PP GG Sbjct: 278 PPSHKTPAAPPSGGGAP---PPPPPPPPPSSGPPPPPPPMASAPPSSGG 323 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXX--PXXPPPPPPXXXPXPPPXXP 677 PPPP + P PPPPPP PPP P Sbjct: 276 PPPPSHKTPAAPPSGGGAPPPPPPPPPPSSGPPPPPPP 313 Score = 24.6 bits (51), Expect(2) = 0.002 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = -2 Query: 276 GXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 G PPPP P P P P P Sbjct: 292 GAPPPPPPPPPPSSGPPPPPPPMASAPP 319 Score = 23.4 bits (48), Expect(2) = 0.023 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = -2 Query: 276 GXXPPPPXXXXPPRXPXTPXXP 211 G PPPP PP P P Sbjct: 291 GGAPPPPPPPPPPSSGPPPPPP 312 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 68.5 bits (160), Expect = 2e-10 Identities = 36/90 (40%), Positives = 36/90 (40%), Gaps = 6/90 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX---AXPPPP 739 PPPPP PPPPPP PPP PP GG P P A PPPP Sbjct: 327 PPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPP 386 Query: 740 PXPPXPXAGPPXPAA---PXXXPPXXGXGG 820 P P GPP P P PP G G Sbjct: 387 PPPGSKIPGPPPPPGGPRPPGPPPPPGQAG 416 Score = 68.1 bits (159), Expect = 3e-10 Identities = 36/84 (42%), Positives = 36/84 (42%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG----PPPPXPPXXGGXXXPXAP--XXXAXP 730 PPPPP PPPPPP PG PPPP PP G P P A P Sbjct: 311 PPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARP 370 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PP A PP P P P Sbjct: 371 PPPPPPPFGNAPPPPPPPPGSKIP 394 Score = 62.9 bits (146), Expect = 1e-08 Identities = 43/134 (32%), Positives = 43/134 (32%), Gaps = 2/134 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P PPPPP Sbjct: 294 PPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPP----PPPPPPPIPGQQNPPPPPP 349 Query: 420 PPXXXXXXXXGXG--GGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 PP GG PP P PG G PPPP Sbjct: 350 PPLPGQQAPPPPPPLPGGARPPP-----PPPPPFGNAPPPPPPPPGSKIPG-PPPPPGGP 403 Query: 246 XPPRXPXTPXXPGG 205 PP P P GG Sbjct: 404 RPPGPPPPPGQAGG 417 Score = 61.7 bits (143), Expect = 2e-08 Identities = 37/98 (37%), Positives = 37/98 (37%), Gaps = 17/98 (17%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--------PPPPXPPXXG-----GXXXPXA 709 PPPPP PPPPPP P PPPP PP G P Sbjct: 293 PPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPL 352 Query: 710 PXXXAXPPPPPXP----PXPXAGPPXPAAPXXXPPXXG 811 P A PPPPP P P P PP AP PP G Sbjct: 353 PGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPG 390 Score = 60.5 bits (140), Expect = 5e-08 Identities = 28/66 (42%), Positives = 28/66 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPPP PPPP PP P P PP PP P Sbjct: 359 PPPPPLPGGA-------RPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRPPGPPPP 411 Query: 749 PXPXAG 766 P G Sbjct: 412 PGQAGG 417 Score = 60.1 bits (139), Expect = 7e-08 Identities = 43/136 (31%), Positives = 43/136 (31%), Gaps = 2/136 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P PPPPP Sbjct: 295 PPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPP-----PPPPPPIPGQQNPPPPPP 349 Query: 420 PPXXXXXXXXGXGG--GGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 PP GG PP P PG G PPP Sbjct: 350 PPLPGQQAPPPPPPLPGGARPPPP-----PPPPFGNAPPPPPPPPGSKIPGPPPPPGG-- 402 Query: 246 XPPRXPXTPXXPGGPG 199 PR P P PG G Sbjct: 403 --PRPPGPPPPPGQAG 416 Score = 54.8 bits (126), Expect = 3e-06 Identities = 24/63 (38%), Positives = 25/63 (39%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP G+ P P PPPP PPPP Sbjct: 326 PPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPP 385 Query: 421 PPP 413 PPP Sbjct: 386 PPP 388 Score = 53.6 bits (123), Expect = 6e-06 Identities = 37/121 (30%), Positives = 38/121 (31%), Gaps = 5/121 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP----PPPPPPXXXXXXXXGXGGGG 373 PPPPP P PPPPP P P P PPPPPP G Sbjct: 288 PPPPPPPP--PPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPP 345 Query: 372 XXXPPXF-FFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGX 196 PP P P G PPPP + P P PGGP Sbjct: 346 PPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGPRP 405 Query: 195 P 193 P Sbjct: 406 P 406 Score = 53.2 bits (122), Expect = 8e-06 Identities = 34/89 (38%), Positives = 34/89 (38%), Gaps = 4/89 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP PPPP PP P P PPPPP P Sbjct: 289 PPPPPPPPPPLPNSTSNVTAPPPPP-----PPPP-PPLPNSQAPPPPP---PPPPPPPIP 339 Query: 749 ----PXPXAGPPXPAAPXXXPPXXGXGGA 823 P P PP P PP GGA Sbjct: 340 GQQNPPPPPPPPLPGQQAPPPPPPLPGGA 368 Score = 52.0 bits (119), Expect = 2e-05 Identities = 27/61 (44%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA-GPPXPAAPXXXPPXX 808 PPPP PPPP PP AP PPPPP PP P + PP P P PP Sbjct: 288 PPPP-----PPPPPPPLPNSTSNVTAP---PPPPPPPPPPLPNSQAPPPPPPPPPPPPIP 339 Query: 809 G 811 G Sbjct: 340 G 340 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP PPPPPPP Sbjct: 293 PPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPP 334 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-----XXXPXPPPXXPPXXGGXXXXXXPPGX 722 P PPPP A P PPPPPP P PPP PP G PP Sbjct: 291 PPPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPP 350 Query: 723 P 725 P Sbjct: 351 P 351 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P PPPPP PPPPPPP Sbjct: 292 PPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPP 334 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPP PPP PP G PP P Sbjct: 310 PPPPPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLP 365 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP GG PPPPPP PPP PP PPG P Sbjct: 353 PGQQAPPPPPPLPGG-----ARPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPPGGP 403 Score = 37.1 bits (82), Expect = 0.57 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 1/56 (1%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP-PXPAAPXXXPP 802 P P PPPP PP P P + PP PP P P P AP PP Sbjct: 283 PQQQSPPPPPPPPP-------PPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPP 331 Score = 34.7 bits (76), Expect = 3.0 Identities = 29/108 (26%), Positives = 29/108 (26%), Gaps = 8/108 (7%) Frame = -2 Query: 492 PXXXXXPPPPPPXP--------XXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXX 337 P PPPPPP P PPPPPPP PP Sbjct: 283 PQQQSPPPPPPPPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPPPPPPP----PI 338 Query: 336 XXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P PG PP P PP P P P P Sbjct: 339 PGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPPPPFGNAPPPPP 386 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPP G P PPPPP P PPP PP PPG Sbjct: 365 PGGARPPPPPPPPFG---NAPPPPPPPPGSKIPGPPP--PPGGPRPPGPPPPPG 413 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 68.5 bits (160), Expect = 2e-10 Identities = 33/78 (42%), Positives = 33/78 (42%), Gaps = 5/78 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP-----XXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP GG PPPPPP P PPPP PP G P P PP Sbjct: 552 PPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPPPPGGMPP 611 Query: 734 PPPXPPXPXAGPPXPAAP 787 PPP P PP A P Sbjct: 612 PPPMPGRAPPPPPGAAKP 629 Score = 62.1 bits (144), Expect = 2e-08 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPPP P PPPP P P PPPP P Sbjct: 553 PPPPPPPGG------LLTAPPPPPP--PPPPPPPGGSLTAPPPPPPPPPPGGRLPPPP-P 603 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 604 PPPGGMPPPPPMPGRAPP 621 Score = 62.1 bits (144), Expect = 2e-08 Identities = 35/92 (38%), Positives = 35/92 (38%), Gaps = 3/92 (3%) Frame = +2 Query: 536 GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXPX 706 GG PPPPP GG PPPPPP PG PPPP PP G P Sbjct: 560 GGLLTAPPPPPPPPPPPPPGGSLTA-----PPPPPPPPPPGGRLPPPPPPPP--GGMPPP 612 Query: 707 APXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPPP P P P P Sbjct: 613 PPMPGRAPPPPPGAAKPGKQKCNPTKPMKQVP 644 Score = 61.7 bits (143), Expect = 2e-08 Identities = 34/88 (38%), Positives = 34/88 (38%), Gaps = 4/88 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG----PPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP GG PPPPPP G PPPP PP G P PPP Sbjct: 551 PPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLP--------PPP 602 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 PP P PP P PP G Sbjct: 603 PPPPGGMPPPPPMPGRAPPPPPGAAKPG 630 Score = 57.6 bits (133), Expect = 4e-07 Identities = 30/81 (37%), Positives = 30/81 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG PPPPP G P PPPPPP P PPPPP Sbjct: 551 PPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAP-------PPPPPPPPPGGRLPPPPP 603 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 PP G PP Sbjct: 604 PPPGGMPPPPPMPGRAPPPPP 624 Score = 55.6 bits (128), Expect = 2e-06 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 P PP P PPPP PP GG P PPPPP PP P P P PP Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPP-----PPPPPPPPPPGGSLTAPPPPPPPPPPG 595 Query: 809 G 811 G Sbjct: 596 G 596 Score = 50.8 bits (116), Expect = 4e-05 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-----PXPPXPXAGPPXPAAPX 790 P PP P PPPP PP G P P PPPP PP P PP P Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPP 600 Query: 791 XXPPXXG 811 PP G Sbjct: 601 PPPPPPG 607 Score = 50.4 bits (115), Expect = 6e-05 Identities = 28/67 (41%), Positives = 28/67 (41%), Gaps = 9/67 (13%) Frame = +2 Query: 629 PPPPPXXXPGPPPP------XPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG---PPXPA 781 PPPPP P PPPP PP P P PPPP PP P G PP P Sbjct: 548 PPPPP---PPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPP 604 Query: 782 APXXXPP 802 P PP Sbjct: 605 PPGGMPP 611 Score = 50.0 bits (114), Expect = 8e-05 Identities = 27/71 (38%), Positives = 27/71 (38%) Frame = -2 Query: 630 GGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP 451 GG PPPP GG PPPPP G P P PPPPP Sbjct: 560 GGLLTAPPPPPPPPPPPPPGGSLT--APPPPPPPPPPGGRLPPPPPPPPGGMPPPPP--- 614 Query: 450 XXPXXPPPPPP 418 P PPPPP Sbjct: 615 -MPGRAPPPPP 624 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 4/57 (7%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP GG A P PPPPPP PPP PP GG PP Sbjct: 548 PPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPP 604 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +3 Query: 534 GGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXP 713 GG P PPPP GG P PPPPPP PPP PP GG Sbjct: 560 GGLLTAPPPPPPPPPPPPPGGS---LTAPPPPPPPPPPGGRLPPP-PPPPPGGMPPPPPM 615 Query: 714 PG 719 PG Sbjct: 616 PG 617 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP PPPPPPP Sbjct: 550 PPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPP 591 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP PPPPPPP Sbjct: 551 PPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPPP 592 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P PPPPP P Sbjct: 547 APPPPPPPPPPPPGGLLTAPPPPPPPPP------PPPPGGSLTAPPPPPPPPPPGGRLPP 600 Query: 430 PPPPPP 413 PPPPPP Sbjct: 601 PPPPPP 606 Score = 44.0 bits (99), Expect = 0.005 Identities = 32/101 (31%), Positives = 32/101 (31%), Gaps = 4/101 (3%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXP----XXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXX 331 P P PPPPPP P P PPPPPPP GG PP Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPPPPPPPPPP-----GGSLTAPP------PPP 589 Query: 330 XXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG 208 P P G PPPP P P PG Sbjct: 590 PPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPPPPGAAKPG 630 Score = 40.3 bits (90), Expect = 0.061 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 491 PXXXPXPPPPPXXLXXXXNPPPPPPP 414 P P PPPPP L PPPPPPP Sbjct: 549 PPPPPPPPPPPGGLLTAPPPPPPPPP 574 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 6/45 (13%) Frame = +3 Query: 609 AXXPXXPPPPPP------XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPPPPP P PPP PP GG PP P Sbjct: 547 APPPPPPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPPPPP 591 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = -2 Query: 630 GGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP 451 GG PPPP GG PPPPP G P P PPP P Sbjct: 579 GGSLTAPPPPPPPPPPGG---------RLPPPPPPPPGGMPPPPPMPGRAPPPPPGAAKP 629 Query: 450 XXPXXPPPPP 421 P P Sbjct: 630 GKQKCNPTKP 639 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P P PPPPP P PPPPP Sbjct: 548 PPPPPPPP-----PPPPGGLLTAPPPPPPPP----PPPPP 578 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 68.1 bits (159), Expect = 3e-10 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP---GPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PPP PP P PPPP PP P P PPP Sbjct: 2670 PPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPP 2729 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP P PP P P PP Sbjct: 2730 PSPPPPSPPPPSPPPPSPPPP 2750 Score = 67.7 bits (158), Expect = 4e-10 Identities = 27/58 (46%), Positives = 29/58 (50%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP P PPPP PP P P + PPP P PP P + PP P P P Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTP 263 Score = 67.3 bits (157), Expect = 5e-10 Identities = 31/77 (40%), Positives = 31/77 (40%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPP P P PPPP PP P P PPPP PP Sbjct: 2680 PPPPSPPPSPPPSPPPPSPPPPSPPP-PSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 2738 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 2739 PPSPPPPSPPPPSPPPP 2755 Score = 66.1 bits (154), Expect = 1e-09 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP P PPPP P PPPP PP P P PPPP P Sbjct: 2687 PSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPS----PPPPSPPPPSPPPPSP 2742 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 2743 PPPSPPPPSPPPPSPPPP 2760 Score = 65.3 bits (152), Expect = 2e-09 Identities = 30/77 (38%), Positives = 33/77 (42%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPP P PPPP PP P +P + PPP P PP Sbjct: 2703 PPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPSPPPP 2760 Query: 752 XPXAGPPXPAAPXXXPP 802 P A P P+ P PP Sbjct: 2761 LPPAPSPPPSPPPPSPP 2777 Score = 61.7 bits (143), Expect = 2e-08 Identities = 30/79 (37%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP-XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 P PPP P PPPP P PPPP PP P +P + PPP P Sbjct: 2706 PSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPS--PPPPSPPPPSPPPPLPP 2763 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 2764 APSPPPSPPPPSPPPSPPP 2782 Score = 61.3 bits (142), Expect = 3e-08 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPPPP P PPPP PP P P PPPP PP P P P P P Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPT 264 Query: 809 G 811 G Sbjct: 265 G 265 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/59 (44%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP P PP P P P PPP PP P PP P+ P PP Sbjct: 2253 PPPSPPPPSPHPPSPPPP---SPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPP 2308 Score = 60.5 bits (140), Expect = 5e-08 Identities = 28/60 (46%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP P PPPP PP P P P PPPP PP P PP P P PP Sbjct: 2264 PPSPPP---PSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPPP 2320 Score = 60.1 bits (139), Expect = 7e-08 Identities = 26/59 (44%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-PPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPPP PP P PP PPP PP P PP P P PP Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPP 2315 Score = 59.3 bits (137), Expect = 1e-07 Identities = 27/73 (36%), Positives = 28/73 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPP PP P PP P PP P PPP P P Sbjct: 2714 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPP 2773 Query: 749 PXPXAGPPXPAAP 787 P P PP P+ P Sbjct: 2774 PSPPPSPPPPSPP 2786 Score = 57.6 bits (133), Expect = 4e-07 Identities = 25/59 (42%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P PPPP P PPP P PP P PPP P PP P PP P+ P P Sbjct: 2530 PSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588 Score = 57.2 bits (132), Expect = 5e-07 Identities = 28/66 (42%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +2 Query: 608 CXXXXXPPP-PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAA 784 C PPP PPP P PPPP PP P +P + PPP P P P PP P+ Sbjct: 2527 CSPPSPPPPSPPPSPPPSPPPPLPP-------PPSPPPPSPPPPSPPPSPPPPSPP-PSP 2578 Query: 785 PXXXPP 802 P PP Sbjct: 2579 PPPSPP 2584 Score = 57.2 bits (132), Expect = 5e-07 Identities = 27/78 (34%), Positives = 28/78 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPP PP P PP P PP P PP P P Sbjct: 2709 PPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPP 2768 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P+ P PP Sbjct: 2769 PSPPPPSPPPSPPPPSPP 2786 Score = 55.2 bits (127), Expect = 2e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPP P P P PPPPPPP Sbjct: 217 PPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 55.2 bits (127), Expect = 2e-06 Identities = 37/137 (27%), Positives = 37/137 (27%), Gaps = 1/137 (0%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP T PP PP P P PPP PP P P PPPP Sbjct: 2647 PPPEAFESNVNYISGQTCIKPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPP 2706 Query: 420 -PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXX 244 PP PP P P PP P Sbjct: 2707 SPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPS 2766 Query: 243 PPRXPXTPXXPGGPGXP 193 PP P P P P P Sbjct: 2767 PPPSPPPPSPPPSPPPP 2783 Score = 54.8 bits (126), Expect = 3e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P P PPPPPPP Sbjct: 218 PPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 53.6 bits (123), Expect = 6e-06 Identities = 23/55 (41%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 641 PXXXPGPPPP-XPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P PPPP PP P P + PPP P PP P PP P+ P PP Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPP 2580 Score = 53.2 bits (122), Expect = 8e-06 Identities = 25/54 (46%), Positives = 27/54 (50%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PP PPP P PPPP PP P +P + PPP P PP P PP P P Sbjct: 1172 PPSPPPP--PSPPPPSPPP------PPSPPPPSPPPPLPPPPSPPPPPPLPLIP 1217 Score = 52.0 bits (119), Expect = 2e-05 Identities = 22/50 (44%), Positives = 23/50 (46%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP PP P P PPPP PP P PP P+ P PP Sbjct: 203 PSPPPPPPPPP--LPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P P PPP PPP Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPP 246 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P P PPPPP Sbjct: 207 PPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPP 248 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P P PPPPPP Sbjct: 208 PPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPP 249 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P PPPPPP P PPPPPPP Sbjct: 209 PPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P P PPPPP Sbjct: 215 PPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 50.4 bits (115), Expect = 6e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P PPPPP P Sbjct: 220 PPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLP 261 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP PPP P P P P PPPP P P PPP P Sbjct: 2253 PPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSP 2312 Query: 420 PP 415 PP Sbjct: 2313 PP 2314 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P P PPPP P P PP PPPP Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPP 2572 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPP PP P P PPPP PP Sbjct: 2534 PPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPP 2575 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P P PPPP P P PPPPP P Sbjct: 1173 PSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLP 1214 Score = 47.2 bits (107), Expect = 5e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPP P P P PPPP PP Sbjct: 212 PPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPP 253 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP- 424 PPPP PPPP P P PP PPP P PPPP Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPS 2316 Query: 423 -PPP 415 PPP Sbjct: 2317 QPPP 2320 Score = 47.2 bits (107), Expect = 5e-04 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP P PPPPPP P PPP PP PP P Sbjct: 2267 PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQP 2318 Score = 46.8 bits (106), Expect = 7e-04 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP-PPPXPXXPXXPPPPPPP 415 P PPP P P PPP PPP P P PP PPPP Sbjct: 2539 PSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPP 2581 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP + P PPP P P PPPP P P P P PPP Sbjct: 2255 PSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPP 2314 Query: 420 P 418 P Sbjct: 2315 P 2315 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP-PXXXGXXXKXPXPXXXXXPPPPP--PXPXXPXXPP 430 PPPP PPPP P P P P PPP P P P PP Sbjct: 2722 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPP 2781 Query: 429 PPPPP 415 PP PP Sbjct: 2782 PPSPP 2786 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP PP P P PP PPP P PPPPPP Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPP 1212 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PP PPP P PPP PPP Sbjct: 2545 PPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPP 2585 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPP PP P P PPP PP Sbjct: 2529 PPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPP 2570 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P PPP PP P P PPPP PP Sbjct: 2543 PSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPP 2584 Score = 43.6 bits (98), Expect = 0.007 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPP P P P PPP PP Sbjct: 2547 PPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + P PP PPP P PPP PP Sbjct: 213 PLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPP 253 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P PPPP +PPPPPPP Sbjct: 216 PPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP P PPP P P PP PP +PPPP Sbjct: 2671 PPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPP 2730 Query: 421 PPP 413 PP Sbjct: 2731 SPP 2733 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P P PPPP P PPP PP PP P Sbjct: 2683 PSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 2738 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP P P PPP PP PP P Sbjct: 2699 PPPSPPPPSPPPPSPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPP 2753 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP P P PPP PP PP P Sbjct: 2704 PPPSPPPPSPPPSPPPPSPPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPP 2758 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPP P P P PPPP P Sbjct: 2542 PPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSP 2583 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PPPP P P PPPP P Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSP 244 Score = 41.5 bits (93), Expect = 0.026 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPP-PXPXXPXXPPPPPPP 415 PPPP P P PPPP P P P PPPP P Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSP 2574 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P PPPP P P P PPP PP Sbjct: 2538 PPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPP 2579 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P P PPP PP PP P Sbjct: 2694 PPPSPPPPSPPPPSPPPPSPPPSPPPPSP-PPPSPPPPSPPPPSPPPPSPPPPSPP 2748 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPP P P P PPP P Sbjct: 2537 PPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSP 2578 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP P P PPPP P PPP PP PP P Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPP 256 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPP P P P PPP P Sbjct: 2546 PPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYP 2587 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPPP PPPPP P Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSP 252 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P P PPP PPPPP P Sbjct: 219 PPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLP 261 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPPP PPP PP PP P Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLP 261 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP + P P PPP P PPP PP PP Sbjct: 2268 PPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPSQPPP 2320 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 600 GXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 G + P PPPPPP P PPP PP PP Sbjct: 197 GVVSDFPSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPP 235 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPP---PPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 PPPP PPP PP P P PP PP +P Sbjct: 2708 PPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSP 2767 Query: 430 PPPPPP 413 PP PPP Sbjct: 2768 PPSPPP 2773 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPPP P PPPPPP P P P PP PP Sbjct: 197 GVVSDFPSPPPPPPPPP--------LPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPP 248 Query: 720 XP 725 P Sbjct: 249 PP 250 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP PPPP P P PPP PP P P P P Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTP 263 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPP + P PPPP P P PPP PP Sbjct: 2254 PPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPP 2294 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP P P P PPPPP PP PPPP Sbjct: 2264 PPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPP 2305 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPP P +PPPP PP Sbjct: 2267 PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPP 2308 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPP-PPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 G P PPPP + P PP PPPP P PP P PP Sbjct: 2661 GQTCIKPPSPPPPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPP 2720 Query: 717 GXP 725 P Sbjct: 2721 SPP 2723 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP PP PP P Sbjct: 2678 PSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPP 2733 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP PP P P Sbjct: 2713 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPP 2768 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPP-PXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP PPPP P P P PPPP PP P Sbjct: 2253 PPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSP 2312 Query: 421 PPP 413 PPP Sbjct: 2313 PPP 2315 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPP P +PPPP PP Sbjct: 2533 PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPP 2575 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 P PPP + P PPPPPP P PPP P G Sbjct: 221 PPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPPLPTPTG 265 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P P PPPP P PP PP Sbjct: 1172 PPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPP 1212 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPPPPXPPXXGG 691 PP PP PPPP PP P PPPP P GG Sbjct: 1178 PPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIPGG 1219 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPP P P P P PPP PPPP PP Sbjct: 2252 SPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPP 2294 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PP P P PPP PP P PPP PP Sbjct: 2255 PSPPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPP 2295 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPP P P PPP P +PPPP Sbjct: 2717 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPSPPPPSPPPPLPPAPSPPPSPPPP 2774 Query: 421 PPP 413 PP Sbjct: 2775 SPP 2777 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 G P P PPP PP P P P PPPP Sbjct: 197 GVVSDFPSPPPPPPPPPLPPPPPPPPPPSPPPP 229 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPPP P PPP P PP P Sbjct: 2253 PPPSPPPPSPHPPS-PPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSP 2307 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP- 422 PPP PPPP P P PP PP +PPPP Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPPS 2316 Query: 421 -PPP 413 PPP Sbjct: 2317 QPPP 2320 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPP P P P PPPP PP Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPP 2551 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPP P P PPP PP Sbjct: 2546 PPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSP-PPPSPPP 2585 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PP PPP P PPP PP PP P Sbjct: 2691 PSPPPPSPPPPSPPPPSPPPPSPPPSPPP---PSPPPPSPPPPSPPPPSPPPPSPP 2743 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPP P PPP PP Sbjct: 2733 PPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPP 2773 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP P PPP PP P PPP PP PP Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSP-PPPSPPPSPPPPSPPPSPP 2579 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PP P P PPP PP P PP PP PP Sbjct: 2720 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPP 2772 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPP P P PPPP +PPP PPP Sbjct: 2531 SPPPPSPPPSPPPSPPPPLPPPPSPPPPS--PPPPSPPPSPPP 2571 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP--PPPPXXXPXPPPXXPP 680 P PPP P PP PPPP P PPP PP Sbjct: 2533 PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPP 2575 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP P PP P Sbjct: 2673 PPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPP 2728 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPP P P PP PP PP P Sbjct: 2258 PPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPP 2313 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP PP PP P Sbjct: 2530 PSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPP-SPPPSPPPPSPP 2584 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP---XXPPPPPPXXXPXPPPXXPP 680 P PPPP P P PPPP P PPP PP Sbjct: 2743 PPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP + P PPP PP P PPP P Sbjct: 2551 PPPSPPPPSPPPPSPPPSPPPPSPPPSPP--PPSPPPYPP 2588 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P P PPPP P PP P PP P Sbjct: 2722 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPP 2777 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPP P P PPP P PPP PP Sbjct: 2742 PPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPP 2782 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 597 GGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 G + P PPPPP P PPP P PP P Sbjct: 1165 GKYFSCNPPSPPPPPSPPPPSPPPPPSPPPPSPPPPLPPPPSP 1207 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPP 680 P PPP + P PPP PPP P PP PP Sbjct: 2547 PPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPP 2588 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP-PXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PP P P PP P Sbjct: 2725 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPP 2781 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PPP P P P P PP P Sbjct: 2730 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPPPPSPPPSPPPPSPP 2786 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP P PPPP P PPP PP Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPP 2566 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPP P P P P PPP +PPP PPP Sbjct: 2540 SPPPSPPPPLPPPPSPPPPSPPPPSPPPS--PPPPSPPPSPPP 2580 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P P PPPP P PP P PP P Sbjct: 2717 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPLPPAPSPPPSPP 2772 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P P PPPP P P P P G PP Sbjct: 1177 PPPSPPPPSPPPPPSPPPPSPPPPLPPPPSPPPPPPLPLIPGGWKGQYVSIFPP 1230 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = -1 Query: 577 GGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 GG G P + P P P PPP PP PPPP Sbjct: 2504 GGACSSGCGYNTPYEHTMISSDPCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPP 2558 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP PPP P PP PP PP P Sbjct: 2526 PCSPPSPPPPSPPPSPPPSPPPPLPPPPSPPPPSPP 2561 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 68.1 bits (159), Expect = 3e-10 Identities = 36/95 (37%), Positives = 36/95 (37%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P G GG PPPP PPPPPP P PPPP PP Sbjct: 193 PTGVTGPGGPTFPTPVSAPPPPFRDR---PVASPSPPPPPPPPPPPPPPPPPSPPPP--- 246 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P P PPPPP PP P PP P P P Sbjct: 247 --PPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTP 279 Score = 62.9 bits (146), Expect = 1e-08 Identities = 32/80 (40%), Positives = 32/80 (40%), Gaps = 4/80 (5%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPP----PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 P G GG PPPP P P PPPP PP P P PPPPP Sbjct: 193 PTGVTGPGGPTFPTPVSAPPPPFRDRPVASPSPPPPPPPPP--PPPPPPPPSPPPPPPPP 250 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P PP P P PP Sbjct: 251 PPPPPPPPPPSPPPPSPNPP 270 Score = 57.2 bits (132), Expect = 5e-07 Identities = 27/75 (36%), Positives = 27/75 (36%) Frame = -2 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G GG PPPP PPPPP P P PPPPP Sbjct: 198 GPGGPTFPTPVSAPPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Query: 459 PXPXXPXXPPPPPPP 415 P P P P PPPP Sbjct: 258 PPPSPPPPSPNPPPP 272 Score = 56.8 bits (131), Expect = 7e-07 Identities = 25/60 (41%), Positives = 25/60 (41%) Frame = -2 Query: 594 PPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P G GG PPPP P P PPPPPP P P PPPPPPP Sbjct: 193 PTGVTGPGGPTFPTPVSAPPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPP 252 Score = 44.4 bits (100), Expect = 0.004 Identities = 23/76 (30%), Positives = 24/76 (31%) Frame = -1 Query: 637 GGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPP 458 G GG PPP PPPPP P P PPPPP Sbjct: 198 GPGGPTFPTPVSAPPPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Query: 457 XXXXXXXTPPPPPPPE 410 P PPPP+ Sbjct: 258 PPPSPPPPSPNPPPPK 273 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPP PP P P PPP P Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPP-PPSPNPPPPKGP 275 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPP P PP P P Sbjct: 235 PPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSP 277 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP 433 PPPP PPPPP P P PPP P P P Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGPSPTPNNFP 283 >UniRef50_Q9VRM2 Cluster: CG10625-PB, isoform B; n=5; Fungi/Metazoa group|Rep: CG10625-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 682 Score = 68.1 bits (159), Expect = 3e-10 Identities = 48/142 (33%), Positives = 48/142 (33%) Frame = +2 Query: 377 PPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVX 556 PP P GG GG G G G G G GG G G P G G Sbjct: 502 PPAPPYVHVVGPEGGFGGNGGKGDGG-GVGPGGPGGPKGPGG----PKGPNGPNGPPGPP 556 Query: 557 XXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PP PP G G PP PP PGPP P P G P P P P Sbjct: 557 GPPGPPGPP--GPKGPTKPGPFGPPGPP--GPPGPPGPTRPGPYGPPGPPGPTGPTRPGP 612 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 P P GPP P P P Sbjct: 613 PGPPGPTRPGPPGPPGPTRPGP 634 Score = 59.7 bits (138), Expect = 9e-08 Identities = 44/136 (32%), Positives = 44/136 (32%), Gaps = 1/136 (0%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXG-GXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXX 646 APP G G G GG G G G GG GG G G P G G PG Sbjct: 504 APPYVHVVGPEGGFGGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGP-PGPP 562 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP 466 G G PP P G PP PP G P P P Sbjct: 563 GPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGP-PGPPGPTRP 621 Query: 465 PPPXPXXPXXPPPPPP 418 PP P P P PP P Sbjct: 622 GPPGPPGPTRPGPPGP 637 Score = 56.4 bits (130), Expect = 9e-07 Identities = 45/134 (33%), Positives = 46/134 (34%), Gaps = 12/134 (8%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGG--GGGGXXXXXGXGXFXXFPXXXGGGG-----GXXXVXXXXXPP 574 GG G GG G G GG G GG G P G G G P Sbjct: 521 GGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPG 580 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXP---GPPPPXPPXXGGXXXPXAPXXXAXPPPP-P 742 PP G G PP PP P GPP P P G P P P P P Sbjct: 581 PPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 640 Query: 743 XPPXP-XAGPPXPA 781 PP P GPP P+ Sbjct: 641 GPPGPTRPGPPGPS 654 Score = 56.0 bits (129), Expect = 1e-06 Identities = 43/132 (32%), Positives = 43/132 (32%), Gaps = 1/132 (0%) Frame = -2 Query: 750 GGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXXGGGGGGXXXXXXKXPPPPXXGGG 574 GG GG GG G G P GG GG GPG G G P PP G Sbjct: 515 GGFGGNGG----KGDGGGVGP---GGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGP 567 Query: 573 GGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXX 394 G P PP P P PP PP P P P PP PP Sbjct: 568 KGPTKPGPFGPPGPPGPPGPPGPTRPGPYG----PPGPPGPTGPTRPGPPGPPGPTRPGP 623 Query: 393 XGXGGGGXXXPP 358 G G PP Sbjct: 624 PGPPGPTRPGPP 635 Score = 54.4 bits (125), Expect = 4e-06 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 1/97 (1%) Frame = +2 Query: 530 GGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA 709 GG G P P GG P PP P PGPP P P G P Sbjct: 521 GGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPG 580 Query: 710 PXXXAXPPPPPXP-PXPXAGPPXPAAPXXXPPXXGXG 817 P PP P P P GPP P P P G Sbjct: 581 PPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPG 617 Score = 52.4 bits (120), Expect = 1e-05 Identities = 40/129 (31%), Positives = 40/129 (31%), Gaps = 2/129 (1%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPP-XXGGXGGGGPGXXXGGGGGGX 622 G G G GGP G GG G G G G PP G G PG G G Sbjct: 526 GGGVGPGGPGGP-KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP 584 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXK-XPXPXXXXXPPPPPPXPXX 445 P P G T PP PP P P P P P P Sbjct: 585 PGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPGPPG 644 Query: 444 PXXPPPPPP 418 P P PP P Sbjct: 645 PTRPGPPGP 653 Score = 45.6 bits (103), Expect = 0.002 Identities = 35/121 (28%), Positives = 35/121 (28%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G G G G G G G G P G G P P G Sbjct: 542 GPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGP 601 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPX 775 G PP PP PGPP P P G P P PP P P P P Sbjct: 602 PGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP----GPPGPTRPGPPGPSPND 657 Query: 776 P 778 P Sbjct: 658 P 658 Score = 44.4 bits (100), Expect = 0.004 Identities = 57/214 (26%), Positives = 57/214 (26%), Gaps = 5/214 (2%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXG--GXGGGGPGXX 646 P P G G G G G G PP G GG G Sbjct: 462 PYTPDNGKYNGNGGRYNGINDGRYYHDDSGKYVHVEGPTGPPAPPYVHVVGPEGGFGGNG 521 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP 466 G GGG P P GG G PP PP G P P P P Sbjct: 522 GKGDGGGVGPGGPGGPKGP--GGPKGPNGPNGPPGPPGPPGPPGP----PGPKGPTKPGP 575 Query: 465 --PPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXP 292 PP P P P P P G G PP P Sbjct: 576 FGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPP--------GPPGPTRPGPPGPP 627 Query: 291 GXXXXGXXPPPPXXXXPPRXPXTPXXPG-GPGXP 193 G G PP P PP P P PG P P Sbjct: 628 GPTRPG--PPGPTRPGPP-GPTRPGPPGPSPNDP 658 Score = 40.3 bits (90), Expect = 0.061 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GG G G G GGG GG G G F P GG G PP PP GG Sbjct: 254 GPNGGNGGNGGSGSGGGFGGNGGFGGVGGFG--PNGPGGPNGPKGPKGPPGPPGPP--GG 309 Query: 596 GG 601 G Sbjct: 310 LG 311 Score = 40.3 bits (90), Expect = 0.061 Identities = 30/87 (34%), Positives = 31/87 (35%), Gaps = 6/87 (6%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXX-----GAXGXXXPPXXGGXGGG-GPGX 649 P G G +G GG G GG GG GG G G PP G GG GP Sbjct: 255 PNGGNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLGP-- 312 Query: 648 XXGGGGGGXXXXXXKXPPPPXXGGGGG 568 G GGG K G G G Sbjct: 313 -VGAGGGASGKPVYKDGDRTGLGDGSG 338 Score = 39.5 bits (88), Expect = 0.11 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 4/88 (4%) Frame = -1 Query: 664 GGXGXXXGGGGGGXXGXXAXXPP--PPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXX 491 GG G G G GG G P P G G PP PP G Sbjct: 515 GGFGGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPG 574 Query: 490 PXXXXXPPPPPXXXXXXXTPP--PPPPP 413 P PP PP P PP PP Sbjct: 575 PFGPPGPPGPPGPPGPTRPGPYGPPGPP 602 Score = 37.9 bits (84), Expect = 0.33 Identities = 41/154 (26%), Positives = 41/154 (26%), Gaps = 9/154 (5%) Frame = +2 Query: 350 KKXGGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGG--GXXXXXGXGXFXXFPXX 523 K GG P P G G G G G G G G G F P Sbjct: 523 KGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGP-PGP 581 Query: 524 XGGGGGXXXVXXXXXPPP-------PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPX 682 G G PP P G G PP PP PGPP P P Sbjct: 582 PGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRPG 641 Query: 683 XGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAA 784 G P P P P PP A Sbjct: 642 PPGPTRPGPPGPSPNDPRYSDKETPGYLPPNQPA 675 Score = 37.1 bits (82), Expect = 0.57 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Frame = -2 Query: 768 GPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPP-P 592 GP G GG GG G G G GG GG GP G GG K PP P Sbjct: 254 GPNGGNGGNGGSGSGGGFGGNGG------FGGVGGFGP----NGPGGPNGPKGPKGPPGP 303 Query: 591 PXXGGGGG 568 P GG G Sbjct: 304 PGPPGGLG 311 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 68.1 bits (159), Expect = 3e-10 Identities = 37/88 (42%), Positives = 37/88 (42%), Gaps = 4/88 (4%) Frame = +2 Query: 569 PPPPPXXG---GGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G G PPPPPP P PPPP P A PPPP Sbjct: 1038 PPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPP 1097 Query: 740 PXPPXP-XAGPPXPAAPXXXPPXXGXGG 820 P PP P AG P P P PP G G Sbjct: 1098 PPPPMPGMAGMPPP--PPPPPPMPGMPG 1123 Score = 66.5 bits (155), Expect = 8e-10 Identities = 31/65 (47%), Positives = 31/65 (47%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP PPPP PP G AP A PPPP PP P PP P PP Sbjct: 1030 PPPPPP-----PPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPM 1084 Query: 806 XGXGG 820 G GG Sbjct: 1085 PGAGG 1089 Score = 65.7 bits (153), Expect = 1e-09 Identities = 35/93 (37%), Positives = 35/93 (37%), Gaps = 1/93 (1%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGG-GGGXXXXXTXXXPPPPPXXXG 514 PP G G P G GG PPPP GG G PPPPP Sbjct: 1040 PPPPPGFLPGAPAPIPGAGGP-PPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPP 1098 Query: 513 XXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPPP P P PPPPPPP Sbjct: 1099 PPPMPGMAGMPPPPPPPPPMPGMPGMPPPPPPP 1131 Score = 62.5 bits (145), Expect = 1e-08 Identities = 35/90 (38%), Positives = 35/90 (38%), Gaps = 7/90 (7%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP--- 742 P P G PPPPPP PG P P P G P P PPPPP Sbjct: 1021 PSAPAAASGPPPPPPPPPPPPPPPGFLPGAPAPIP---GAGGPPPPPPPPPPPPPPPGGL 1077 Query: 743 ---XPPXPXA-GPPXPAAPXXXPPXXGXGG 820 PP P A GPP P P PP G G Sbjct: 1078 PGAAPPMPGAGGPPPPPPPPPPPPMPGMAG 1107 Score = 58.8 bits (136), Expect = 2e-07 Identities = 35/97 (36%), Positives = 36/97 (37%), Gaps = 7/97 (7%) Frame = +2 Query: 497 GXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXG--GGGXXCXXXXXPPPPPPXXXPGPPPP 670 G P G GG PPPPP G G PPPPPP P PPPP Sbjct: 1045 GFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPP---PPPPPP 1101 Query: 671 XPPXXGGXXXPXAPXXXAX-----PPPPPXPPXPXAG 766 P G P P PPPPP P P +G Sbjct: 1102 MPGMAGMPPPPPPPPPMPGMPGMPPPPPPPMPGPASG 1138 Score = 58.0 bits (134), Expect = 3e-07 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 1/77 (1%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPP-XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 P P G GG PPPPPP PG PP P G P P P PP Sbjct: 1051 PAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGMAGMPP 1110 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 1111 PPPPPPPMPGMPGMPPP 1127 Score = 56.4 bits (130), Expect = 9e-07 Identities = 32/74 (43%), Positives = 32/74 (43%), Gaps = 4/74 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP----PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP GG P PPPPP PPPP PP G P P PPP Sbjct: 1066 PPPPPPPPPGGLPGAAPPMPGAGGPPPPP-----PPPPPPPMPGMAGMPPPP-----PPP 1115 Query: 737 PPXPPXPXAGPPXP 778 PP P P PP P Sbjct: 1116 PPMPGMPGMPPPPP 1129 Score = 55.2 bits (127), Expect = 2e-06 Identities = 39/116 (33%), Positives = 39/116 (33%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP G P P PPPPP P PPPPPPP G G P Sbjct: 1037 PPPPPPPPGFLPGAPAPIPGAGGPPPPPPPP----PPPPPPPGGLPGAAPPMPGAGGPPP 1092 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P G PPPP PP P P P P P Sbjct: 1093 PP--------------PPPPPPPMPGMAGMPPPPP---PPPPMPGMPGMPPPPPPP 1131 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/82 (30%), Positives = 25/82 (30%) Frame = -2 Query: 660 GPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXX 481 GP G PPPP G PPPPP P Sbjct: 1020 GPSAPAAASGPPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPG 1079 Query: 480 XXPPPPPPXPXXPXXPPPPPPP 415 PP P P PPPPPPP Sbjct: 1080 AAPPMPGAGGPPPPPPPPPPPP 1101 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +3 Query: 513 SPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 +P G GG P PPPP G G P PPPP P PPP PP G Sbjct: 1081 APPMPGAGG---PPPPPPPPPPPPMPGMAG--MPPPPPPPPPMPGMPGMPPPPPPPMPG 1134 Score = 41.1 bits (92), Expect = 0.035 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGX 695 P G P PPPP G A P PPPP P PPP P G Sbjct: 1021 PSAPAAASGPPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGA 1080 Query: 696 XXXXXPPGXP 725 G P Sbjct: 1081 APPMPGAGGP 1090 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP-PXXGGXXXXXXPPGXP 725 P P P G G P PPPPPP P P P GG PP P Sbjct: 1044 PGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPP 1100 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 7/70 (10%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXP-------PPPPXXXXX 443 PPPP G P P P G P P P PP P Sbjct: 1031 PPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGP 1090 Query: 442 XXTPPPPPPP 413 PPPPPPP Sbjct: 1091 PPPPPPPPPP 1100 Score = 35.1 bits (77), Expect = 2.3 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A P P G PPPP G P PPPPP P Sbjct: 1018 ATGPSAPAAASGPPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPPP--------P 1069 Query: 430 PPPPP 416 PPPPP Sbjct: 1070 PPPPP 1074 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 689 GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 G P A PPPPP PP P G P AP P G Sbjct: 1020 GPSAPAAASGPPPPPPPPPPPPPPPG-FLPGAPAPIPGAGG 1059 >UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1331 Score = 67.7 bits (158), Expect = 4e-10 Identities = 34/88 (38%), Positives = 34/88 (38%), Gaps = 5/88 (5%) Frame = +2 Query: 569 PPPPPXXGGG----GXXCXXXXXPPPPPPXXXPGPPPPXPPXXG-GXXXPXAPXXXAXPP 733 PPPPP G PPPPPP G PPP PP G P P P Sbjct: 800 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVP 859 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP PP GP P P PP G Sbjct: 860 PPPPPPLTHTGPAPPPPPPPIPPSMAPG 887 Score = 60.1 bits (139), Expect = 7e-08 Identities = 37/97 (38%), Positives = 38/97 (39%), Gaps = 14/97 (14%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP-----PPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAX 727 PPPPP G C P PPPPP PG PP PP G P P Sbjct: 765 PPPPPLPG----VCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCL 820 Query: 728 PPPPPXPPXPXAGPPXP-------AAPXXXPPXXGXG 817 PPP PP P G P P +AP PP G G Sbjct: 821 SVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMG 857 Score = 58.4 bits (135), Expect = 2e-07 Identities = 31/76 (40%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP---XXXAXPPPP 739 PPPPP G G PPPPPP PPP PP G P P PPP Sbjct: 824 PPPPPLPGMGA--------PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPP 875 Query: 740 PXPPXPXAGPPXPAAP 787 P PP P + P AP Sbjct: 876 PPPPIPPSMAPGACAP 891 Score = 51.2 bits (117), Expect = 3e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXX--PXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP PPP PP G P P PPPPP P PP P P Sbjct: 752 PPPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLP 811 Query: 800 P 802 P Sbjct: 812 P 812 Score = 51.2 bits (117), Expect = 3e-05 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPP P P P PPPPPP PPPPP Sbjct: 825 PPPPLPGMGA-------PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPPPP 877 Query: 420 PP 415 PP Sbjct: 878 PP 879 Score = 50.4 bits (115), Expect = 6e-05 Identities = 38/121 (31%), Positives = 38/121 (31%), Gaps = 5/121 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX-PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 PPPPP G P P PPPPPP P PPPPP P G Sbjct: 764 PPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLP----------GASLPPP 813 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP----PRXPXTPXXPGGPGX 196 PP L P P G PPP P P P P GP Sbjct: 814 PPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAP 873 Query: 195 P 193 P Sbjct: 874 P 874 Score = 50.0 bits (114), Expect = 8e-05 Identities = 37/124 (29%), Positives = 37/124 (29%), Gaps = 3/124 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX---PPPPPPXPXXPXXPP 430 PPPP G PPPPP P P PPPPPP P PP Sbjct: 766 PPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPP 825 Query: 429 PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXX 250 PPP P G PP P P G PPPP Sbjct: 826 PPPLPGMGAPPPPPPLPGLSAPPPP-------PPLPGMGVPPPPPPPLTHTGPAPPPPPP 878 Query: 249 XXPP 238 PP Sbjct: 879 PIPP 882 Score = 49.2 bits (112), Expect = 1e-04 Identities = 35/90 (38%), Positives = 36/90 (40%), Gaps = 7/90 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPPP G C PPPP P PPP P P P A PPPPP Sbjct: 753 PPPPPLPG----VCAPP--PPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLP 806 Query: 743 ---XPPXPXAGPPXP--AAPXXXPPXXGXG 817 PP P PP P + P PP G G Sbjct: 807 GASLPPPP---PPLPCLSVPPPPPPLPGMG 833 Score = 49.2 bits (112), Expect = 1e-04 Identities = 35/92 (38%), Positives = 35/92 (38%), Gaps = 9/92 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP---PPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP G G P PPPP PG PPPP PP P P P Sbjct: 823 PPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLT--HTGPAPP-----P 875 Query: 731 PPPPXPPXPXAG---PPXPAAPXXXPPXXGXG 817 PPPP PP G PP PP G Sbjct: 876 PPPPIPPSMAPGACAPPLAFGFGSLPPPLPLG 907 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXG--EXXKXPXXPXXXXXPPPPPXXXXXXXTPP 428 PPPP G G PPPPP G P P PPPPP PP Sbjct: 824 PPPPPLPGMGA---------PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPP 874 Query: 427 PPPPP 413 PPPPP Sbjct: 875 PPPPP 879 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXX---PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 PPPP G PPPPP G P P PPPP P Sbjct: 800 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVP 859 Query: 430 PPPPPP 413 PPPPPP Sbjct: 860 PPPPPP 865 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 APPPPP G P PPPPP L PPPPP Sbjct: 763 APPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPP 804 Score = 38.7 bits (86), Expect = 0.19 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPP P P PPPPP PPPP Sbjct: 786 PPPPPPP-----LPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPPPPP--LPGMGAPPPP 838 Query: 421 PP 416 PP Sbjct: 839 PP 840 Score = 36.3 bits (80), Expect = 1.00 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPPP G PPP P P P PPPPP Sbjct: 760 GVCAPPPPPPLP--------GVCVPTPPPLPGVC-PPPPPPPLPGVCAIPPPPPLPGASL 810 Query: 439 XTPPPPPP 416 PPPP P Sbjct: 811 PPPPPPLP 818 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXP----PPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP G P P P PPP PPP PP G PP Sbjct: 752 PPPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPP 804 >UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n=2; Danio rerio|Rep: UPI00015A5D5E UniRef100 entry - Danio rerio Length = 1093 Score = 67.7 bits (158), Expect = 4e-10 Identities = 34/88 (38%), Positives = 34/88 (38%), Gaps = 5/88 (5%) Frame = +2 Query: 569 PPPPPXXGGG----GXXCXXXXXPPPPPPXXXPGPPPPXPPXXG-GXXXPXAPXXXAXPP 733 PPPPP G PPPPPP G PPP PP G P P P Sbjct: 873 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVP 932 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP PP GP P P PP G Sbjct: 933 PPPPPPLTHTGPAPPPPPPPIPPSMAPG 960 Score = 60.1 bits (139), Expect = 7e-08 Identities = 37/97 (38%), Positives = 38/97 (39%), Gaps = 14/97 (14%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP-----PPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAX 727 PPPPP G C P PPPPP PG PP PP G P P Sbjct: 838 PPPPPLPG----VCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCL 893 Query: 728 PPPPPXPPXPXAGPPXP-------AAPXXXPPXXGXG 817 PPP PP P G P P +AP PP G G Sbjct: 894 SVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMG 930 Score = 58.4 bits (135), Expect = 2e-07 Identities = 31/76 (40%), Positives = 32/76 (42%), Gaps = 3/76 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP---XXXAXPPPP 739 PPPPP G G PPPPPP PPP PP G P P PPP Sbjct: 897 PPPPPLPGMGA--------PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPP 948 Query: 740 PXPPXPXAGPPXPAAP 787 P PP P + P AP Sbjct: 949 PPPPIPPSMAPGACAP 964 Score = 51.2 bits (117), Expect = 3e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXX--PXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP PPP PP G P P PPPPP P PP P P Sbjct: 825 PPPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLP 884 Query: 800 P 802 P Sbjct: 885 P 885 Score = 51.2 bits (117), Expect = 3e-05 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPP P P P PPPPPP PPPPP Sbjct: 898 PPPPLPGMGA-------PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPPPPP 950 Query: 420 PP 415 PP Sbjct: 951 PP 952 Score = 50.4 bits (115), Expect = 6e-05 Identities = 38/121 (31%), Positives = 38/121 (31%), Gaps = 5/121 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX-PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 PPPPP G P P PPPPPP P PPPPP P G Sbjct: 837 PPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLP----------GASLPPP 886 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP----PRXPXTPXXPGGPGX 196 PP L P P G PPP P P P P GP Sbjct: 887 PPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAP 946 Query: 195 P 193 P Sbjct: 947 P 947 Score = 50.0 bits (114), Expect = 8e-05 Identities = 37/124 (29%), Positives = 37/124 (29%), Gaps = 3/124 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX---PPPPPPXPXXPXXPP 430 PPPP G PPPPP P P PPPPPP P PP Sbjct: 839 PPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPP 898 Query: 429 PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXX 250 PPP P G PP P P G PPPP Sbjct: 899 PPPLPGMGAPPPPPPLPGLSAPPPP-------PPLPGMGVPPPPPPPLTHTGPAPPPPPP 951 Query: 249 XXPP 238 PP Sbjct: 952 PIPP 955 Score = 49.2 bits (112), Expect = 1e-04 Identities = 35/90 (38%), Positives = 36/90 (40%), Gaps = 7/90 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPPP G C PPPP P PPP P P P A PPPPP Sbjct: 826 PPPPPLPG----VCAPP--PPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPPLP 879 Query: 743 ---XPPXPXAGPPXP--AAPXXXPPXXGXG 817 PP P PP P + P PP G G Sbjct: 880 GASLPPPP---PPLPCLSVPPPPPPLPGMG 906 Score = 49.2 bits (112), Expect = 1e-04 Identities = 35/92 (38%), Positives = 35/92 (38%), Gaps = 9/92 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP---PPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP G G P PPPP PG PPPP PP P P P Sbjct: 896 PPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLT--HTGPAPP-----P 948 Query: 731 PPPPXPPXPXAG---PPXPAAPXXXPPXXGXG 817 PPPP PP G PP PP G Sbjct: 949 PPPPIPPSMAPGACAPPLAFGFGSLPPPLPLG 980 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXG--EXXKXPXXPXXXXXPPPPPXXXXXXXTPP 428 PPPP G G PPPPP G P P PPPPP PP Sbjct: 897 PPPPPLPGMGA---------PPPPPPLPGLSAPPPPPPLPGMGVPPPPPPPLTHTGPAPP 947 Query: 427 PPPPP 413 PPPPP Sbjct: 948 PPPPP 952 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXX---PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 PPPP G PPPPP G P P PPPP P Sbjct: 873 PPPPPLPGASLPPPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVP 932 Query: 430 PPPPPP 413 PPPPPP Sbjct: 933 PPPPPP 938 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 APPPPP G P PPPPP L PPPPP Sbjct: 836 APPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPP 877 Score = 38.7 bits (86), Expect = 0.19 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPP P P PPPPP PPPP Sbjct: 859 PPPPPPP-----LPGVCAIPPPPPLPGASLPPPPPPLPCLSVPPPPPP--LPGMGAPPPP 911 Query: 421 PP 416 PP Sbjct: 912 PP 913 Score = 36.3 bits (80), Expect = 1.00 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPPP G PPP P P P PPPPP Sbjct: 833 GVCAPPPPPPLP--------GVCVPTPPPLPGVC-PPPPPPPLPGVCAIPPPPPLPGASL 883 Query: 439 XTPPPPPP 416 PPPP P Sbjct: 884 PPPPPPLP 891 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXP----PPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP G P P P PPP PPP PP G PP Sbjct: 825 PPPPPPLPGVCAPPPPPPLPGVCVPTPPPLPGVCPPPPPPPLPGVCAIPPPPP 877 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 67.7 bits (158), Expect = 4e-10 Identities = 31/64 (48%), Positives = 31/64 (48%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP GPPPP PP P A PPPPP PP P GPP P P P Sbjct: 363 PPPPPPPGFLGPPPPPPP-------PLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGL 415 Query: 806 XGXG 817 G G Sbjct: 416 PGAG 419 Score = 66.9 bits (156), Expect = 6e-10 Identities = 38/84 (45%), Positives = 38/84 (45%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG------PPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP G G PPPPPP PG PPPP PP GG P P Sbjct: 363 PPPPPPPGFLG--------PPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPP-------PP 407 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P P AGPP P P P Sbjct: 408 PPPPPPGLPGAGPPPPPPPPGCGP 431 Score = 60.1 bits (139), Expect = 7e-08 Identities = 34/81 (41%), Positives = 34/81 (41%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G G PPPPPP PG PPPP PP P A PPPP Sbjct: 377 PPPPPLPGNTGAP------PPPPPPPPLPGGGPPPPPPPP-------PPPGLPGAGPPPP 423 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP PP P P Sbjct: 424 PPPPGCGPPPPPPMGSFGQKP 444 Score = 58.0 bits (134), Expect = 3e-07 Identities = 30/74 (40%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GGG PPPPPP PG PP PP G P P + P P Sbjct: 392 PPPPPPLPGGG----PPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPPMGSFGQKPENP 447 Query: 749 P-XPXAGPPXPAAP 787 P P P P P Sbjct: 448 PRKPTIEPNCPMKP 461 Score = 55.2 bits (127), Expect = 2e-06 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 2/63 (3%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX--PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXX 367 PPPPP G P P PPPPPP P P PPPPPP G G Sbjct: 365 PPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPP 424 Query: 366 XPP 358 PP Sbjct: 425 PPP 427 Score = 49.6 bits (113), Expect = 1e-04 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXPPP 427 PPPP G G PPPPP G P P P PPP P P PP Sbjct: 378 PPPPLPGNTGAPPPP-----PPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPP 432 Query: 426 PPPP 415 PPPP Sbjct: 433 PPPP 436 Score = 49.2 bits (112), Expect = 1e-04 Identities = 31/90 (34%), Positives = 31/90 (34%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P G G PPPP GGG PPPPP G Sbjct: 366 PPPPGFLGPPPPPPPPLPGNTGAPPPPP--PPPPLPGGG-----PPPPPPPPPPPGLPGA 418 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P P PPPPPP P PP Sbjct: 419 GPPPPPPPPGCGPPPPPPMGSFGQKPENPP 448 Score = 46.8 bits (106), Expect = 7e-04 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 8/70 (11%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP---PPPPPXPXXP---- 442 PPPP G G PPPPP P P P PPPPP P P Sbjct: 364 PPPPPPGFLG-------PPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLP 416 Query: 441 -XXPPPPPPP 415 PPPPPPP Sbjct: 417 GAGPPPPPPP 426 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = -1 Query: 628 GXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXX 449 G G PPPP GGG PPPPP G P P PPPPP Sbjct: 384 GNTGAPPPPPPPPPLPGGGPPPP----PPPPPPPGLPGAGPPPPPPPPGCGPPPPPPMGS 439 Query: 448 XXXXTPPPPPPP 413 PP P Sbjct: 440 FGQKPENPPRKP 451 Score = 45.2 bits (102), Expect = 0.002 Identities = 41/131 (31%), Positives = 41/131 (31%), Gaps = 1/131 (0%) Frame = -2 Query: 582 GGGGGXXXXXTXXXPPPPPXXX-GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXX 406 GGGG T P G K P PPPPPP P PPPPPPP Sbjct: 328 GGGGSLAPSPTQALPKKLNLDAIGLNLKAGAPPP---PPPPPPPPGFLGPPPPPPPPL-- 382 Query: 405 XXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPX 226 G G PP P PG PPPP P P Sbjct: 383 ------PGNTGAPPPP---------------PPPPPLPGGGPPPPPPPPPPPGLPGAGPP 421 Query: 225 TPXXPGGPGXP 193 P P G G P Sbjct: 422 PPPPPPGCGPP 432 Score = 43.2 bits (97), Expect = 0.009 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 4/70 (5%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX-PPPPPXXXXXXXT 434 A PPPP G PPP P G P P PPPPP Sbjct: 356 AGAPPPPPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGL 415 Query: 433 P---PPPPPP 413 P PPPPPP Sbjct: 416 PGAGPPPPPP 425 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 534 GGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 GGG P PPPP G G PPPPPP P PPP Sbjct: 400 GGGPPPPPPP--PPPPGLPGAG-------PPPPPPPPGCGPPPPP 435 Score = 36.7 bits (81), Expect = 0.75 Identities = 27/90 (30%), Positives = 27/90 (30%), Gaps = 1/90 (1%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P GG PPPP G G PPPPP G Sbjct: 380 PPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAG--------PPPPPPPPGCGP 431 Query: 510 XXKXPXPXXXXXPPPPPPXP-XXPXXPPPP 424 P P PP P P P P Sbjct: 432 PPPPPMGSFGQKPENPPRKPTIEPNCPMKP 461 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX------PXPPPXXPP 680 P PPPP GGG P PPPPPP P PPP P Sbjct: 389 PPPPPPPPPLPGGG----PPPPPPPPPPPGLPGAGPPPPPPPPGCGP 431 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 G PPP PP P P PPPPP P P G P PP GG Sbjct: 357 GAPPPPPP-------PPPPPGFLGPPPPP--PPPLPGNTGAPPPPPPPPPLPGGG 402 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 67.3 bits (157), Expect = 5e-10 Identities = 32/77 (41%), Positives = 33/77 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PPPP PP P +P PPPPP P Sbjct: 222 PPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPP---PPPPSPPPPPPPPPPPPP 278 Query: 749 PXPXAGPPXPAAPXXXP 799 P PP PA P P Sbjct: 279 PLLPPLPPFPAKPPMSP 295 Score = 56.0 bits (129), Expect = 1e-06 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP PPPPP P P PPPPPP P P PPPPPP Sbjct: 222 PPPPPSASSPPSSPSPSPRPPPPPMPP----PPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Query: 417 P 415 P Sbjct: 278 P 278 Score = 55.6 bits (128), Expect = 2e-06 Identities = 23/56 (41%), Positives = 24/56 (42%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P PP P P P PPPPP PP P PP P+ P PP Sbjct: 217 PPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPP 272 Score = 55.6 bits (128), Expect = 2e-06 Identities = 25/61 (40%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PP PPPP PP P P P PPPPP PP P + PP P P P Sbjct: 218 PPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Query: 800 P 802 P Sbjct: 278 P 278 Score = 54.8 bits (126), Expect = 3e-06 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = +2 Query: 608 CXXXXXPPPPP--PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA 781 C P PPP P PP PP P +P PPPPP PP P PP P Sbjct: 199 CIEGLYPSPPPVTPAVRRPPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPP 258 Query: 782 APXXXP 799 P P Sbjct: 259 PPPPPP 264 Score = 49.2 bits (112), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PP PP P Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFP 288 Score = 48.8 bits (111), Expect = 2e-04 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPPP P P P PPPP P P PPP Sbjct: 222 PPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLL 281 Query: 420 PP 415 PP Sbjct: 282 PP 283 Score = 46.8 bits (106), Expect = 7e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PP P P Sbjct: 250 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKP 291 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP P P PPP PP PP P Sbjct: 219 PSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPPP P P PPPPP PPPPPPP Sbjct: 221 SPPPPPSASSPPSS---PSPSPRPPPPPMPPPPPPPPPPPPPP 260 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 222 PPPPP----SASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPP 260 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPPPP P PPP PP PP P Sbjct: 217 PPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPP 272 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PP P P PPPPPPP Sbjct: 217 PPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPP 256 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P P PPPPP P P P PP Sbjct: 253 PPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPP 292 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP-PXXPP 680 P PPPP P PPPPPP P PP P PP Sbjct: 251 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPP 292 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPP--PPXPXXPXXPPPPP 421 PPPPP P P PPPP PP P P PP P Sbjct: 254 PPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP--XPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PP P Sbjct: 252 PPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKPPMSP 295 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P PPPPPP P PPP PP PP P Sbjct: 225 PPSASSPPSSPSPSPRPPPPPMPPPPPPP---PPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PP P P Sbjct: 249 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPPFPAKP 291 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + P PPPPPP PPP PP Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPP-----PPPLLPP 283 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP P P P PP P P PPP PPP Sbjct: 208 PPVTPAVRRPPPSSPPPPPSASSPPSSPSPSPRPPPPPMPPP 249 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 67.3 bits (157), Expect = 5e-10 Identities = 31/79 (39%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPPP PP P PPP PP P P PPPP Sbjct: 814 PPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPS 873 Query: 743 XPPXPXAGPPXPAAPXXXP 799 PP P PP P +P P Sbjct: 874 PPPSPPPSPPPPPSPPPPP 892 Score = 65.7 bits (153), Expect = 1e-09 Identities = 30/77 (38%), Positives = 32/77 (41%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PP PPP P PPP PP P +P PPPPP PP Sbjct: 805 PPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPS-PSPPPSPPPAPSPPPPPNPP 863 Query: 752 XPXAGPPXPAAPXXXPP 802 PP P+ P PP Sbjct: 864 PAPTPPPPPSPPPSPPP 880 Score = 64.1 bits (149), Expect = 4e-09 Identities = 27/60 (45%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA-APXXXPP 802 PPP PP P P PP PP P P PPPPP PP P + PP P+ +P PP Sbjct: 792 PPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPP 851 Score = 64.1 bits (149), Expect = 4e-09 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPP PP PPPP PP P +P PPP P P Sbjct: 797 PSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSP 856 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P P Sbjct: 857 PPPPNPPPAPTPPPPPSP 874 Score = 62.1 bits (144), Expect = 2e-08 Identities = 30/81 (37%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP---PXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PP P P P PPP P PP P +P PPPP Sbjct: 832 PPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPP 891 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP + PP P PP Sbjct: 892 PSPPPSPSPPPSSNPPLSSPP 912 Score = 59.3 bits (137), Expect = 1e-07 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP PPPP PP P P PP PP PP P P P P PP Sbjct: 789 PSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPP 847 Score = 58.0 bits (134), Expect = 3e-07 Identities = 28/79 (35%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPP P P PPP P +P + PPPP P Sbjct: 870 PPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSP 929 Query: 749 PXPXAG-PPXPAAPXXXPP 802 P P PP P P PP Sbjct: 930 PPPSPPLPPSPPLPPNPPP 948 Score = 56.0 bits (129), Expect = 1e-06 Identities = 26/60 (43%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PP PP P +P PP PP PP P + PP P++P P Sbjct: 787 PPPSPP--PPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSP 844 Score = 56.0 bits (129), Expect = 1e-06 Identities = 29/80 (36%), Positives = 32/80 (40%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX--AXPPPPP 742 PPP P PP PPP P PPP PP P P + PPPP Sbjct: 828 PPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPS 887 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P + PP P+ P P Sbjct: 888 -PPPPPSPPPSPSPPPSSNP 906 Score = 55.6 bits (128), Expect = 2e-06 Identities = 28/80 (35%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPX--XXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PP PPP P PPPP P P + + PPP Sbjct: 856 PPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLS 915 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P + PP P++P P Sbjct: 916 SPP-PLSSPPPPSSPPPPSP 934 Score = 54.0 bits (124), Expect = 5e-06 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP P PPPP P PPP PP P +P PPP P Sbjct: 847 PPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNP 906 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P PP Sbjct: 907 PLSSPPPLSSPPPLSSPP 924 Score = 54.0 bits (124), Expect = 5e-06 Identities = 29/81 (35%), Positives = 31/81 (38%), Gaps = 4/81 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPP---P 736 PPPPP PPPP P P PPP P PP P + PP P Sbjct: 868 PPPPPSP----PPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSP 923 Query: 737 PPXPPXPXAGPPXPAAPXXXP 799 PP P PP P +P P Sbjct: 924 PPPSSPPPPSPPLPPSPPLPP 944 Score = 51.2 bits (117), Expect = 3e-05 Identities = 37/136 (27%), Positives = 38/136 (27%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP T PPPPP P P PP PPP P P P PPP Sbjct: 806 PPPPPPPSPPPPPNPPTPPSPPPPPSPP-PPPSSPPPPSPSPPPSPPPAPSPPPPPNPPP 864 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P PP P PPP P Sbjct: 865 APTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPP 924 Query: 240 PRXPXTPXXPGGPGXP 193 P P +P P P P Sbjct: 925 P--PSSPPPPSPPLPP 938 Score = 50.8 bits (116), Expect = 4e-05 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 1/117 (0%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPP-PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 PPP P P P PPPP PP P P PP PPPP Sbjct: 787 PPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSP 846 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP P P PPP PP P P P P P Sbjct: 847 PPS--PPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPP 901 Score = 48.8 bits (111), Expect = 2e-04 Identities = 30/71 (42%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPP-PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPP PP PP P P PPPP P P PPPP PP Sbjct: 917 PPPLSSPPPPSSPPPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSPP 976 Query: 752 XPXAGPPXPAA 784 P PP AA Sbjct: 977 LPPP-PPLEAA 986 Score = 47.6 bits (108), Expect = 4e-04 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP---PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 P PPP PPP PPP P PPP PP P P PPPP Sbjct: 892 PSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSP-PPPSSPPPPSPPLPPSPPLPPNPPPPP 950 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P P PP Sbjct: 951 SPSPXXXXXXXPPRLPTPSPP 971 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPP P P PP PP P P P PPP Sbjct: 889 PPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPNPPP 948 Query: 420 PP 415 PP Sbjct: 949 PP 950 Score = 44.8 bits (101), Expect = 0.003 Identities = 24/60 (40%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PP PP PP P +P P P P PP P+ P PP Sbjct: 923 PPPPSSPPPPSPPLPPSPPLPPNPPPPPSPSPXXXXXXXP-PRLPTPSPPPPSPPLPPPP 981 Score = 42.7 bits (96), Expect = 0.011 Identities = 30/111 (27%), Positives = 32/111 (28%), Gaps = 3/111 (2%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP--PPPXXXXXXXXGXGGGGXXXPPXFFFL 343 G + P P PP PP P P PPPP PPP PP Sbjct: 781 GQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPP 840 Query: 342 XXXXXXXXXXXXXXPXPGXXXXGXXP-PPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPP PP P +P P P P Sbjct: 841 PPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPP 891 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PP PPP P PPP PP PP P Sbjct: 824 PSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPP 879 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXP-PPPPXXLXXXXNPPPPPPP 414 +PPPPP P P P PPPP PPPPP P Sbjct: 831 SPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSP 874 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/60 (33%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPP 716 G P PPPP + P PPP PPP P PP PP PP Sbjct: 781 GQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPP 840 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP P PP PPP P PPP PP PP Sbjct: 800 PPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPP 852 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P P PP P PPPPP P PPP PP PP Sbjct: 844 PSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPP 896 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PPPPP P P P PP PP P Sbjct: 808 PPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPP 863 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPP P P PPP P PP P Sbjct: 834 PPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPP 889 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PP P P P PPP P PP P Sbjct: 828 PPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPP 883 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PP P P P PPP PP PP P Sbjct: 840 PPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPP 895 Score = 38.3 bits (85), Expect = 0.25 Identities = 22/39 (56%), Positives = 22/39 (56%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPPP P P PPPP P P PPPP Sbjct: 946 PPPPPSPSPXXXXXXXPPRLPTPSPPPPSP--PLPPPPP 982 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PP PP P P P PP PP P Sbjct: 796 PPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPP 851 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPP P PP PP PP P Sbjct: 807 PPPPPPSPPPPPNPPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNP 862 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P P PP P PPP P P PPP PP PP Sbjct: 850 PPPAPSPPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPP 902 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP + P PPPP P P PPP P PP Sbjct: 864 PAPTPPPPPSP----PPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPP 912 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP P PPPP P P PPP P PP Sbjct: 866 PTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPP 918 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 707 APXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 +P PP PP PP P + PP P P PP Sbjct: 786 SPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPP 817 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPP-PXXLXXXXNPPPPPPP 414 +PPP P P P PPPP P PP PPPP Sbjct: 786 SPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPPSPPPP 829 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 2/68 (2%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PPPPP P PPP P Sbjct: 865 APTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLSSPPPLSSPP 924 Query: 430 PP--PPPP 413 PP PPPP Sbjct: 925 PPSSPPPP 932 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P P PPP P P P PP PP P Sbjct: 820 PPTPPSPPPPPSPPPPPSSPPPPSPSPPPSPPPAPSPPPPPNPPPAPTPPPPPSPP 875 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PPP P P PP PP P P PPP P Sbjct: 895 PPSPSPPPSSNPPLSSPPPLSSPPPLSSPPPPSSPPPPSPPLPPSPPLPPNPP--PPPSP 952 Query: 420 PP 415 P Sbjct: 953 SP 954 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP-- 425 PPP PP PP P P P PPP +PPP Sbjct: 856 PPPPPNPPPAPTPPPPPSPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSSNPPLSSPPPLS 915 Query: 424 PPPP 413 PPP Sbjct: 916 SPPP 919 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP PPPPP P P PPPPP PP Sbjct: 848 PSPPPAPSPPPPPNPPPAPTPPPPP---SPPPSPPPSPPPPPSPPPPPSPPPSPSPPPSS 904 Query: 421 PPP 413 PP Sbjct: 905 NPP 907 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 594 GGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 G + P PPP PP P P P PP PP P Sbjct: 781 GQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPPNPPTPP 824 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPP 680 P PPPP P P P PPP P PPP PP Sbjct: 943 PPNPPPPPSPSPXXXXXXXPPRLPTPSPPPPSPPLPPP--PP 982 >UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 2146 Score = 67.3 bits (157), Expect = 5e-10 Identities = 31/79 (39%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX-PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPP PPPP P P PPPP PP P P + PPP P Sbjct: 889 PPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPP 948 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P PP P P PP Sbjct: 949 PPSPPPLPPPPPPPSPPPP 967 Score = 62.9 bits (146), Expect = 1e-08 Identities = 25/59 (42%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP P PPPP PP P + PPP P P P + PP P P PP Sbjct: 887 PSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPP 945 Score = 56.8 bits (131), Expect = 7e-07 Identities = 26/73 (35%), Positives = 28/73 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPPP P PP P PP P +P + PP PP P Sbjct: 900 PPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPP 959 Query: 749 PXPXAGPPXPAAP 787 P P PP P Sbjct: 960 PPPSPPPPVDECP 972 Score = 55.2 bits (127), Expect = 2e-06 Identities = 24/57 (42%), Positives = 26/57 (45%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P PPPP PP P P + PPPP P P PP P+ P PP Sbjct: 878 PSPP---PSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPP 931 Score = 54.4 bits (125), Expect = 4e-06 Identities = 24/59 (40%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPP P PPPP P P +P + PPP P PP P PP P +P P Sbjct: 878 PSPPPSPPPPSPPPPSPLP---SPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSP 933 Score = 53.2 bits (122), Expect = 8e-06 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP + PPP P P P PPP PP P P PPPPP Sbjct: 901 PSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPP 960 Query: 420 PP 415 PP Sbjct: 961 PP 962 Score = 51.6 bits (118), Expect = 2e-05 Identities = 27/65 (41%), Positives = 27/65 (41%), Gaps = 6/65 (9%) Frame = +2 Query: 626 PPPPPPXXXPGP-PPPXPP--XXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP---AAP 787 PPP PP P P PPP PP P P P PPP PP PP P A P Sbjct: 731 PPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPPPPVAVP 790 Query: 788 XXXPP 802 PP Sbjct: 791 SPSPP 795 Score = 49.2 bits (112), Expect = 1e-04 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP PPP P P P PPP PP P P PPPPP Sbjct: 880 PPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPV 939 Query: 417 P 415 P Sbjct: 940 P 940 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +2 Query: 626 PPPPPPXXXPGP-PPPXPP--XXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 PPP PP P P PPP PP P P P PPP PP P P P Sbjct: 718 PPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVE 777 Query: 797 PP 802 P Sbjct: 778 VP 779 Score = 48.4 bits (110), Expect = 2e-04 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +2 Query: 626 PPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPP PP P P PPP PP P P PPP PP P P P Sbjct: 744 PPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPPPPVAVPSPSPPILP 798 Score = 46.0 bits (104), Expect = 0.001 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXA--PXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPP PP P P PP P P P P PPP PP P P P Sbjct: 680 PPPSPPIVQPSPSPPPPVEVPSPSPPSPSPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEV 739 Query: 800 P 802 P Sbjct: 740 P 740 Score = 45.2 bits (102), Expect = 0.002 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +2 Query: 626 PPPPPPXXXPGP-PPPXPP--XXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 P P PP P P PPP PP P P P PPP PP P P P Sbjct: 705 PSPSPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVE 764 Query: 797 PP 802 P Sbjct: 765 VP 766 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXP----PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 P PPPP P P PP P P P P PPP PP P P P Sbjct: 691 PSPPPPVEVPSPSPPSPSPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPV 750 Query: 794 XPP 802 P Sbjct: 751 EVP 753 Score = 44.8 bits (101), Expect = 0.003 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXP-PPPPXXXGEXXKXPXXPXXXXXPPPP-PXXXXXXXTPP 428 PPPP P PPPP P P PPPP P PP Sbjct: 898 PPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPP 957 Query: 427 PPPPP 413 PPPPP Sbjct: 958 PPPPP 962 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P P PPP P PPPPPP Sbjct: 745 PPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPPPP 786 Score = 41.5 bits (93), Expect = 0.026 Identities = 24/69 (34%), Positives = 25/69 (36%), Gaps = 7/69 (10%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPPPP----PXPXXP 442 PPPP + PPP PP P P PPPPP P P P Sbjct: 889 PPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPP 948 Query: 441 XXPPPPPPP 415 PPP PP Sbjct: 949 PPSPPPLPP 957 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPPPP P PP PP PP P Sbjct: 916 PSPSPPPP------SPPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPP 965 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPP------PPPPXPXXPXXPPPPPPP 415 P PPP P P PP PPPP P P PPPP P Sbjct: 878 PSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSP 925 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPP +PPPP PP Sbjct: 884 PPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPP 926 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPPXXXXXXXXXXGG 378 PPPPP P P PPPPP PP PPPP GG Sbjct: 934 PPPPPVPSPPPPSPPPPSPPPLPPPPP--------PPSPPPPVDECPTLRLVGG 979 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P P PPPP PPPPPP Sbjct: 896 PSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPP 938 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PP PPPP Sbjct: 933 PPPPPPVPSPPPPSPPPPSPPPLPPPPP--------PPSPPPP 967 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPPXP-PXPXAGPPXPAAPXXXP 799 PP P P P P P P P P P P P P P P PP ++P Sbjct: 1858 PPSPSPPPTPSPTPSPTPSPTPSPTPSPTPSPTPTPTPSPTPTPTPTPTPPTESSPTPPA 1917 Query: 800 P 802 P Sbjct: 1918 P 1918 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PP P PP PP PP P Sbjct: 904 PSPSPPPP------SPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSPP 953 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXP--XXPXXPPPPPPP 415 PPP P P P P PP P P P PPP PP Sbjct: 680 PPPSPPIVQPSPSPPPPVEVPSPSPPSPSPPVEVPSPSPPPQPP 723 Score = 36.3 bits (80), Expect = 1.00 Identities = 28/101 (27%), Positives = 28/101 (27%), Gaps = 1/101 (0%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXX 313 P PPPP P P P PPPP P PP L Sbjct: 878 PSPPPSPPPPSPPPPSPLPSPPPPSPPSPS-------------PPPPSPLPPSPSPPPPS 924 Query: 312 XXXXPXPGXXXXGXXP-PPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPP PP P P P P P Sbjct: 925 PPSPSPPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPP 965 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX-PXPPPXXPPXXGGXXXXXXPP 716 P PPPP + PPPP P P PPP PP PP Sbjct: 885 PPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPP 938 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P P PPP +P PPP P Sbjct: 693 PPPPVEVPSPSPPSPSPPVEVPSPSPPPQPPVEVPSPSPPPQP 735 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP P P P PPP +P PPP P Sbjct: 719 PPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQP 761 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP P P P PPP +P PPP P Sbjct: 732 PPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQP 774 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPP PPP P P P PP PP Sbjct: 873 GLSCFPSPPPSPPPPSPPPPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSP---- 928 Query: 439 XTPPPPPPP 413 +PP PPPP Sbjct: 929 -SPPSPPPP 936 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P PPPP P PP PPP P PPP Sbjct: 930 PPSPPPPPPVPSPPPPSPPPPSPPPLPPPPPPPSPPP 966 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPP PP P PP PP P P Sbjct: 880 PPPSPPPPSPP----PPSPLPSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPP 931 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P P PP P P P P PP Sbjct: 678 PSPPPSPPIVQPSPSPPPPVEVPSPSPPSPSPPVEVPSPSPP 719 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P P P P P P P P PP Sbjct: 691 PSPPPPVEVPSPSPPSPSPPVEVPSPSPPPQPPVEVPSPSPP 732 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP-PXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPP P PP P PP PP P Sbjct: 896 PSPPPPSPPSPSPPPPSPLPPSPSPPPPSPPSPSPPSPPPPPPVPSPPPPSPPPPSP 952 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP PP P P PPPPP P PP P Sbjct: 758 PPQPPVEVPSPSPPPQPPVEVPSPPPPPPVAVPSPSPPILP 798 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PP P P P PPP +P PPP P Sbjct: 707 PSPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQP 748 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -3 Query: 542 APPPPP----XXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 +P PPP P P P PPP +PPPPPP Sbjct: 741 SPSPPPQPPVEVPSPSPPPQPPVEVPSPSPPPQPPVEVPSPPPPPP 786 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPP P P PP P Sbjct: 757 PPPQPPVEVPSPSPPPQPPVEVPSPPPPPPVAVPSPSPPILP 798 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 66.9 bits (156), Expect = 6e-10 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP P P PPPPP PP P PP P P PP Sbjct: 234 PPPPPPPPPPPPPPPPPP------PPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 66.5 bits (155), Expect = 8e-10 Identities = 27/57 (47%), Positives = 27/57 (47%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP P PPPP PP P P PPPPP PP P PP P P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLP 290 Score = 66.1 bits (154), Expect = 1e-09 Identities = 27/58 (46%), Positives = 28/58 (48%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP P PPPP PP P P P PPP PP P PP P+ P P Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLP 294 Score = 58.4 bits (135), Expect = 2e-07 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P PPPP PP P P PPPPP PP P PP P P PP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP--PPLPPPPPPPPP 281 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 54.8 bits (126), Expect = 3e-06 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPPPPP P P PPPPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPP PPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PP PPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P P PPPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPP P Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLP 283 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/73 (39%), Positives = 29/73 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPP---PPPPPPPPP----PLPPPPPPPPPLPPPPPSL 289 Query: 749 PXPXAGPPXPAAP 787 P P AP Sbjct: 290 PLPLPTTSATVAP 302 Score = 51.6 bits (118), Expect = 2e-05 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P PPPPPP P P PPPPPPP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P PPPPPP P P PPPPPPP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P P PP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPP P P P P PPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P PPPP P Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLP 290 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PP P P Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLP 292 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P P P P Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPL 293 Query: 420 P 418 P Sbjct: 294 P 294 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/68 (32%), Positives = 23/68 (33%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PPPP PP P PP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAPPSTSQ 307 Query: 749 PXPXAGPP 772 P + P Sbjct: 308 PTQLSTTP 315 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PP PPPP Sbjct: 248 PPPPPP----PPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP P PPPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPLPPPPP-----PPPPLPPPPP 287 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPP P P P Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATVAP 302 Query: 420 P 418 P Sbjct: 303 P 303 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPP T Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPPPSLPLPLPTTSATV 300 Query: 421 PPP 413 PP Sbjct: 301 APP 303 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 66.9 bits (156), Expect = 6e-10 Identities = 35/86 (40%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP--PPP 742 PPPPP PPPPPP PPPP PP G P P PP PPP Sbjct: 608 PPPPPVKSA-------PLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPP 660 Query: 743 XPPXPXA---GPPXPAAPXXXPPXXG 811 PP P + GPP P P P G Sbjct: 661 PPPPPGSKAGGPPPPPPPGAPQPPGG 686 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PP P P PPPP PP P P PPPP PP AGPP P P P Sbjct: 596 PPNAPSLPPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPP 655 Query: 809 G 811 G Sbjct: 656 G 656 Score = 57.2 bits (132), Expect = 5e-07 Identities = 31/76 (40%), Positives = 31/76 (40%), Gaps = 6/76 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP G PPPPPP P GPPPP PP P P P P Sbjct: 633 PPPPPMKAG---------PPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQP 683 Query: 737 P--PXPPXPXAGPPXP 778 P PP P PP P Sbjct: 684 PGGSAPPPPFGAPPQP 699 Score = 56.0 bits (129), Expect = 1e-06 Identities = 38/117 (32%), Positives = 38/117 (32%), Gaps = 1/117 (0%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP P PPPPPPP GG P Sbjct: 608 PPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPP------GGPPPP 661 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXP-GGPGXP 193 P PG G PPPP P P P G P P Sbjct: 662 PP-------------------PPGSKAGGPPPPPPPGAPQPPGGSAPPPPFGAPPQP 699 Score = 46.4 bits (105), Expect = 0.001 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP PPP PP G PPG P Sbjct: 603 PPPPPPPPPPVKSA------PLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVP 652 Score = 43.6 bits (98), Expect = 0.007 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P PPP PP P P A PPPP PP A PP P P P Sbjct: 593 PQQPPNAPSLPPPPPP-------PPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGP 642 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G P PP P PPPPPP P PP Sbjct: 631 PPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQPPGGSAPP 690 Query: 420 PP 415 PP Sbjct: 691 PP 692 Score = 38.7 bits (86), Expect = 0.19 Identities = 28/96 (29%), Positives = 28/96 (29%), Gaps = 2/96 (2%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX 295 P PP P P PPPPPPP PP P Sbjct: 593 PQQPPNAPSLPPPPPPPPPPVKSAPLPPPPPPPKIAAPPP----PPPPPMKAGPPPPPPP 648 Query: 294 PG--XXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PG G PPPP P P PG P P Sbjct: 649 PGVPRPPGGPPPPPPPPGSKAGGPPPPPPPGAPQPP 684 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 Query: 491 PXXXPXPPPPPXXLXXXXNPPPPPPP 414 P P PPPPP + PPPPPPP Sbjct: 600 PSLPPPPPPPPPPVKSAPLPPPPPPP 625 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 P P PPPPP PPPPPPP+ Sbjct: 597 PNAPSLPPPPPPPPPPVKSAPLPPPPPPPK 626 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXP------XXXPXPPPPPXXLXXXXNPPPPPPP 414 AP PPP P P PPPPP PPPPPPP Sbjct: 616 APLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPP 664 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXP-----XXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP + P P PPPPP PPPPPPP Sbjct: 617 PLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPP 664 Score = 35.5 bits (78), Expect = 1.7 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP G P PPPPPP P PPP P G P G P Sbjct: 643 PPPPPPPGVPRPPGGPP--PPPPPPGSKAGGPPPPPPPGAPQPPGGSAPPPPFGAP 696 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP GG P PPPPP PPP PP PP Sbjct: 643 PPPPPPPGVPRPPGG-----PPPPPPPPGSKAGGPPPPPPPGAPQPPGGSAPP 690 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 558 PXXXPPPPXXXG--GGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP G GG P P PP P PP PP Sbjct: 655 PGGPPPPPPPPGSKAGGPPPPPPPGAPQPPGGSAPPPPFGAPP 697 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP-PXXPPXXGGXXXXXXPPG 719 P PPPP A P PPP P PP P P GG PPG Sbjct: 617 PLPPPPPPPKIA-----APPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPG 666 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP--PPPPXXXPXPPPXXPP 680 P PPPP G P PP P PP PPP P Sbjct: 654 PPGGPPPPPPPPGSKAGGPPPPPPPGAPQPPGGSAPPPPFGAP 696 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 66.9 bits (156), Expect = 6e-10 Identities = 35/77 (45%), Positives = 35/77 (45%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPPPP P PPPP PP G P P PPPP P Sbjct: 127 PPPPVLPGP----PVGPPPPPPPPPPPPPPPPPPPPMAG---PPPPPGPPPPHPPPPAGP 179 Query: 752 XPXAGPPXPAAPXXXPP 802 P AGPP P P PP Sbjct: 180 PPVAGPPVP--PPHPPP 194 Score = 65.7 bits (153), Expect = 1e-09 Identities = 34/85 (40%), Positives = 35/85 (41%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP---PPXXXPGPPPPXPPXXG-GXXXPXAPXXXAXPPP 736 PPPPP G PPPP PP P PPP PP P AP PPP Sbjct: 154 PPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPP 213 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXG 811 PP P PP P +P PP G Sbjct: 214 VEGPPPPKGPPPPPHSPPGPPPAEG 238 Score = 65.3 bits (152), Expect = 2e-09 Identities = 33/78 (42%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-PPPX 745 PPPPP PPPPPP GPPPP P P P A PP PPP Sbjct: 139 PPPPPPP-------PPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPH 191 Query: 746 PPXPXAGPPXPAAPXXXP 799 PP PP P AP P Sbjct: 192 PPPAEPAPPPPPAPQGPP 209 Score = 62.9 bits (146), Expect = 1e-08 Identities = 34/86 (39%), Positives = 34/86 (39%), Gaps = 5/86 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPX-APXXXAXPPPPPX 745 PPP P G PPP PP P PPPP P P P PPPPP Sbjct: 169 PPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPH 228 Query: 746 P---PXPXAGPPXPA-APXXXPPXXG 811 P P GPP PA P PP G Sbjct: 229 SPPGPPPAEGPPPPAKVPPPAPPVEG 254 Score = 60.9 bits (141), Expect = 4e-08 Identities = 35/95 (36%), Positives = 35/95 (36%), Gaps = 12/95 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP----PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP- 733 PPPPP G P PPPPP PGPPP P P AP PP Sbjct: 199 PPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPP 258 Query: 734 -------PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP P P GPP P P P G Sbjct: 259 HSPPPHGPPPHFPPPAEGPPPPHGPPPHSPPPSEG 293 Score = 58.4 bits (135), Expect = 2e-07 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 8/85 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-PPXXGGXXXPXA--PXXXAXPPPP 739 PPPPP PPPPP P PPPP PP G P P PPPP Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPP 202 Query: 740 P---XP--PXPXAGPPXPAAPXXXP 799 P P P P GPP P P P Sbjct: 203 PAPQGPPAPPPVEGPPPPKGPPPPP 227 Score = 56.8 bits (131), Expect = 7e-07 Identities = 40/142 (28%), Positives = 41/142 (28%), Gaps = 6/142 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP--PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP G PPP PP G P P PPPPP P P PPP Sbjct: 154 PPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPP 213 Query: 426 ---PPPPXXXXXXXXGXGGGGXXX-PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPP 259 PPPP G PP + P PPP Sbjct: 214 VEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPPPHFPPP 273 Query: 258 PXXXXPPRXPXTPXXPGGPGXP 193 PP P P G P Sbjct: 274 AEGPPPPHGPPPHSPPPSEGPP 295 Score = 55.6 bits (128), Expect = 2e-06 Identities = 35/116 (30%), Positives = 35/116 (30%), Gaps = 1/116 (0%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP G P P PPPPPP P P PPPPP G PP Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPP 186 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXX-XXPPRXPXTPXXPGGPGXP 193 P PPPP PP P P GP P Sbjct: 187 VPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPP 242 Score = 55.2 bits (127), Expect = 2e-06 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 6/79 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-- 736 PPPPP G P PPP GPPPP P G P P PPP Sbjct: 223 PPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPP-PHFPPPAEGPPPPH 281 Query: 737 --PPXPPXPXAGPPXPAAP 787 PP P P GPP P P Sbjct: 282 GPPPHSPPPSEGPPPPHGP 300 Score = 54.0 bits (124), Expect = 5e-06 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXP---PP 736 P PPP G PPPP P P PP PP G P A P PP Sbjct: 197 PAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPP 256 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 PP P P PP P PP Sbjct: 257 PPHSPPPHGPPPHFPPPAEGPP 278 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/63 (46%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = +2 Query: 635 PPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPP PGPP PP PP P P PPPPP PP P AGPP P P P Sbjct: 127 PPPPVLPGPPVGPPPPPP------PPPP-----PPPPPPPPPPMAGPPPPPGPPPPHPPP 175 Query: 809 GXG 817 G Sbjct: 176 PAG 178 Score = 49.6 bits (113), Expect = 1e-04 Identities = 39/139 (28%), Positives = 40/139 (28%), Gaps = 6/139 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP-----XXPXX 436 PPP G G PPPPP P P PP PPP P Sbjct: 128 PPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPV 187 Query: 435 PPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPP 256 PPP PPP G PP + PG PPPP Sbjct: 188 PPPHPPPAEPAPPPPPAPQGPPAPPP----VEGPPPPKGPPPPPHSPPG-PPPAEGPPPP 242 Query: 255 XXXXPPRXPXT-PXXPGGP 202 PP P P P P Sbjct: 243 AKVPPPAPPVEGPPPPHSP 261 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPPP PPPP PP Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPP 169 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP----PPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PP PPP P PPP PP P G P Sbjct: 150 PPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPP 209 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP--PPXXPPXXGGXXXXXXPPGXP 725 P P PP G A P PPPP P P PP PP G PP P Sbjct: 193 PPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAP 250 Score = 39.5 bits (88), Expect = 0.11 Identities = 26/84 (30%), Positives = 26/84 (30%), Gaps = 6/84 (7%) Frame = -2 Query: 606 KXPPPPXXGGGG---GXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP--PPPPPXPXXP 442 K PPPP G PPP P G P P PPP P P Sbjct: 221 KGPPPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPPPP 280 Query: 441 XXPPP-PPPPXXXXXXXXGXGGGG 373 PPP PPP G G Sbjct: 281 HGPPPHSPPPSEGPPPPHGPSSSG 304 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP A P P PPPP P PP PP G PP Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPP--HPPPPAGPPPVAGPPVPPPHPP 193 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP G P PPP PP P PPP PP G G P Sbjct: 165 PPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPP--PPAPQGPPAPPPVEGPP 218 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP G PPPPP P P PPPPP PP P Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPPPP-------PPPPPPPPMAGPPPPPGPPPPHPPPPAGP 179 Query: 418 PP 413 PP Sbjct: 180 PP 181 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP----PPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPP PPP P PP PP G PP Sbjct: 169 PPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPPKGPPP 225 Score = 37.5 bits (83), Expect = 0.43 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 4/67 (5%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPP--PPPXXXXXXXTPP 428 PPPP G G PPP E P P PP PPP P Sbjct: 224 PPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHSPPPHGPPPHFPPPAEGPPPPHGP 283 Query: 427 PP--PPP 413 PP PPP Sbjct: 284 PPHSPPP 290 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXP---PPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PPP P P PP PP PP P Sbjct: 146 PPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAP 205 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +3 Query: 570 PPPPXXXGGGGXX---AXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP G P PPPPP P PPP P PP Sbjct: 200 PPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPPGPPPAEGPPPPAKVPPPAPP 251 Score = 35.1 bits (77), Expect = 2.3 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP----PXXPPXXGGXXXXX 707 G P PPPP P PP PPP P PP P PP G Sbjct: 207 GPPAPPPVEGPPPPKGP------PPPPHSPPGPPPAEGPPPPAKVPPPAPPVEGPPPPHS 260 Query: 708 XPPGXP 725 PP P Sbjct: 261 PPPHGP 266 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 689 GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 G P P P PP PP P PP P P PP G Sbjct: 123 GRFMPPPPVLPGPPVGPPPPPPPP--PPPPPPPPPPPPMAG 161 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPP PPP P PP PP PP P Sbjct: 251 PVEGPPPP--------HSPPPHGPPPHFPPPAEGPPPPHGPPPHSPPPSEGPPPPHGP 300 >UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleostomi|Rep: Wiskott-Aldrich syndrome - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 479 Score = 66.5 bits (155), Expect = 8e-10 Identities = 37/100 (37%), Positives = 39/100 (39%), Gaps = 5/100 (5%) Frame = +2 Query: 536 GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPX 715 GG V PPPP G PPP P GPPPP PP P Sbjct: 309 GGLSSVPGPTGRPPPPSRSPGPPH---RGPPPPAPHCNRSGPPPPPPPSQSHKPPPPPMG 365 Query: 716 XXAXPPPPPXPPXP-----XAGPPXPAAPXXXPPXXGXGG 820 A PPPPP PP P + P +AP PP G GG Sbjct: 366 ACAPPPPPPPPPPPSSSGNFSSSPVSSAPPPPPPSGGGGG 405 Score = 54.8 bits (126), Expect = 3e-06 Identities = 30/84 (35%), Positives = 31/84 (36%), Gaps = 3/84 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP---GPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 P PPP GG PPPP P GPPPP P P P + PPP Sbjct: 302 PAPPPPRGGLSSVPGPTGRPPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPPSQSHKPPP 361 Query: 740 PXPPXPXAGPPXPAAPXXXPPXXG 811 P P PP P P P G Sbjct: 362 P--PMGACAPPPPPPPPPPPSSSG 383 Score = 46.8 bits (106), Expect = 7e-04 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP G G PPP P P P PPPPP PPPPP Sbjct: 321 PPPPSRSPGPPHRGP----PPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPP 376 Query: 418 PP 413 PP Sbjct: 377 PP 378 Score = 45.2 bits (102), Expect = 0.002 Identities = 32/99 (32%), Positives = 33/99 (33%), Gaps = 11/99 (11%) Frame = -2 Query: 636 GGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP 457 G G + P PP G PPPPP P P PPPPPP Sbjct: 316 GPTGRPPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPPSQSHKPPPP-PMGACAPPPPPP 374 Query: 456 XPXXPXXP-----------PPPPPPXXXXXXXXGXGGGG 373 P P PPPPPP G GGGG Sbjct: 375 PPPPPSSSGNFSSSPVSSAPPPPPP-----SGGGGGGGG 408 Score = 44.4 bits (100), Expect = 0.004 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPP P P PPPP PPPP Sbjct: 321 PPPP------SRSPGPPHRGPPPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPP 374 Query: 421 PPP 413 PPP Sbjct: 375 PPP 377 Score = 39.9 bits (89), Expect = 0.081 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP--PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 P PP GG T PPP P P P PPPPP P P Sbjct: 302 PAPPPPRGGLSSVPGPTGRPPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPPSQSHK--P 359 Query: 426 PPPP 415 PPPP Sbjct: 360 PPPP 363 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/69 (30%), Positives = 23/69 (33%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G P PP GG G PPPP G + P P PP Sbjct: 296 GGPRSAPAPPPPRGGLSSVPGPTGR-PPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPPS 354 Query: 439 XTPPPPPPP 413 + PPPPP Sbjct: 355 QSHKPPPPP 363 Score = 37.9 bits (84), Expect = 0.33 Identities = 26/81 (32%), Positives = 27/81 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG PPPP + P P PPPP P PPPPP Sbjct: 304 PPPPR----GGLSSVPGPTGRPPPPS------RSPGPPHRG-PPPPAPHCNRSGPPPPPP 352 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 P G PP Sbjct: 353 PSQSHKPPPPPMGACAPPPPP 373 Score = 35.5 bits (78), Expect = 1.7 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP-XPXAGPPXPA 781 P P P PPPP GG P PPPP P P GPP PA Sbjct: 295 PGGPRSAPAPPPPR----GGLSS--VPGPTGRPPPPSRSPGPPHRGPPPPA 339 Score = 35.1 bits (77), Expect = 2.3 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 7/71 (9%) Frame = +3 Query: 534 GGGXXXXXPXXXPPPPXXXGGGGXXAXXP-------XXPPPPPPXXXPXPPPXXPPXXGG 692 GG P PPPP G P PPPPPP PP PP G Sbjct: 309 GGLSSVPGPTGRPPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPPSQSHKPP--PPPMGA 366 Query: 693 XXXXXXPPGXP 725 PP P Sbjct: 367 CAPPPPPPPPP 377 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 66.5 bits (155), Expect = 8e-10 Identities = 32/70 (45%), Positives = 33/70 (47%) Frame = +2 Query: 590 GGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP 769 GGG PPPPPP P PPPP PP P +P A PPPPP PP P P Sbjct: 260 GGGAEAAVVDVAPPPPPP--PPPPPPPPPP-----PPPPSPPAPAPPPPPPAPPPPPPAP 312 Query: 770 PXPAAPXXXP 799 P PA P Sbjct: 313 PPPAPVNNDP 322 Score = 56.8 bits (131), Expect = 7e-07 Identities = 35/95 (36%), Positives = 35/95 (36%), Gaps = 3/95 (3%) Frame = -2 Query: 690 PPXXGGXGGGGP---GXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXX 520 P GG G GG G G GGG PPPP PPPPP Sbjct: 239 PAPAGGTGAGGSKGAGQGAGAGGGAEAAVVDVAPPPPPP------------PPPPPPPPP 286 Query: 519 XGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P PPPPPP P P PPPP P Sbjct: 287 PPPPPSPPAPA----PPPPPPAPPPPPPAPPPPAP 317 Score = 46.4 bits (105), Expect = 0.001 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 2/94 (2%) Frame = -1 Query: 688 PXXGGXXGG--GXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXG 515 P G GG G G G GGG PPPP PPPPP Sbjct: 241 PAGGTGAGGSKGAGQGAGAGGGAEAAVVDVAPPPP----------------PPPPPPPPP 284 Query: 514 EXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPPP PP PPPP Sbjct: 285 PPPPPPPSPPAPAPPPPPPAPPPP---PPAPPPP 315 Score = 45.2 bits (102), Expect = 0.002 Identities = 30/89 (33%), Positives = 30/89 (33%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKX 500 GG G G G GGG A PPPP PPPPP Sbjct: 248 GGSKGAGQGAGAGGGAEAAVVDVAPPPPPPP---------------PPPPPPPPPPPPPS 292 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPPP PPPP P Sbjct: 293 PPAPA----PPPPPPAPPPPPPAPPPPAP 317 Score = 41.5 bits (93), Expect = 0.026 Identities = 30/99 (30%), Positives = 30/99 (30%) Frame = +2 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXX 559 P P GG G GG G G G G GG P Sbjct: 231 PALPAAPAPAPAGGTGAGGSKGA-GQGAGAGGGAEAAVVDVAPPPPPPP----------- 278 Query: 560 XXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP 676 PPPPP PPP PP P PPPP P Sbjct: 279 PPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPPPP P P P Sbjct: 282 PPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAPVNNDP 322 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 66.5 bits (155), Expect = 8e-10 Identities = 29/64 (45%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA--APXXXP 799 PPPPPP P PPPP PP P P PPPPP PP P PP P+ P P Sbjct: 486 PPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRP 545 Query: 800 PXXG 811 G Sbjct: 546 EIPG 549 Score = 58.8 bits (136), Expect = 2e-07 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = -2 Query: 573 GGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 GG PPPPP P P PPPPPP P P PPPPPPP Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 54.0 bits (124), Expect = 5e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPP P Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 50.8 bits (116), Expect = 4e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPP P P Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 47.2 bits (107), Expect = 5e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 531 GGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 GG P PPPP P PPPPPP P PPP PP G Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPPP P P P PPP PPPPPPP Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPPP P P PPPP PPPPPPP Sbjct: 483 GVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 44.4 bits (100), Expect = 0.004 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P PPPPP PPPPPPP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 44.0 bits (99), Expect = 0.005 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPP P Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 Score = 41.5 bits (93), Expect = 0.026 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 591 GGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 GG P PPPPPP P PPP PP PP P Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP PPPPPP P PPPP P P P P Sbjct: 505 PPPPPPPSPP----PPPPPPPPPPPPPPPPPPPPGPSPITPSVRPEIPGYIVKP 554 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP--XPXXPXXPPP 427 PPPP PPPPP P P PPPPPP P P P Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRPE 546 Query: 426 PP 421 P Sbjct: 547 IP 548 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PP P P PPPPPP P PPP P Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSP 538 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPPPPP P P P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGPSPITPSVRP 545 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 66.5 bits (155), Expect = 8e-10 Identities = 37/90 (41%), Positives = 37/90 (41%), Gaps = 9/90 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG------PPPPXPPXXGG-XXXPXAPXXXAX 727 PPPPP G PPPPPP PG PPPP P G P P Sbjct: 546 PPPPPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTG 605 Query: 728 PPPPPXPPXP--XAGPPXPAAPXXXPPXXG 811 PPPPP PP P AG P P P P G Sbjct: 606 PPPPPPPPLPGQKAGAPPPPPPPPPPGQKG 635 Score = 60.1 bits (139), Expect = 7e-08 Identities = 30/73 (41%), Positives = 30/73 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPP G P P A PPPPP Sbjct: 542 PPPPPPPPPPPLPGQHKQTPPPPPP--PPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPL 599 Query: 749 PXPXAGPPXPAAP 787 P GPP P P Sbjct: 600 PGQKTGPPPPPPP 612 Score = 58.0 bits (134), Expect = 3e-07 Identities = 32/86 (37%), Positives = 32/86 (37%), Gaps = 1/86 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP-PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP PPPPP P GPPPP PP G P P P Sbjct: 562 PPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPP-PPLPGQKTGPPPPPPPPLPGQKAG 620 Query: 746 PPXPXAGPPXPAAPXXXPPXXGXGGA 823 P P PP P PP GGA Sbjct: 621 APPPPPPPPPPGQKGIPPPPPTFGGA 646 Score = 57.6 bits (133), Expect = 4e-07 Identities = 27/65 (41%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPP---XXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPPP G PPPPP G P P PPPPPP P PP Sbjct: 548 PPPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPP 607 Query: 429 PPPPP 415 PPPPP Sbjct: 608 PPPPP 612 Score = 51.2 bits (117), Expect = 3e-05 Identities = 21/41 (51%), Positives = 22/41 (53%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP G + P P PPPPPP P PPPPPP Sbjct: 547 PPPPPPLPGQHKQTPPP--PPPPPPPPPLPGQKTGPPPPPP 585 Score = 49.2 bits (112), Expect = 1e-04 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 9/71 (12%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXX---GXXXKXPXPXXXXXPPPPPPXP------X 448 PPPP PPPPP G P P PPPPPP P Sbjct: 561 PPPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPLPGQKAG 620 Query: 447 XPXXPPPPPPP 415 P PPPPPPP Sbjct: 621 APPPPPPPPPP 631 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/74 (33%), Positives = 26/74 (35%), Gaps = 5/74 (6%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXP-----XXXXXPPPPPX 455 G PPPP G PPPPP + P P PPPPP Sbjct: 555 GQHKQTPPPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPL 614 Query: 454 XXXXXXTPPPPPPP 413 PPPPPPP Sbjct: 615 PGQKAGAPPPPPPP 628 Score = 46.4 bits (105), Expect = 0.001 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 6/66 (9%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXX------TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPX 439 PPPP G G T PPPPP G P P PPPPP P Sbjct: 582 PPPPLPGQKAGPPPPPPLPGQKTGPPPPPPPPLPGQKAGAPPP------PPPPPPPGQKG 635 Query: 438 XPPPPP 421 PPPPP Sbjct: 636 IPPPPP 641 Score = 45.6 bits (103), Expect = 0.002 Identities = 32/104 (30%), Positives = 32/104 (30%), Gaps = 4/104 (3%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXX 313 P PPPPPP P PPPPPP G G PP Sbjct: 541 PPPPPPPPPPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPPPPPP-------LPGQKAGP 593 Query: 312 XXXXPXPGXXXXGXXPPPP----XXXXPPRXPXTPXXPGGPGXP 193 P PG PPPP P P P PG G P Sbjct: 594 PPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIP 637 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP P P PPPPP PPPP Sbjct: 541 PPPPPPPPPPPPLPGQHKQTPPPPP----PPPPPPPLPGQKTGPPPPPPLPGQKAGPPPP 596 Query: 421 PP 416 PP Sbjct: 597 PP 598 Score = 45.2 bits (102), Expect = 0.002 Identities = 27/62 (43%), Positives = 27/62 (43%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP P PPPP P G P PPPPP PP P P P PP Sbjct: 541 PPPPPP---PPPPPPLP----GQHKQTPP-----PPPPPPPPPPL--PGQKTGPPPPPPL 586 Query: 806 XG 811 G Sbjct: 587 PG 588 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPPPP L PPPPPP Sbjct: 546 PPPPPPPLPGQHKQTPPPPPPPPPPPP--LPGQKTGPPPPPP 585 Score = 42.7 bits (96), Expect = 0.011 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP---PPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPPP P PP PP G PP P Sbjct: 542 PPPPPPPPPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPPPPLP 600 Score = 41.5 bits (93), Expect = 0.026 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--------PPPPXPPXXGGXXXPXAPXXXA 724 PPPPP G PPPPPP PG PPPP PP G P A Sbjct: 594 PPPPPLPG-------QKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPPPPPTFGGA 646 Query: 725 XPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P P P Sbjct: 647 NAKGPGIPQQVGKKKQNPQKPMKQVP 672 Score = 39.9 bits (89), Expect = 0.081 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPPP PPP PP GG PG P Sbjct: 606 PPPPPPPPLP---GQKAGAPPPPPPPPPPGQKGIPPP--PPTFGGANAKG--PGIP 654 Score = 39.1 bits (87), Expect = 0.14 Identities = 35/123 (28%), Positives = 35/123 (28%), Gaps = 7/123 (5%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP-----PPPPPXXXXXXXXGXGGG 376 PPPPP P P PPPPP P P P PPPPP Sbjct: 541 PPPPPPPP---PPPPLPGQHKQTPPPPPPPPPPPPLPGQKTGPPPPPPLPGQK------A 591 Query: 375 GXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXT--PXXPGGP 202 G PP G PPPP P P T GP Sbjct: 592 GPPPPPPLPGQKTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPPPPPTFGGANAKGP 651 Query: 201 GXP 193 G P Sbjct: 652 GIP 654 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 503 KXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 K P P PPPPP PPPPPPP Sbjct: 538 KSHPPPPPPPPPPPPLPGQHKQTPPPPPPP 567 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPPP G P PPPP P PPP PP G PP Sbjct: 555 GQHKQTPPPPPPPPPPPPLPGQKTGPP--PPPPLPGQKAGPPP-PPPLPGQKTGPPPPPP 611 Query: 720 XP 725 P Sbjct: 612 PP 613 >UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2 - Homo sapiens (Human) Length = 1865 Score = 66.5 bits (155), Expect = 8e-10 Identities = 57/208 (27%), Positives = 58/208 (27%) Frame = +2 Query: 200 PGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPP 379 P PP G G G P PG G PP Sbjct: 1040 PQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPP 1099 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXX 559 PP P G G G G G G P G + Sbjct: 1100 PPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG 1159 Query: 560 XXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G G PPPPP G PPP PP G P P A PPP Sbjct: 1160 AGIPPPPPLPGAG---------IPPPPPLPGAGIPPP-PPLPGAGIPPPPPLPGAGIPPP 1209 Query: 740 PXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P P PP P PP GA Sbjct: 1210 PPLPGAGIPPPPPLPGAGIPPPPPLPGA 1237 Score = 66.1 bits (154), Expect = 1e-09 Identities = 58/210 (27%), Positives = 59/210 (28%), Gaps = 1/210 (0%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P G G G G G PP G G P Sbjct: 1175 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL 1234 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G G PPPP G G PPPP G P P PPPP Sbjct: 1235 PGAG-------IPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1287 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PPPPP P G G PP + P P Sbjct: 1288 PLPRV-GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPG 1346 Query: 279 XGXXPPPPXXXXP-PRXPXTPXXPGGPGXP 193 G PPPP P P P P G G P Sbjct: 1347 AGIPPPPPLPGMGIPPAPAPPLPPPGTGIP 1376 Score = 65.3 bits (152), Expect = 2e-09 Identities = 53/190 (27%), Positives = 54/190 (28%), Gaps = 2/190 (1%) Frame = +2 Query: 260 GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPPPXPXXXXXXFXGGGGGGGX 439 G G P PG G PPPP P G G Sbjct: 1082 GAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1141 Query: 440 XGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXX 619 G G G G P G + PPPPP G G Sbjct: 1142 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL 1201 Query: 620 XXP--PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPPPP G PPP PP G P P A PPPP P PP P Sbjct: 1202 PGAGIPPPPPLPGAGIPPP-PPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAG 1260 Query: 794 XPPXXGXGGA 823 PP GA Sbjct: 1261 IPPPPPLPGA 1270 Score = 65.3 bits (152), Expect = 2e-09 Identities = 53/190 (27%), Positives = 54/190 (28%), Gaps = 2/190 (1%) Frame = +2 Query: 260 GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPPPXPXXXXXXFXGGGGGGGX 439 G G P PG G PPPP P G G Sbjct: 1126 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1185 Query: 440 XGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG--GXXCX 613 G G G G P G + PPPPP G G Sbjct: 1186 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL 1245 Query: 614 XXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPPPP G PPP PP G P P A PPPP P PP P Sbjct: 1246 PGVGIPPPPPLPGAGIPPP-PPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAG 1304 Query: 794 XPPXXGXGGA 823 PP GA Sbjct: 1305 IPPPPPLPGA 1314 Score = 64.1 bits (149), Expect = 4e-09 Identities = 53/188 (28%), Positives = 54/188 (28%) Frame = +2 Query: 260 GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPPPXPXXXXXXFXGGGGGGGX 439 G G P PG G PPPP P G G Sbjct: 1170 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1229 Query: 440 XGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXX 619 G G G G P G + PPPPP G G Sbjct: 1230 PPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAG------- 1282 Query: 620 XXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP G PPP PP G P P A PPPP P PP P P Sbjct: 1283 --IPPPPPLPRVGIPPP-PPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIP 1339 Query: 800 PXXGXGGA 823 P GA Sbjct: 1340 PPPPLPGA 1347 Score = 62.9 bits (146), Expect = 1e-08 Identities = 51/185 (27%), Positives = 52/185 (28%), Gaps = 4/185 (2%) Frame = +2 Query: 260 GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPPPXPXXXXXXFXGGGGGGGX 439 G G P PG G PPPP P G G Sbjct: 1203 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAGIP 1262 Query: 440 XGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG---GXXC 610 G G G G P G + PPPPP G G Sbjct: 1263 PPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL 1322 Query: 611 XXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG-PPXPAAP 787 PPPPP PPPP P G P P P P P P P G PP P P Sbjct: 1323 PGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLP 1382 Query: 788 XXXPP 802 PP Sbjct: 1383 VSGPP 1387 Score = 60.5 bits (140), Expect = 5e-08 Identities = 57/209 (27%), Positives = 57/209 (27%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P G G G G G PP G G P Sbjct: 1120 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPL 1179 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G G PPPP G G PPPP G P P PPPP Sbjct: 1180 PGAG-------IPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPP 1232 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PPPPP P G G PP P P Sbjct: 1233 PLP-GAGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPR 1291 Query: 279 XGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 G PPPP P P PG G P Sbjct: 1292 VGIPPPPPLPG--AGIPPPPPLPGA-GIP 1317 Score = 60.5 bits (140), Expect = 5e-08 Identities = 52/185 (28%), Positives = 53/185 (28%), Gaps = 4/185 (2%) Frame = +2 Query: 260 GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPPPXPXXXXXXFXGGGGGGGX 439 G G P PG G PPPP P G G Sbjct: 1148 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIP 1207 Query: 440 XGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXX 619 G G G G P G + PPPPP G G Sbjct: 1208 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGAG------- 1260 Query: 620 XXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP----PXPXAGPPXPAAP 787 PPPPP G PPP P G P PPPPP P P P PP P A Sbjct: 1261 --IPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPP---PPLPGAG 1315 Query: 788 XXXPP 802 PP Sbjct: 1316 IPPPP 1320 Score = 60.5 bits (140), Expect = 5e-08 Identities = 54/187 (28%), Positives = 55/187 (29%), Gaps = 3/187 (1%) Frame = +2 Query: 260 GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPPPXPXXXXXXFXGGGGGGGX 439 G G P PG G PPPP P G G Sbjct: 1192 GAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIP 1251 Query: 440 XGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXX 619 G G G G P G + PPPPP G G Sbjct: 1252 PPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPRVGIPPPPPLPGAGIPPPPPL 1311 Query: 620 XXP--PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX-PPPPPXPPXPXAGPPXPAAPX 790 PPPPP G PPP PP G P P A PPP PP P G P AP Sbjct: 1312 PGAGIPPPPPLPGVGIPPP-PPLPGVGIPPPPPLPGAGIPPP---PPLPGMGIPPAPAPP 1367 Query: 791 XXPPXXG 811 PP G Sbjct: 1368 LPPPGTG 1374 Score = 55.6 bits (128), Expect = 2e-06 Identities = 41/136 (30%), Positives = 41/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP G G PPPP G P P PPPPP P PPPPP Sbjct: 1076 PLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPLPPPLPGAGIPPPPPLP-GAGIPPPPP 1134 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P G G PP P P G PPPP Sbjct: 1135 LPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG-- 1192 Query: 240 PRXPXTPXXPGGPGXP 193 P P PG G P Sbjct: 1193 AGIPPPPPLPGA-GIP 1207 Score = 51.2 bits (117), Expect = 3e-05 Identities = 42/136 (30%), Positives = 42/136 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPPP P P PPPPP P PPPPP Sbjct: 1054 PPPPLPGAG----------IPPPPPLPGAGILPLP-PLPGAGIPPPPPLP-GAAIPPPPP 1101 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P G G PP P P G PPPP Sbjct: 1102 LPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG-- 1159 Query: 240 PRXPXTPXXPGGPGXP 193 P P PG G P Sbjct: 1160 AGIPPPPPLPGA-GIP 1174 Score = 47.6 bits (108), Expect = 4e-04 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 5/88 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPPPP PG P P P PPPP P Sbjct: 1001 PPPLPCTESSSSMPGLGMVPPPPPP--LPGMTVPTLPSTAIPQPPPLQGTEMLPPPP--P 1056 Query: 749 PXPXAG-PPXPAAP----XXXPPXXGXG 817 P P AG PP P P PP G G Sbjct: 1057 PLPGAGIPPPPPLPGAGILPLPPLPGAG 1084 Score = 47.2 bits (107), Expect = 5e-04 Identities = 36/120 (30%), Positives = 36/120 (30%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 T PPPPP G P P P PP P PPPPP P G G Sbjct: 1048 TEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLP-GAGIPPPPPLPGAAIPPPPPLPGAG 1106 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP P P G PPPP P P PG G P Sbjct: 1107 IPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPG--AGIPPPPPLPGA-GIP 1163 Score = 43.6 bits (98), Expect = 0.007 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPP G P P PP P P P PP Sbjct: 1318 PPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTGIPP 1377 Query: 420 PP 415 PP Sbjct: 1378 PP 1379 Score = 39.9 bits (89), Expect = 0.081 Identities = 26/83 (31%), Positives = 27/83 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPP PP P PP P PP P Sbjct: 1339 PPPPPLPGAG--------IPPPPPLPGMGIPPAPAPPLPPPGTGIPPPPLLPVSGPPLLP 1390 Query: 749 PXPXAGPPXPAAPXXXPPXXGXG 817 + P P PP G Sbjct: 1391 QVGSSTLPTPQVCGFLPPPLPSG 1413 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP G PPPPP P P P PPP PPPP Sbjct: 1001 PPPLPCTESSSSMPGLGMVPPPPPPL---PGMTVPTLP-STAIPQPPPLQGTEMLPPPPP 1056 Query: 421 PPP 413 P P Sbjct: 1057 PLP 1059 Score = 35.9 bits (79), Expect = 1.3 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXX--PPPPPXXXGEXXKXPXXPXXXXXPPP-PPXXXXXX 440 A PPPP G G PPPPP P P P P PP Sbjct: 1314 AGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGT 1373 Query: 439 XTPPPPPPP 413 PPPP P Sbjct: 1374 GIPPPPLLP 1382 Score = 34.7 bits (76), Expect = 3.0 Identities = 30/99 (30%), Positives = 30/99 (30%), Gaps = 4/99 (4%) Frame = -2 Query: 702 GXXXPPXXGGXGGGGPGXXXGGG--GGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPP 529 G PP G G P G G PPPP G G PPP Sbjct: 1293 GIPPPPPLPGAGIPPPPPLPGAGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGAGIPPP 1352 Query: 528 PXXXGXXXKXPXPXXXXXPPPP--PPXPXXPXXPPPPPP 418 P G P P PP PP P P PP P Sbjct: 1353 PPLPGMGIP-PAPAPPLPPPGTGIPPPPLLPVSGPPLLP 1390 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 66.1 bits (154), Expect = 1e-09 Identities = 36/86 (41%), Positives = 36/86 (41%), Gaps = 3/86 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPP PG PP PP G P P PPPP P Sbjct: 934 PPPPPLPGFVPPPPVVGKAPPPPP---LPGMVPPPPPPLPGMAPPPPPPFPGMTPPPP-P 989 Query: 749 PXPXAGPPXPAAP---XXXPPXXGXG 817 P P GPP P P PP G G Sbjct: 990 PPPGCGPPPPPLPPGIGPPPPFMGMG 1015 Score = 55.2 bits (127), Expect = 2e-06 Identities = 27/75 (36%), Positives = 27/75 (36%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP G PPPPP G P P PPPPPP P PPP PP Sbjct: 944 PPPPVVGKAPPPPPLPGMVPPPPPPLPGMAPPPPPPFPGMTPPPPPPPPGCGPPPPPLPP 1003 Query: 417 PXXXXXXXXGXGGGG 373 G G G Sbjct: 1004 GIGPPPPFMGMGPPG 1018 Score = 51.2 bits (117), Expect = 3e-05 Identities = 32/78 (41%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPPP PG PP P G P P PPPPP P Sbjct: 916 PPPPPLSGMTPPKPTGVIPPPPP---LPGFVPPPPVV--GKAPPPPPLPGMVPPPPP--P 968 Query: 752 XP-XAGPPXPAAPXXXPP 802 P A PP P P PP Sbjct: 969 LPGMAPPPPPPFPGMTPP 986 Score = 48.0 bits (109), Expect = 3e-04 Identities = 29/69 (42%), Positives = 29/69 (42%), Gaps = 8/69 (11%) Frame = +2 Query: 629 PPPPPXXXPGPP------PPXPPXXGGXXXPXAPXXXAXPPPPPXP-PXPXAGPPXPA-A 784 PPPPP PP PP PP G P P PPPPP P P PP P A Sbjct: 916 PPPPPLSGMTPPKPTGVIPPPPPLPG--FVPPPPVVGKAPPPPPLPGMVPPPPPPLPGMA 973 Query: 785 PXXXPPXXG 811 P PP G Sbjct: 974 PPPPPPFPG 982 Score = 45.2 bits (102), Expect = 0.002 Identities = 29/76 (38%), Positives = 29/76 (38%), Gaps = 3/76 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPPP P PPPP PP G P P PP Sbjct: 975 PPPPPFPG-------MTPPPPPPPPGCGP-PPPPLPPGIG----PPPPFMGMGPPGMAHE 1022 Query: 749 PXPXAG---PPXPAAP 787 P PP P P Sbjct: 1023 SVPLKAVIEPPRPMKP 1038 Score = 44.4 bits (100), Expect = 0.004 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 10/66 (15%) Frame = +2 Query: 635 PPPXXXPGPPP---PXPPXXGGXXXPXAPXXXAXPPP------PPXPPXP-XAGPPXPAA 784 PPP P PPP PP G P P PPP PP PP P PP P Sbjct: 910 PPPPQLPPPPPLSGMTPPKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPL 969 Query: 785 PXXXPP 802 P PP Sbjct: 970 PGMAPP 975 Score = 41.5 bits (93), Expect = 0.026 Identities = 24/61 (39%), Positives = 24/61 (39%), Gaps = 7/61 (11%) Frame = +2 Query: 641 PXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPPP-----PXPPXPXAGPPXPAAPXXXP 799 P P PP PP PP G P P PPPP P PP PP P P P Sbjct: 906 PLSTPPPPQLPPPPPLSG--MTPPKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVP 963 Query: 800 P 802 P Sbjct: 964 P 964 Score = 40.7 bits (91), Expect = 0.046 Identities = 29/96 (30%), Positives = 29/96 (30%), Gaps = 13/96 (13%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP-------PPXXXGXXXKXPXPXXXXXPPPPPP----- 457 PPPP G PPP PP P P PPPP P Sbjct: 916 PPPPPLSGMTPPKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPLPGMAPP 975 Query: 456 -XPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXF 352 P P PPPPPP G PP F Sbjct: 976 PPPPFPGMTPPPPPPPPGCGPPPPPLPPGIGPPPPF 1011 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP G PPPPPP PPP PP G PPG Sbjct: 959 PGMVPPPPPPLPG--------MAPPPPPPFPGMTPPPPPPPPGCGPPPPPLPPG 1004 Score = 37.9 bits (84), Expect = 0.33 Identities = 31/105 (29%), Positives = 32/105 (30%), Gaps = 5/105 (4%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPP-----XPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 PPPP G P P PPPP P P PPPPP P G Sbjct: 916 PPPPPLSGMTP--PKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPLPGMA 973 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP 238 PP F + P P G PPPP P Sbjct: 974 PPPPPPFPGMTPPPPPPPPGCGPPPPP--LPPGIGPPPPFMGMGP 1016 Score = 37.5 bits (83), Expect = 0.43 Identities = 29/103 (28%), Positives = 30/103 (29%), Gaps = 3/103 (2%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPP---PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXX 322 P PPPPP P P PPPPP G PP + Sbjct: 910 PPPPQLPPPPPLSGMTPPKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPPPPL 969 Query: 321 XXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPPP PP P P GP P Sbjct: 970 PGMAPPPPPPFPGMTPPPPPPPPGCGPPPPPLPPGI--GPPPP 1010 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 P PPPP G PPPPPP P PPP PP G Sbjct: 970 PGMAPPPPPPFPG------MTPPPPPPPPGCGP-PPPPLPPGIG 1006 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 66.1 bits (154), Expect = 1e-09 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P P PPPP PP P P PPPPP P P PP P P PP Sbjct: 319 PPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPP 377 Score = 61.7 bits (143), Expect = 2e-08 Identities = 27/60 (45%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXP--XAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP P PPPP PP P P PPPPP PP P PP P P P Sbjct: 324 PPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPPPP 383 Score = 59.3 bits (137), Expect = 1e-07 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP P PP P PP P P P PPP P P PP P P PP Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPP 368 Score = 51.6 bits (118), Expect = 2e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPP P P PPPPPPP Sbjct: 318 PPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPP 358 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P P PPP PPP Sbjct: 340 PPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPP 381 Score = 49.2 bits (112), Expect = 1e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPP--PXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P P P PPPP PP Sbjct: 324 PPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPP 367 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P P PPPP P P PPPPP P Sbjct: 312 PPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDP 352 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P PPPPP P P PPPPPP Sbjct: 318 PPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPP 358 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PP PPP P P PPP PPP Sbjct: 321 PPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPP 362 Score = 48.0 bits (109), Expect = 3e-04 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP- 424 PPPP PP PP P P PPPPPP P P PPPP Sbjct: 312 PPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDP-PPPPPPDPPPPPDPPPPD 370 Query: 423 -PPP 415 PPP Sbjct: 371 RPPP 374 Score = 47.2 bits (107), Expect = 5e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP-PPPPPXPXXPXXPPPPPP 418 PPP P P P P PPPPP P P PPPPPP Sbjct: 336 PPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPP 377 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PP PPP P P P PPPPP Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPPPPDPPP-PDPPPPPDPPPPP 350 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPPP P PPP PP PP P Sbjct: 321 PPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPP 376 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP PPPPP P P PP PP PP P Sbjct: 320 PPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEP 379 Query: 421 PPP 413 PPP Sbjct: 380 PPP 382 Score = 41.5 bits (93), Expect = 0.026 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP--PPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PP PPPP P PPP PP PP P Sbjct: 326 PPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPEPPPPP 383 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP-----PPPPE 410 PPPP + P P PPPPP PPP PPPPE Sbjct: 330 PPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPPPPDRPPPPPPE 378 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P P PPPP P PP PP PP Sbjct: 315 PSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPPDPP 367 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPPP P P PPPPP P PPPPP+ Sbjct: 324 PPPPPDPPPPDPPPPDPPPPPDPPPPPDPPPPPP-PDPPPPPD 365 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 618 PXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP PPP P PPP PP PP P Sbjct: 310 PDPPPPSDPPPPPDPPPPPDPPPPDPPPPDPPPPPDPP 347 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP PPP P PP PP PP P Sbjct: 318 PPPPPDPPPPPDPPPPDPPPPDPPPPPDPPPPPDPP 353 >UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)]; n=10; Eukaryota|Rep: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] - Sus scrofa (Pig) Length = 676 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 83 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 139 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 140 ARPPPGPPPPGPPPPGPAPPGARPP 164 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 104 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 160 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 161 ARPPPGPPPPGPPPPGPAPPGARPP 185 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 125 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 181 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 182 ARPPPGPPPPGPPPPGPAPPGARPP 206 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 146 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 202 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 203 ARPPPGPPPPGPPPPGPAPPGARPP 227 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 167 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 223 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 224 ARPPPGPPPPGPPPPGPAPPGARPP 248 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 209 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPG 265 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 266 ARPPPGPPPPGPPPPGPAPPGARPP 290 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 272 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 328 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 329 ARPPPGPPPPGPPPPGPAPPGARPP 353 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 293 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 349 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 350 ARPPPGPPPPGPPPPGPAPPGARPP 374 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 314 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 370 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 371 ARPPPGPPPPGPPPPGPAPPGARPP 395 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 335 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 391 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 392 ARPPPGPPPPGPPPPGPAPPGARPP 416 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 531 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 587 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 588 ARPPPGPPPPGPPPPGPAPPGARPP 612 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 552 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 608 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 609 ARPPPGPPPPGPPPPGPAPPGARPP 633 Score = 66.1 bits (154), Expect = 1e-09 Identities = 35/85 (41%), Positives = 35/85 (41%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 573 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 629 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 630 ARPPPGPPPPGPPPPGPAPPGARPP 654 Score = 65.3 bits (152), Expect = 2e-09 Identities = 50/157 (31%), Positives = 50/157 (31%), Gaps = 5/157 (3%) Frame = +2 Query: 347 KKKXGGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXX 526 KKK PPPP P G G G G P Sbjct: 438 KKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 497 Query: 527 GGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPP----PPXPPXXGG 691 G PP PP G PPPP PP P PP PP PP G Sbjct: 498 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP 557 Query: 692 XXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 AP A PPP P PP P PP PA P PP Sbjct: 558 PPPGPAPPG-ARPPPGPPPPGPP--PPGPAPPGARPP 591 Score = 64.1 bits (149), Expect = 4e-09 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 P PP G PPP PP PGPPPP P G P P PP Sbjct: 61 PRPPGDGPEQGPAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 118 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 119 ARPPPGPPPPGPPPPGPAPPGARPP 143 Score = 64.1 bits (149), Expect = 4e-09 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP PGPPPP P G P P PP Sbjct: 594 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 650 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P GP P P PP Sbjct: 651 ARPPPGPPPPPPGPSPPRPPPGPPP 675 Score = 63.3 bits (147), Expect = 8e-09 Identities = 33/80 (41%), Positives = 33/80 (41%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PP PPP PGPPPP P G P P PPPP P Sbjct: 356 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPG---PPPPGPA 409 Query: 752 XPXAGPPXPAAPXXXPPXXG 811 P A PP P P P G Sbjct: 410 PPGARPPPPPPPPADEPQQG 429 Score = 62.9 bits (146), Expect = 1e-08 Identities = 34/80 (42%), Positives = 34/80 (42%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PP PPP PGPPPP P G P P PPPP P Sbjct: 188 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPGPPPPG---PPPPGPA 241 Query: 752 XPXAGPPXPAAPXXXPPXXG 811 P A PP P P PP G Sbjct: 242 PPGARPP-PGPPPLGPPPPG 260 Score = 62.9 bits (146), Expect = 1e-08 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP------ 733 PPPP G PP PPP GPPPP P G P P PP Sbjct: 230 PPPPGPPPPGPAPPGARPPPGPPPL---GPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 286 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 287 ARPPPGPPPPGPPPPGPAPPGARPP 311 Score = 61.7 bits (143), Expect = 2e-08 Identities = 37/85 (43%), Positives = 37/85 (43%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPP--PPXXGGGGXXCXXXXXPPPP-PPXXXPGPP----PPXPPXXGGXXXPXAPXXXAX 727 PPP PP G PPPP PP P PP PP PP G AP A Sbjct: 251 PPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAP-PGAR 309 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P PP P PP PA P PP Sbjct: 310 PPPGPPPPGPP--PPGPAPPGARPP 332 Score = 61.3 bits (142), Expect = 3e-08 Identities = 56/212 (26%), Positives = 57/212 (26%), Gaps = 3/212 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G A G A G G G PP G PG Sbjct: 466 PGPPPPGPPPPGPAPPG--ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 523 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G PPPP G PPPP + P PPPP Sbjct: 524 GARP-PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 582 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PP PPPP G PP P PG Sbjct: 583 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP----PGPPPPGPAPPGARPPPGPPP 638 Query: 279 XGXXPP---PPXXXXPPRXPXTPXXPGGPGXP 193 G PP PP PP P P P P P Sbjct: 639 PGPPPPGPAPPGARPPPGPPPPPPGPSPPRPP 670 Score = 60.9 bits (141), Expect = 4e-08 Identities = 56/212 (26%), Positives = 57/212 (26%), Gaps = 3/212 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G A G A G G G PP G PG Sbjct: 81 PGPPPPGPPPPGPAPPG--ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 138 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G PPPP G PPPP + P PPPP Sbjct: 139 GARP-PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 197 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PP PPPP G PP P PG Sbjct: 198 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP----PGPPPPGPAPPGARPPPGPPP 253 Query: 279 XGXXPP---PPXXXXPPRXPXTPXXPGGPGXP 193 G PP PP PP P P GP P Sbjct: 254 LGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 285 Score = 60.9 bits (141), Expect = 4e-08 Identities = 56/212 (26%), Positives = 57/212 (26%), Gaps = 3/212 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G A G A G G G PP G PG Sbjct: 144 PGPPPPGPPPPGPAPPG--ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 201 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G PPPP G PPPP + P PPPP Sbjct: 202 GARP-PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPG 260 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PP PPPP G PP P PG Sbjct: 261 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP----PGPPPPGPAPPGARPPPGPPP 316 Query: 279 XGXXPP---PPXXXXPPRXPXTPXXPGGPGXP 193 G PP PP PP P P GP P Sbjct: 317 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 348 Score = 60.9 bits (141), Expect = 4e-08 Identities = 56/212 (26%), Positives = 57/212 (26%), Gaps = 3/212 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G A G A G G G PP G PG Sbjct: 207 PGPPPPGPPPPGPAPPG--ARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPP 264 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G PPPP G PPPP + P PPPP Sbjct: 265 GARP-PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 323 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PP PPPP G PP P PG Sbjct: 324 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP----PGPPPPGPAPPGARPPPGPPP 379 Query: 279 XGXXPP---PPXXXXPPRXPXTPXXPGGPGXP 193 G PP PP PP P P GP P Sbjct: 380 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 411 Score = 60.5 bits (140), Expect = 5e-08 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP---PP 739 PP PP G PPPP P PGP PP G P P PP PP Sbjct: 190 PPGPPPPGPAPPGARPPPGPPPPGP-PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 248 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP PP PA P PP Sbjct: 249 PGPPPLGPPPPGPAPPGARPP 269 Score = 60.1 bits (139), Expect = 7e-08 Identities = 34/88 (38%), Positives = 34/88 (38%), Gaps = 10/88 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP---PXXXPGP----PPPXPPXXGGXXXPXAPXXXAX 727 PPP P G PPPPP P P P P PP G P P Sbjct: 399 PPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPA 458 Query: 728 PP---PPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP PP P PP PA P PP Sbjct: 459 PPGARPPPGPPPPGPPPPGPAPPGARPP 486 Score = 60.1 bits (139), Expect = 7e-08 Identities = 33/86 (38%), Positives = 33/86 (38%), Gaps = 5/86 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPP 739 PPPPP P PPPP P P PP P P G P P PPP Sbjct: 418 PPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPG 477 Query: 740 PXPP--XPXAGPPXPAAPXXXPPXXG 811 P PP P GPP P P P G Sbjct: 478 PAPPGARPPPGPPPPGPPPPGPAPPG 503 Score = 60.1 bits (139), Expect = 7e-08 Identities = 34/87 (39%), Positives = 34/87 (39%), Gaps = 6/87 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPP----PPXPPXXGGXXXPXAPXXXAXPP 733 PP PP G PPPP PP P PP PP PP G AP PP Sbjct: 449 PPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPP 508 Query: 734 -PPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPP P P P A P PP G Sbjct: 509 GPPPPGPPPPGPAPPGARPPPGPPPPG 535 Score = 58.8 bits (136), Expect = 2e-07 Identities = 35/94 (37%), Positives = 35/94 (37%), Gaps = 13/94 (13%) Frame = +2 Query: 569 PPPPPXXGGGG-------XXCXXXXXPPPPPPXXXPGPPPPXPPXXG----GXXXPXAPX 715 PPPP G G P PP PGPPPP PP G G P P Sbjct: 46 PPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 105 Query: 716 XXAXPPPPPXPP--XPXAGPPXPAAPXXXPPXXG 811 PPP P PP P GPP P P P G Sbjct: 106 PPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 139 Score = 58.4 bits (135), Expect = 2e-07 Identities = 49/184 (26%), Positives = 49/184 (26%), Gaps = 3/184 (1%) Frame = -2 Query: 735 GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXX 556 G G G PP G PG G PPP G Sbjct: 65 GDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 124 Query: 555 XTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PPPP P P PPPP P P PP PPPP G Sbjct: 125 PPPPGPPPPGPAPPGARPPPGPPPP-GPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGAR 183 Query: 375 GXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPP---PPXXXXPPRXPXTPXXPGG 205 PP P PG G PP PP PP P P G Sbjct: 184 PPPGPPP----PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 239 Query: 204 PGXP 193 P P Sbjct: 240 PAPP 243 Score = 58.4 bits (135), Expect = 2e-07 Identities = 36/86 (41%), Positives = 36/86 (41%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPP----PPXPPXXGGXXXPXAPXXXAXPP 733 PP PP G PPPP PP P PP PP PP G AP A PP Sbjct: 358 PPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG-ARPP 416 Query: 734 PPPXPP--XPXAGP-PXPAAPXXXPP 802 PPP PP P GP P P PP Sbjct: 417 PPPPPPADEPQQGPAPSGDKPKKKPP 442 Score = 58.4 bits (135), Expect = 2e-07 Identities = 52/200 (26%), Positives = 53/200 (26%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G A G A G G G PP G PG Sbjct: 487 PGPPPPGPPPPGPAPPG--ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 544 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G PPPP G PPPP + P PPPP Sbjct: 545 GARP-PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 603 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PP PPPP G PP PG Sbjct: 604 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP----------PGPPPPGPAPPGARP 653 Query: 279 XGXXPPPPXXXXPPRXPXTP 220 PPPP PPR P P Sbjct: 654 PPGPPPPPPGPSPPRPPPGP 673 Score = 57.6 bits (133), Expect = 4e-07 Identities = 33/88 (37%), Positives = 33/88 (37%), Gaps = 8/88 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP- 748 PPPP G PP PPP PGPPPP P G P P P P P Sbjct: 377 PPPPGPPPPGPAPPGARPPPGPPP---PGPPPPGPAPPGARPPPPPPPPADEPQQGPAPS 433 Query: 749 -------PXPXAGPPXPAAPXXXPPXXG 811 P P AGPP P P P G Sbjct: 434 GDKPKKKPPPPAGPPPPGPPSPGPAPPG 461 Score = 57.6 bits (133), Expect = 4e-07 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAP---XXXAXPP 733 PPP P G PPPP PG PPPP PP AP PP Sbjct: 383 PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPP 442 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PP PP P P PA P PP Sbjct: 443 PPAGPPPPGPPSPGPAPPGARPP 465 Score = 57.2 bits (132), Expect = 5e-07 Identities = 31/81 (38%), Positives = 31/81 (38%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP---PP 739 P PPP G PP P P PP PP G P P PP PP Sbjct: 44 PRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPP--GPPPPGPPPPGPAPPGARPP 101 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP P PP PA P PP Sbjct: 102 PGPPPPGPPPPGPAPPGARPP 122 Score = 56.8 bits (131), Expect = 7e-07 Identities = 47/173 (27%), Positives = 47/173 (27%), Gaps = 3/173 (1%) Frame = -2 Query: 702 GXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPX 523 G PP G PG G PPP G PPPP Sbjct: 461 GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 520 Query: 522 XXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFL 343 P P PPPP P P PP PPPP G PP Sbjct: 521 APPGARPPPGPPPP-GPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP---- 575 Query: 342 XXXXXXXXXXXXXXPXPGXXXXGXXPP---PPXXXXPPRXPXTPXXPGGPGXP 193 P PG G PP PP PP P P GP P Sbjct: 576 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 628 Score = 55.6 bits (128), Expect = 2e-06 Identities = 32/85 (37%), Positives = 32/85 (37%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXX--------PGPPPPXPPXXGGXXXPXAPXXXAX 727 PPPP G PP PPP PGPPPP PP G P Sbjct: 578 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG--PAPPGARPPPG 635 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P PP P PP P PP Sbjct: 636 PPP-PGPPPPGPAPPGARPPPGPPP 659 Score = 55.2 bits (127), Expect = 2e-06 Identities = 56/213 (26%), Positives = 57/213 (26%), Gaps = 4/213 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G A G A G G G PP G PG Sbjct: 270 PGPPPPGPPPPGPAPPG--ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 327 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G PPPP G PPPP + P PPPP Sbjct: 328 GARP-PPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 386 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXX 280 P P PP PPPP G PP P P Sbjct: 387 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPPPP----------PPADEPQQGPAPSGDK 436 Query: 279 XGXXPPPPXXXXPPRXPXT-PXXPGG---PGXP 193 PPPP PP P P PG PG P Sbjct: 437 PKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPP 469 Score = 53.6 bits (123), Expect = 6e-06 Identities = 30/85 (35%), Positives = 30/85 (35%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP--GPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP G PPPPPP P GP P P P P P P Sbjct: 398 PPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPPAGPPPPGPPSPGP 457 Query: 743 XPPX--PXAGPPXPAAPXXXPPXXG 811 PP P GPP P P P G Sbjct: 458 APPGARPPPGPPPPGPPPPGPAPPG 482 Score = 52.0 bits (119), Expect = 2e-05 Identities = 38/139 (27%), Positives = 39/139 (28%), Gaps = 3/139 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G P + P PPPP P P PP PP Sbjct: 46 PPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPP 105 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPP---PPXX 250 PP G PP P PG G PP PP Sbjct: 106 PPGPPPPGPAPPGARPPPGPPP----PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGA 161 Query: 249 XXPPRXPXTPXXPGGPGXP 193 PP P P GP P Sbjct: 162 RPPPGPPPPGPPPPGPAPP 180 Score = 52.0 bits (119), Expect = 2e-05 Identities = 48/176 (27%), Positives = 49/176 (27%), Gaps = 10/176 (5%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGG---GXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXX 520 PP G G G G G + PP P G PPP P Sbjct: 47 PPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 106 Query: 519 XGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP---PPPXXXXXXXXGXG-GGGXXXPPXF 352 G P P PP PPP P P PP PPP G PP Sbjct: 107 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 166 Query: 351 FFLXXXXXXXXXXXXXXPXPGXXXXGXXPP---PPXXXXPPRXPXTPXXPGGPGXP 193 P PG G PP PP PP P P GP P Sbjct: 167 PPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 222 Score = 50.8 bits (116), Expect = 4e-05 Identities = 39/134 (29%), Positives = 39/134 (29%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G A G A G G G PP G PG Sbjct: 550 PGPPPPGPPPPGPAPPG--ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 607 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G PPPP G PPPP P PPPPP Sbjct: 608 GA------RPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPP 661 Query: 459 PXPXXPXXPPPPPP 418 P P P PP PPP Sbjct: 662 PGPSPPRPPPGPPP 675 Score = 50.0 bits (114), Expect = 8e-05 Identities = 59/224 (26%), Positives = 59/224 (26%), Gaps = 15/224 (6%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G A G A G G G PP G PG Sbjct: 333 PGPPPPGPPPPGPAPPG--ARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 390 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXX---------GXXXKXPXPX 487 G PPPP G PPPPP K P P Sbjct: 391 GA------RPPPGPPPPGPPPPGPAPPGARPPPPPPPPADEPQQGPAPSGDKPKKKPPPP 444 Query: 486 XXXXPPPPP---PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXX 316 PP PP P P PP PPPP G PP Sbjct: 445 AGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP----PGPPPPGPA 500 Query: 315 XXXXXPXPGXXXXGXXPP---PPXXXXPPRXPXTPXXPGGPGXP 193 P PG G PP PP PP P P GP P Sbjct: 501 PPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPP 544 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +2 Query: 626 PPPPPPXXXPGP---PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 P PPPP G P PP G P P P PPP P P P A P Sbjct: 44 PRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPG 103 Query: 797 PPXXG 811 PP G Sbjct: 104 PPPPG 108 Score = 44.4 bits (100), Expect = 0.004 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXP-PPPPXXXXXXXTPPP 425 PPPP G G PPPP G P P P PPPP PPP Sbjct: 615 PPPPGPPPPGPAPPGARPPPGPPPP---GPPPPGPAPPGARPPPGPPPPPPGPSPPRPPP 671 Query: 424 PPPPE 410 PPP+ Sbjct: 672 GPPPQ 676 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P G P PPPP P PPP PP G PPG P Sbjct: 618 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPPRPPPGPP 674 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 123 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 181 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 144 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 202 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 165 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 223 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 186 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 244 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 207 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPG 265 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 270 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 328 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 291 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 349 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 312 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 370 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 333 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 391 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 354 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 412 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 571 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 629 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 5/59 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXP----PPXXPPXXGGXXXXXXPPG 719 P PP P G A P PPPP PP P P PP PP G PPG Sbjct: 592 PGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 650 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 105 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 164 Query: 717 GXP 725 P Sbjct: 165 PGP 167 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 126 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 185 Query: 717 GXP 725 P Sbjct: 186 PGP 188 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 147 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 206 Query: 717 GXP 725 P Sbjct: 207 PGP 209 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 168 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 227 Query: 717 GXP 725 P Sbjct: 228 PGP 230 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 189 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 248 Query: 717 GXP 725 P Sbjct: 249 PGP 251 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 210 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPP 269 Query: 717 GXP 725 P Sbjct: 270 PGP 272 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 252 PPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 311 Query: 717 GXP 725 P Sbjct: 312 PGP 314 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 273 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 332 Query: 717 GXP 725 P Sbjct: 333 PGP 335 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 294 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 353 Query: 717 GXP 725 P Sbjct: 354 PGP 356 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 315 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 374 Query: 717 GXP 725 P Sbjct: 375 PGP 377 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 336 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 395 Query: 717 GXP 725 P Sbjct: 396 PGP 398 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 357 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 416 Query: 717 GXP 725 P Sbjct: 417 PPP 419 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 553 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 612 Query: 717 GXP 725 P Sbjct: 613 PGP 615 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 574 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 633 Query: 717 GXP 725 P Sbjct: 634 PGP 636 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX-------PPPXXPPXXGGXXXXXXPP 716 P PPPP G P P PPPP P PPP PP G PP Sbjct: 595 PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPP 654 Query: 717 GXP 725 P Sbjct: 655 PGP 657 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXX-PXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPP P PPPP G P P P P P GPP P P P Sbjct: 37 PPPGGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPPPPGPAPP 96 Query: 809 G 811 G Sbjct: 97 G 97 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PP P G P PPPP P PP PP G PPG Sbjct: 233 PGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 286 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP--PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G + P P PPP P PPP P G PP P Sbjct: 437 PKKKPPPPAGPPPPGPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP 494 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 121 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 172 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 142 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 193 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 163 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 214 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 184 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 235 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 268 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 319 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 289 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 340 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 310 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 361 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 331 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 382 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 352 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 403 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 569 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 620 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 590 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPGP 641 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 611 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPPPP 662 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP G P PPPP P P PPP PP Sbjct: 637 PPPGPPPPGPAPPGARPPPGPP-PPPPGP-SPPRPPPGPPP 675 Score = 35.9 bits (79), Expect = 1.3 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A PPP PP P PPP P G PP P Sbjct: 205 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPGPPPLGP 256 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP G P PPP P PPP P G PP P Sbjct: 243 PGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP 298 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP---PPXXXPXPPPXXP 677 P PP P G P PPPP PP P PPP P Sbjct: 380 PGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPPPPPP 422 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP G A PPP PP P PPP P G PP Sbjct: 373 PPPGPPPPGPPPPG--PAPPGARPPPGPP--PPGPPPPGPAPPGARPPPPPPP 421 Score = 34.7 bits (76), Expect = 3.0 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G G PPPP G P P P PPP P PP Sbjct: 104 PPPPGPPPPGPAPPGARPPPGPPPP---GPPPPGPAPPGARPPPGPPP--------PGPP 152 Query: 421 PP 416 PP Sbjct: 153 PP 154 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXX-KXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPP GE K P P P P PPPP PP Sbjct: 40 GGGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGPP 89 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPPXXGGXXXXXXPPG 719 P P PP G P P PPPP P PP PP G PPG Sbjct: 68 PEQGPAPP-----GARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPG 118 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXG--GGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPP PPP PP G PP P Sbjct: 415 PPPPPPPPADEPQQGPAPSGDKPKKKPPPP----AGPPPPGPPSPGPAPPGARPPPGP 468 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 65.7 bits (153), Expect = 1e-09 Identities = 39/100 (39%), Positives = 39/100 (39%), Gaps = 10/100 (10%) Frame = +2 Query: 533 GGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPPPXPPXX----- 685 GG PPPPP G PPPPPP P GPPPP PP Sbjct: 701 GGSSALPPITGGPPPPP-----GLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPIS 755 Query: 686 GGXXXPXAPXXXAXPPPPPXPPXP-XAGPPXPAAPXXXPP 802 GG P P PPPPP PP GPP P P P Sbjct: 756 GGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFAP 795 Score = 62.5 bits (145), Expect = 1e-08 Identities = 38/107 (35%), Positives = 39/107 (36%), Gaps = 5/107 (4%) Frame = +2 Query: 497 GXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPP---PXXXPGPPP 667 G P GG + PPPP GG PPPPP P GPPP Sbjct: 701 GGSSALPPITGGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPP 760 Query: 668 PXPPXXGGXXXPXAPXXXAXP--PPPPXPPXPXAGPPXPAAPXXXPP 802 P PP G P P PPPP PP A P P P PP Sbjct: 761 PPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFA-PMAPVIPDYLPP 806 Score = 56.4 bits (130), Expect = 9e-07 Identities = 27/65 (41%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPPP GG PPP PP G P P PPPPPP PP Sbjct: 726 PPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPP 785 Query: 429 PPPPP 415 PPPPP Sbjct: 786 PPPPP 790 Score = 54.4 bits (125), Expect = 4e-06 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 3/78 (3%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXXP---GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P GG PPPPP P GPPPP PP G P PPP P Sbjct: 696 PSTSAGGSSALPPITGGPPPPPGLPPITGGPPPPPPP---GGLPPITGGPPPPPPPGGLP 752 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 753 PISGGPPPPPPPPGGCPP 770 Score = 46.4 bits (105), Expect = 0.001 Identities = 38/127 (29%), Positives = 38/127 (29%), Gaps = 2/127 (1%) Frame = -2 Query: 594 PPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP--XPXXPXXPPPPP 421 P GG T PPPP P PPPPPP P PPPPP Sbjct: 696 PSTSAGGSSALPPITGGPPPPPGL---------PPITGGPPPPPPPGGLPPITGGPPPPP 746 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP GG PP P PG G PPPP Sbjct: 747 PPGGLPPI-----SGGPPPPP-------PPPGGCPPPPPPPPPGGFKGGPPPPPPPGMFA 794 Query: 240 PRXPXTP 220 P P P Sbjct: 795 PMAPVIP 801 Score = 46.4 bits (105), Expect = 0.001 Identities = 34/103 (33%), Positives = 34/103 (33%), Gaps = 6/103 (5%) Frame = -2 Query: 636 GGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP-- 463 GG PPPP G PPPPP P P PPPP Sbjct: 701 GGSSALPPITGGPPPPP-----GLPPITGGPPPPPPPGGLPPITGGPPP-----PPPPGG 750 Query: 462 -PPXPXXPXXPPPPP---PPXXXXXXXXGXGGGGXXXPPXFFF 346 PP P PPPPP PP G GG PP F Sbjct: 751 LPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPPPGMF 793 Score = 45.2 bits (102), Expect = 0.002 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP-XPPXXGGXXXPXAPXXXAXPP---P 736 P PPP PP PPPP PP GG P P PP Sbjct: 684 PLPPPTKMNLSAPSTSAGGSSALPPITGGPPPPPGLPPITGG--PPPPPPPGGLPPITGG 741 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXG 811 PP PP P PP P PP G Sbjct: 742 PPPPPPPGGLPPISGGPPPPPPPPG 766 Score = 45.2 bits (102), Expect = 0.002 Identities = 28/63 (44%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP---XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP GG C PPPPPP GPPPP PP G P AP PP Sbjct: 759 PPPPPPPGG----CP----PPPPPPPPGGFKGGPPPPPPP---GMFAPMAPVIPDYLPPK 807 Query: 740 PXP 748 P Sbjct: 808 KVP 810 Score = 43.2 bits (97), Expect = 0.009 Identities = 25/63 (39%), Positives = 25/63 (39%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP GG G PPPPP P PPPPP PPPP Sbjct: 742 PPPPPPPGGLPPISGGP---PPPPPP-----------PGGCPPPPPPPPPGGFKGGPPPP 787 Query: 421 PPP 413 PPP Sbjct: 788 PPP 790 Score = 38.3 bits (85), Expect = 0.25 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 6/77 (7%) Frame = +3 Query: 507 LXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPP---PPPXXXPXPPP--- 668 L +P GG PPPP G P PPP PP P PPP Sbjct: 693 LSAPSTSAGGSSALPPITGGPPPPP---GLPPITGGPPPPPPPGGLPPITGGPPPPPPPG 749 Query: 669 XXPPXXGGXXXXXXPPG 719 PP GG PPG Sbjct: 750 GLPPISGGPPPPPPPPG 766 Score = 37.5 bits (83), Expect = 0.43 Identities = 31/95 (32%), Positives = 31/95 (32%), Gaps = 2/95 (2%) Frame = -2 Query: 702 GXXXPPXXGGXGG--GGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPP 529 G PP GG GGP GG PPPP G PPPP Sbjct: 725 GPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGG-----------CPPPPP 773 Query: 528 PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 P G P PPPPPP P P P Sbjct: 774 PPPPGGFKGGP-------PPPPPPGMFAPMAPVIP 801 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 65.7 bits (153), Expect = 1e-09 Identities = 31/78 (39%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPPPPP PPPP PP P P PPPPP Sbjct: 242 PSPPPSPRPPSPPPPSPSPPPPPPP-----PPPPPPPPPPSPPPPPPPPPPPPPPPPPPS 296 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 297 PSPPRKPPSPSPPVPPPP 314 Score = 59.7 bits (138), Expect = 9e-08 Identities = 28/77 (36%), Positives = 29/77 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP P PP PP P PPPP PP P PPPPP P Sbjct: 230 PPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Query: 749 PXPXAGPPXPAAPXXXP 799 P P PP P+ P P Sbjct: 290 PPPP--PPSPSPPRKPP 304 Score = 59.7 bits (138), Expect = 9e-08 Identities = 29/74 (39%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPPPPP P PPPP PP P +P PP P P Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPP 309 Query: 749 PXPXAGPP--XPAA 784 P PP PAA Sbjct: 310 VPPPPSPPSVLPAA 323 Score = 56.0 bits (129), Expect = 1e-06 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP P PP P PP P P PPPPP PP P PP P P PP Sbjct: 241 PPSPPPS--PRPPSPPPPS------PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 55.6 bits (128), Expect = 2e-06 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P PP PP P P PPPPP PP P PP P P PP Sbjct: 228 PLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 55.2 bits (127), Expect = 2e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPPPP P P PPPPPPP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPP 285 Score = 53.6 bits (123), Expect = 6e-06 Identities = 23/59 (38%), Positives = 24/59 (40%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP P P PP P P P +P PPPPP PP P P P P PP Sbjct: 230 PPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 53.2 bits (122), Expect = 8e-06 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PP PP P P PPPPP P P PPPPP Sbjct: 230 PPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 289 Query: 420 PP 415 PP Sbjct: 290 PP 291 Score = 51.6 bits (118), Expect = 2e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPP PP P P PPPPPPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PP PPP P P PPPPPPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P P PPPP P P PPPPPPP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PP P PP Sbjct: 268 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPP 309 Score = 50.4 bits (115), Expect = 6e-05 Identities = 24/62 (38%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P + PPPPP P P PPPPPP P P PPPPP Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPP-----PPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Query: 420 PP 415 P Sbjct: 296 SP 297 Score = 49.6 bits (113), Expect = 1e-04 Identities = 26/73 (35%), Positives = 26/73 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPP PP P PPPP PP P PP PP P Sbjct: 262 PPPPPPP-------PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPP 314 Query: 749 PXPXAGPPXPAAP 787 P P P Sbjct: 315 SPPSVLPAATGFP 327 Score = 48.4 bits (110), Expect = 2e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PPPPP P P PPPPPP P P P PP Sbjct: 245 PPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPP 304 Query: 420 PP 415 P Sbjct: 305 SP 306 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 + P PP PPPPP P P PPP P P P P P Sbjct: 249 RPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSP 308 Query: 426 PPPP 415 P PP Sbjct: 309 PVPP 312 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP---PXPPXPXAGPPXPAAPXXX 796 P P P P PP P P P PPPP P PP P PP P P Sbjct: 219 PIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSP 278 Query: 797 PP 802 PP Sbjct: 279 PP 280 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP + P P PP PPP P PPPPPPP Sbjct: 228 PLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPP 269 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPPPPP P PPP PP PP P Sbjct: 248 PRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKP 303 Score = 43.6 bits (98), Expect = 0.007 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPPPP P P PP PP P P PPP P Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPP----PPPPPPPSPSPPRKPPSPSPPVPPPPSP 316 Query: 420 P 418 P Sbjct: 317 P 317 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PP P P PPPPPP P PPP PP Sbjct: 246 PSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPP 286 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP + P PPPPPP P PP PP PP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPP 312 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP P PPPPPP P PPP PP Sbjct: 244 PPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPP--------PPPPPPP 295 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPPPP P PPP PP PP P Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPPP-PPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PP P PPPPP P P PPP P +P PP Sbjct: 250 PPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPP 309 Query: 421 PPP 413 PP Sbjct: 310 VPP 312 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPP---PXXXXXXXTPPPPPPP 413 PPPPP P P PPPP P +PP PPPP Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPP 314 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPPPP P PP P PP Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPP 317 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -1 Query: 595 PPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 P G G P PP P P PP PP PPPPPP Sbjct: 209 PTGLSGPNVNPIGPAPNNSPLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPP 268 Query: 415 P 413 P Sbjct: 269 P 269 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP + P P PPPP P PPP PP PP P Sbjct: 235 PTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P P P PPPP P PPP PP PP P Sbjct: 228 PLPPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPP 283 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PP P PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSP-----SPPVPPPP 314 Query: 421 PPP 413 PP Sbjct: 315 SPP 317 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP 442 PPPP PPPPP K P P PPPP P P Sbjct: 270 PPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPV-PPPPSPPSVLP 321 >UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein; n=1; Yarrowia lipolytica|Rep: Similar to tr|Q95JC9 Sus scrofa Basic proline-rich protein - Yarrowia lipolytica (Candida lipolytica) Length = 659 Score = 65.3 bits (152), Expect = 2e-09 Identities = 30/74 (40%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP GG PP PPP G P PP G P AP + PP PP P Sbjct: 381 PAPPPVPGGAAPPIPGSAAPPAPPPAPPAGFGAPAPPSFGAPTPPPAPPAPSAPPAPPAP 440 Query: 749 PXPXAGPP-XPAAP 787 P P + PP P P Sbjct: 441 PAPPSEPPSTPRGP 454 Score = 54.4 bits (125), Expect = 4e-06 Identities = 40/138 (28%), Positives = 40/138 (28%), Gaps = 3/138 (2%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP-PPP 421 PPP GG PPP G P PPP PP P P PP PP Sbjct: 383 PPPVPGGAAPPIPGSAAPPAPPPAPPAGFGAPAPPSFGAPTPPPAPPAPSAPPAPPAPPA 442 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP G G P P PG G PP P P Sbjct: 443 PPSEPPSTPRGPAMFGAPMP-------KSPAAASPGAPPPPPPGAAAPGLAPPAPPAQPP 495 Query: 240 P--RXPXTPXXPGGPGXP 193 R P P GP P Sbjct: 496 SPGRPSGAPPPPPGPPAP 513 Score = 49.6 bits (113), Expect = 1e-04 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 14/80 (17%) Frame = +2 Query: 626 PPPPPPXXXPGP------------PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA-- 763 PPP PP P P PP PP AP P PPP PP P A Sbjct: 376 PPPAPPAPPPVPGGAAPPIPGSAAPPAPPPAPPAGFGAPAPPSFGAPTPPPAPPAPSAPP 435 Query: 764 GPPXPAAPXXXPPXXGXGGA 823 PP P AP PP G A Sbjct: 436 APPAPPAPPSEPPSTPRGPA 455 Score = 49.2 bits (112), Expect = 1e-04 Identities = 33/96 (34%), Positives = 35/96 (36%), Gaps = 15/96 (15%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP----PXXXPGPP-PPXPPXXG----------GXXXP 703 PPP P G G P PPP P P PP PP PP G P Sbjct: 403 PPPAPPAGFGAPAPPSFGAPTPPPAPPAPSAPPAPPAPPAPPSEPPSTPRGPAMFGAPMP 462 Query: 704 XAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 +P + PPP PP A P AP PP G Sbjct: 463 KSPAAASPGAPPPPPPGAAAPGLAPPAPPAQPPSPG 498 Score = 44.8 bits (101), Expect = 0.003 Identities = 32/105 (30%), Positives = 32/105 (30%), Gaps = 9/105 (8%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXC-----XXXXXPPPPPPXXXPGPPPPXPP 679 P GG PPP G G P PP P P PP P P Sbjct: 384 PPVPGGAAPPIPGSAAPPAPPPAPPAGFGAPAPPSFGAPTPPPAPPAPSAPPAPPAPPAP 443 Query: 680 XXGGXXXPXAPXXXAXP-PPPPXPPXPXAGPPXP---AAPXXXPP 802 P P P P P P A PP P AAP PP Sbjct: 444 PSEPPSTPRGPAMFGAPMPKSPAAASPGAPPPPPPGAAAPGLAPP 488 Score = 44.8 bits (101), Expect = 0.003 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP P P P PG PPP PP G AP A P PP Sbjct: 440 PPAPPSEPPSTPRGPAMFGAPMPKSPAAASPGAPPPPPP--GAAAPGLAP--PAPPAQPP 495 Query: 743 XPPXPXAGPPXPAAPXXXP 799 P P PP P P P Sbjct: 496 SPGRPSGAPPPPPGPPAPP 514 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP P P PP G PPPPP P G P P P P Sbjct: 241 PPPPPGGAPPIPGGAPPPLPGKVSTSGGAPTFGAPPPPPPGGAPAYGAPAPPTPGTSSP 299 Score = 43.6 bits (98), Expect = 0.007 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 3/73 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP---PP 739 PPP P PPPPPP P P PP G P PP P Sbjct: 256 PPPLPGKVSTSGGAPTFGAPPPPPPGGAPAYGAPAPPTPGTSSPKPPPKPAKRPPALKPK 315 Query: 740 PXPPXPXAGPPXP 778 P P P P P Sbjct: 316 PKIPTPGLKPAVP 328 Score = 42.7 bits (96), Expect = 0.011 Identities = 29/89 (32%), Positives = 30/89 (33%), Gaps = 8/89 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP--PXXXPGPPP--PXPPXXGGXXX----PXAPXXXA 724 PPPPP G PP P P P PPP P PP + Sbjct: 474 PPPPPGAAAPGLAPPAPPAQPPSPGRPSGAPPPPPGPPAPPTDQFHSMILDDGSSSGSHG 533 Query: 725 XPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPPPP P G AP PP G Sbjct: 534 APPPPPPSAPPSNGGHSHGAPPPPPPNGG 562 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPPP P PPPPPP GG PP Sbjct: 4 PPPPPPPPPPGFGGPPPPPPPGGGFGALSSGGAPKAGPP 42 Score = 41.5 bits (93), Expect = 0.026 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 9/82 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP---------PPXXXPGPPPPXPPXXGGXXXPXAPXXX 721 PPPPP GG PP P P P PPPP G P P Sbjct: 241 PPPPP---GGAPPIPGGAPPPLPGKVSTSGGAPTFGAPPPPPPGGAPAYGAPAPPTPGTS 297 Query: 722 AXPPPPPXPPXPXAGPPXPAAP 787 + PPP P A P P P Sbjct: 298 SPKPPPKPAKRPPALKPKPKIP 319 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPPP GPPPP PP G A PP Sbjct: 7 PPPPPPPGFGGPPPPPPPGGGFGALSSGGAPKAGPP 42 Score = 39.9 bits (89), Expect = 0.081 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-----PPPXPPXXGGXXXPXAPXXXAXPP 733 PPP P PP PP GP P P P P P A P Sbjct: 424 PPPAPPAPSAPPAPPAPPAPPSEPPSTPRGPAMFGAPMPKSPAAASPGAPPPPPPGAAAP 483 Query: 734 --PPPXPPXPXAGPPXPAAPXXXPP 802 PP PP PP P P PP Sbjct: 484 GLAPPAPPAQ---PPSPGRPSGAPP 505 Score = 39.1 bits (87), Expect = 0.14 Identities = 41/156 (26%), Positives = 42/156 (26%), Gaps = 5/156 (3%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGG-----GGXXXXXGXGXFXXFPXX 523 GG PPPP P G G GG G G P Sbjct: 204 GGFAPPPPPAPPGGAPAIPGAPSVASSYRSASASSGAPPPPPGGAPPIPG-GAPPPLPGK 262 Query: 524 XGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXP 703 GG PPPPP GG PP P PP P P Sbjct: 263 VSTSGG---APTFGAPPPPPP---GGAPAYGAPAPPTPGTSSPKPPPKPAKRPPALKPKP 316 Query: 704 XAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P P P P + P P AP PP G Sbjct: 317 KIP-TPGLKPAVPTPGQRRSVSPSPGAP--PPPIPG 349 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPP G G PPP G P PP PP P Sbjct: 379 APPAPPPVPGGAAPPIPGSAAPPAPPPAPPAGFGAPAPPSFGAPTPPPAPPAPSAPPAPP 438 Query: 430 PPPPPP 413 PP PP Sbjct: 439 APPAPP 444 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 722 AXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 A PPPPP PP GPP P P GGA Sbjct: 3 APPPPPPPPPPGFGGPPPPPPPGGGFGALSSGGA 36 Score = 37.1 bits (82), Expect = 0.57 Identities = 53/222 (23%), Positives = 55/222 (24%), Gaps = 12/222 (5%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXG--GGGPGX 649 AP P A GG G + G PP G GG P Sbjct: 199 APSAPGGFAPPPPPAPPGGAPAIPGAPSVASSYRSASASSGAPPPPPGGAPPIPGGAPPP 258 Query: 648 XXG--GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXX--PPPPP----XXXGXXXKXPX 493 G GG PPPP G T P PPP K Sbjct: 259 LPGKVSTSGGAPTFGAPPPPPPGGAPAYGAPAPPTPGTSSPKPPPKPAKRPPALKPKPKI 318 Query: 492 PXXXXXPPPPPPXPXXPXXPPP--PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXX 319 P P P P P P PPPP + Sbjct: 319 PTPGLKPAVPTPGQRRSVSPSPGAPPPPIPGSVAPSVRHAPSQSVSSIASSVSTPSTPPP 378 Query: 318 XXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P PG G PP P PP P P P G G P Sbjct: 379 APPAPPPVPG----GAAPPIPGSAAPPAPPPAP--PAGFGAP 414 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXG 689 P PPPPPP PPP PP G Sbjct: 4 PPPPPPPPPPGFGGPPPPPPPGGG 27 Score = 34.7 bits (76), Expect = 3.0 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPP PPPP PP GG PPPPP P AP PP Sbjct: 2 PAPPP-----PPPPPPPGFGG------------PPPPPPPGGGFGALSSGGAPKAGPP 42 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 479 PXPPPPPXXLXXXXNPPPPPPPXXXXXXXXXXGGGGXXXP 360 P PPPPP PPPPPP GG P Sbjct: 2 PAPPPPPPPPPPGFGGPPPPPPPGGGFGALSSGGAPKAGP 41 Score = 34.3 bits (75), Expect = 4.0 Identities = 30/100 (30%), Positives = 31/100 (31%), Gaps = 7/100 (7%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXX----GXXXXXPPPPPX 524 PP GG G GG G A PPPP G G PPP P Sbjct: 249 PPIPGGAPPPLPGKVSTSGGAPTFG--APPPPPPGGAPAYGAPAPPTPGTSSPKPPPKPA 306 Query: 523 XXGEXXKX-PXXPXXXXXPPPPPXXXXXXXTPPP--PPPP 413 K P P P P +P P PPPP Sbjct: 307 KRPPALKPKPKIPTPGLKPAVPTPGQRRSVSPSPGAPPPP 346 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP PP P P PP G PP P Sbjct: 373 PSTPPPAPPAPPPVPGGAAPPIPGSAAPPAPPPAPP 408 Score = 34.3 bits (75), Expect(2) = 0.006 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP--PXXXPXPPPXXP 677 P PPPP G P PP P P P PPP P Sbjct: 470 PGAPPPPPPGAAAPGLAPPAPPAQPPSPGRPSGAPPPPPGPP 511 Score = 33.9 bits (74), Expect = 5.3 Identities = 22/68 (32%), Positives = 24/68 (35%), Gaps = 5/68 (7%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG---PPXP--AAPXX 793 PPPP P P + + PPP P P P G PP P AAP Sbjct: 343 PPPPIPGSVAPSVRHAPSQSVSSIASSVSTPSTPPPAPPAPPPVPGGAAPPIPGSAAPPA 402 Query: 794 XPPXXGXG 817 PP G Sbjct: 403 PPPAPPAG 410 Score = 33.9 bits (74), Expect = 5.3 Identities = 31/121 (25%), Positives = 31/121 (25%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P G G PPP P P P PP PP P P P P Sbjct: 404 PPAPPAGFGAPAPPSFGAPTPPPAP---------PAPSAPPAPPAPPAPPSEPPSTPRGP 454 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP P PG G PPPP P Sbjct: 455 AMFGAPMPKSPAAASPGAPPPPPPGAAAPGLAPPAPPAQPPSPG-RPSGAPPPPPGPPAP 513 Query: 240 P 238 P Sbjct: 514 P 514 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP G + PPP PP P P PP Sbjct: 401 PAPPPAPPAGFGAPAPPSFGAPTPPPAPPAPSAPPAPPAPP 441 Score = 28.7 bits (61), Expect(2) = 0.006 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 654 PXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP PP GG PP P Sbjct: 536 PPPPPSAPPSNGGHSHGAPPPPPP 559 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 64.9 bits (151), Expect = 2e-09 Identities = 30/67 (44%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX--PGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G PPPPP P PPPP PP GG P P PPPP Sbjct: 579 PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPG 638 Query: 743 XPPXPXA 763 PP P A Sbjct: 639 APPAPGA 645 Score = 61.7 bits (143), Expect = 2e-08 Identities = 29/65 (44%), Positives = 30/65 (46%), Gaps = 7/65 (10%) Frame = +2 Query: 626 PPPPPPXXXPG----PPPPXPPXXGGXXXPXAPXXXAXPP---PPPXPPXPXAGPPXPAA 784 PPPPPP PG PPPP PP G P PP PPP PP P +GPP P Sbjct: 579 PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPG 638 Query: 785 PXXXP 799 P Sbjct: 639 APPAP 643 Score = 59.7 bits (138), Expect = 9e-08 Identities = 28/68 (41%), Positives = 28/68 (41%), Gaps = 6/68 (8%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAP------XXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PP P P PPPP PP G P P PPPPP PP P GPP P P Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPG 630 Query: 794 XPPXXGXG 817 P G Sbjct: 631 SGPPPPPG 638 Score = 50.0 bits (114), Expect = 8e-05 Identities = 26/56 (46%), Positives = 26/56 (46%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G GG P PPPPPP P PPP PP G PPG P Sbjct: 593 PPPPPPPPPPSGSGG---APPPPPPPPPPGGGPPPPP--PPPGSG---PPPPPGAP 640 Score = 49.2 bits (112), Expect = 1e-04 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPP G P P PPPPP P PPPP Sbjct: 579 PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPPPG 638 Query: 420 PP 415 P Sbjct: 639 AP 640 Score = 49.2 bits (112), Expect = 1e-04 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP G P P PPPP P PPPPPPP G G P Sbjct: 581 PPPPPPLPGAEAPPPPPP----PPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPP 636 Query: 360 P 358 P Sbjct: 637 P 637 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP G A P PPPPPP P PPP PP GG PPG Sbjct: 578 PPPPPPPPPLPG-----AEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPG 630 Score = 46.8 bits (106), Expect = 7e-04 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPP G P P PPPPP P Sbjct: 576 AAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPP 635 Query: 430 PPPPPP 413 PP PP Sbjct: 636 PPGAPP 641 Score = 46.8 bits (106), Expect = 7e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP G GG PPPPP G P P PPPPP P P P Sbjct: 597 PPPPPPSGSGGAPP------PPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAPGAETGP 649 Score = 46.4 bits (105), Expect = 0.001 Identities = 33/102 (32%), Positives = 33/102 (32%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXX 319 P P PPPPPP PPPPPPP G GG PP Sbjct: 572 PSPAAAPPPPPPPPPLPGAEAPPPPPPPPPP------SGSGGAPPPP------------- 612 Query: 318 XXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPPP PP P P PG P Sbjct: 613 -----PPPPPPGGGPPPPPPPPGSGPPPPPGAPPAPGAETGP 649 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/61 (40%), Positives = 26/61 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP + P P PPPPPP PPPPPPP GGG P Sbjct: 579 PPPPPPPPLPGAEAPPP-----PPPPPPPSGSGGAPPPPPPPPPP--------GGGPPPP 625 Query: 360 P 358 P Sbjct: 626 P 626 Score = 44.4 bits (100), Expect = 0.004 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +2 Query: 707 APXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 AP A PPPP PP P G P P PP G GGA Sbjct: 570 APPSPAAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGA 608 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPPXXXXXXXXXXGGGGXXX 363 APPPPP P P PPP PPPPPP G G Sbjct: 577 APPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPPPP 636 Query: 362 P 360 P Sbjct: 637 P 637 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +3 Query: 609 AXXPXXPPPPPP---XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPPPPP P PPP PP G PP P Sbjct: 575 AAAPPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPP 616 Score = 38.3 bits (85), Expect = 0.25 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPP 458 G A PPPP G G PPPPP G P P PPPPP Sbjct: 589 GAEAPPPPPPPPPPSGS---GGAPPPPPPPPPPGG--GPPPPPPPPGSGPPPPP 637 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPPP PPPPPPP Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPP 599 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP 662 P G GG P PPPP GG P PPPPP P P Sbjct: 599 PPPPSGSGGA----PPPPPPPPPPGGGPPPPPPPPGSGPPPPPGAPPAP 643 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 64.9 bits (151), Expect = 2e-09 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP P P PPPPP P P PP P P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP-PPPPYVYPP 436 Score = 61.3 bits (142), Expect = 3e-08 Identities = 31/78 (39%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P P P P Sbjct: 379 PPPPPPP----------PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 429 PPPYVYPPPPSPPYVYPP 446 Score = 58.4 bits (135), Expect = 2e-07 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPPP PP P P PPPP P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP-PPSPPPYVYPPPPPPYVY-PPPPSP 440 Query: 749 PXPXAGPPXPAAPXXXP 799 P PP P P Sbjct: 441 PYVYPPPPPSPQPYMYP 457 Score = 53.2 bits (122), Expect = 8e-06 Identities = 27/65 (41%), Positives = 27/65 (41%) Frame = +2 Query: 608 CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 C PP PP P PPPP PP P P PPPPP PP P P P P Sbjct: 369 CASFGCSPPSPPPPPPPPPPPPPP-------PPPP----PPPPPPPPPPPYVYPSPPPPP 417 Query: 788 XXXPP 802 PP Sbjct: 418 PSPPP 422 Score = 50.8 bits (116), Expect = 4e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPPPPP P PPPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 50.4 bits (115), Expect = 6e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P PPPPP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 48.0 bits (109), Expect = 3e-04 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 G P P PPPPPP P P PPPPPPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PPPPPP P PPPPPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP PPPP PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 47.2 bits (107), Expect = 5e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPPPP P P PPPPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPP 417 Score = 46.8 bits (106), Expect = 7e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P PPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P PPP PPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 45.2 bits (102), Expect = 0.002 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P P PP P +P PPPP Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQ 452 Query: 749 PXPXAGPPXPAAP 787 P PP P Sbjct: 453 PYMYPSPPCNDLP 465 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPPP P P PPPPP PPPP PP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 44.4 bits (100), Expect = 0.004 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 PPPPP P P PPPPP PPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPP P P PP P Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQ 452 Query: 420 P 418 P Sbjct: 453 P 453 Score = 43.6 bits (98), Expect = 0.007 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP---PPPPXPXXPXXPP 430 PPPP PPPPP P P PP PPPP P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYV--YPP 436 Query: 429 PPPPP 415 PP PP Sbjct: 437 PPSPP 441 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP-- 428 PPPP PPPP P P PPPPP +PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYV 443 Query: 427 -PPPPP 413 PPPPP Sbjct: 444 YPPPPP 449 Score = 39.9 bits (89), Expect = 0.081 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 6/70 (8%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT---- 434 PPPP PPPPP P P PPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPY 442 Query: 433 --PPPPPPPE 410 PPPPP P+ Sbjct: 443 VYPPPPPSPQ 452 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 579 PXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P G P PPPPPP P PPP PP Sbjct: 366 PIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPP 399 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 7/67 (10%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP-------PPPXPXXP 442 PPPP PPPPP P P PPP PPP P Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Query: 441 XXPPPPP 421 P PP Sbjct: 454 YMYPSPP 460 >UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; Suberites domuncula|Rep: Wiskott-Aldrich syndrome protein - Suberites domuncula (Sponge) Length = 410 Score = 64.9 bits (151), Expect = 2e-09 Identities = 32/81 (39%), Positives = 33/81 (40%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G PPPPP PG PPPP G P P P PP Sbjct: 266 PPPPPNRGNTSRG--GGRGHPPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVGVPAPP 323 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP GPP P + PP Sbjct: 324 PPPPVGGTGPPKPPSAAGGPP 344 Score = 64.5 bits (150), Expect = 3e-09 Identities = 36/90 (40%), Positives = 37/90 (41%), Gaps = 4/90 (4%) Frame = +2 Query: 527 GGGGGXXXVXXXXXP----PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 GGG G P PPPP GG PPPPPP P PPPP P GG Sbjct: 278 GGGRGHPPPPPRGGPGRGGPPPPSNSRGGSA----PAPPPPPPVGVPAPPPP--PPVGGT 331 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAA 784 P P PPPPP P + P P A Sbjct: 332 GPPKPPSAAGGPPPPPSRDKPSSSLPAPPA 361 Score = 52.0 bits (119), Expect = 2e-05 Identities = 35/104 (33%), Positives = 35/104 (33%) Frame = -2 Query: 729 GXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXT 550 G G G PP GG G GGP GG PPPP G Sbjct: 273 GNTSRGGGRGHPPPPPRGGPGRGGPPPPSNSRGGSAPAP----PPPPPVG---------- 318 Query: 549 XXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP G P P PPPPP P P PP Sbjct: 319 VPAPPPPPPVGGTGP--PKPPSAAGGPPPPPSRDKPSSSLPAPP 360 Score = 50.0 bits (114), Expect = 8e-05 Identities = 31/87 (35%), Positives = 31/87 (35%), Gaps = 6/87 (6%) Frame = -2 Query: 600 PPPPXXGG---GGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX---PPPPPPXPXXPX 439 PPPP G GGG PPPPP P P P PPPP P Sbjct: 267 PPPPNRGNTSRGGGRGH------PPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVGVP 320 Query: 438 XPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPPP GG PP Sbjct: 321 APPPPPPVGGTGPPKPPSAAGGPPPPP 347 Score = 47.2 bits (107), Expect = 5e-04 Identities = 34/111 (30%), Positives = 35/111 (31%), Gaps = 1/111 (0%) Frame = -2 Query: 702 GXXXPPXXGGXG-GGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPP 526 G PP G GGG G GG PPPP GG + PPPPP Sbjct: 265 GPPPPPNRGNTSRGGGRGHPPPPPRGGPGRGG---PPPPSNSRGG------SAPAPPPPP 315 Query: 525 XXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 P P PP PP P PP P GG G Sbjct: 316 PVGVPAPPPPPPVGGTGPPKPPSAAGGPPPPPSRDKPSSSLPAPPAGGGRG 366 Score = 44.0 bits (99), Expect = 0.005 Identities = 33/106 (31%), Positives = 33/106 (31%), Gaps = 2/106 (1%) Frame = +2 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXX 559 PP P GGG G G G GG G P G Sbjct: 266 PPPPPNRGNTSRGGGRGHPPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVG------- 318 Query: 560 XXXPPPPPXXGGGGXXCXXXXX--PPPPPPXXXPGPPPPXPPXXGG 691 PPPPP GG G PPPPP P P PP GG Sbjct: 319 VPAPPPPPPVGGTGPPKPPSAAGGPPPPPSRDKPSSSLPAPPAGGG 364 Score = 37.1 bits (82), Expect = 0.57 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 4/88 (4%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P GG G GGP GG G PP GG GP Sbjct: 284 PPPPPRGGP-----GRGGPPPPSNSRGGSAPAPPPPPPVGVPAPPPPPPVGGTGPPKPPS 338 Query: 639 GGGGGXXXXXXKXP----PPPXXGGGGG 568 GG P P P GGG G Sbjct: 339 AAGGPPPPPSRDKPSSSLPAPPAGGGRG 366 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 64.5 bits (150), Expect = 3e-09 Identities = 35/79 (44%), Positives = 35/79 (44%), Gaps = 9/79 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP-------XXXPGPPPPXPPXXGGXXXPXAPXXXAX 727 P PPP GGGG PPPPPP P PPPP P GG P P Sbjct: 512 PMPPPPPGGGG------APPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGG 565 Query: 728 PPPPPXP--PXPXAGPPXP 778 PPPPP P P GPP P Sbjct: 566 PPPPPMPGMMRPGGGPPPP 584 Score = 60.5 bits (140), Expect = 5e-08 Identities = 35/96 (36%), Positives = 35/96 (36%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P GGGG PPPPP G G PPPP P GPPPP PP G Sbjct: 515 PPPPGGGGAPP-------PPPPPMPGRAGGG--PPPPPPPPMPGRAGGPPPPPPPPGMGG 565 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P PP GP P P P Sbjct: 566 PPPPPMPGMMRPGGGPPPPPMMMGPMVPVLPHGLKP 601 Score = 57.2 bits (132), Expect = 5e-07 Identities = 29/67 (43%), Positives = 29/67 (43%), Gaps = 6/67 (8%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXG--GXXXPXAP----XXXAXPPPPPXPPXPXAGPPXPAAPX 790 PPPPP PPPP PP G G P P A PPPP PP GPP P P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 791 XXPPXXG 811 P G Sbjct: 574 MMRPGGG 580 Score = 54.8 bits (126), Expect = 3e-06 Identities = 28/61 (45%), Positives = 28/61 (45%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP GGGG PPPPP G P PPPPPP P PPPPPP Sbjct: 514 PPPPPGGGGAP--------PPPPPPMPGRAGGGP------PPPPPPPMPGRAGGPPPPPP 559 Query: 417 P 415 P Sbjct: 560 P 560 Score = 52.4 bits (120), Expect = 1e-05 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Frame = -2 Query: 636 GGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP- 460 GGGG PPPP G GG PPP P G P P PPPPP Sbjct: 519 GGGGAPPP----PPPPMPGRAGGGPPPPP---PPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 459 PXPXXPXXPPPPPP 418 P P PPPPP Sbjct: 572 PGMMRPGGGPPPPP 585 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 6/60 (10%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAP----XXXAXPPPPPXPPXP--XAGPPXPAAPXXXPPXXGXGG 820 P PP PP GG P P PPPPP PP P GPP P PP G GG Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPP------PPPPGMGG 565 Score = 41.1 bits (92), Expect = 0.035 Identities = 33/110 (30%), Positives = 33/110 (30%), Gaps = 4/110 (3%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP----XXPPPPPPPXXXXXXXXGXGGGGX 370 P P P P PPPP P P PPPPPPP G GG Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP-----PMPGRAGGPP 555 Query: 369 XXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTP 220 PP P PG G PPPP P P P Sbjct: 556 PPPP---------PPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLP 596 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 1/55 (1%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXP-PXPXAGPPXPAAPXXXPPXXGXGG 820 P P P P P PPPPP P P G P P P PP G G Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP---PPMPGRAG 552 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 64.1 bits (149), Expect = 4e-09 Identities = 36/88 (40%), Positives = 36/88 (40%), Gaps = 7/88 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXX---CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G G PPPP GPPPP P GG P P PPPP Sbjct: 472 PPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPP 531 Query: 740 P----XPPXPXAGPPXPAAPXXXPPXXG 811 P PP P G P P P PP G Sbjct: 532 PMGGVPPPPPPMGGPVPLPP---PPAGG 556 Score = 61.7 bits (143), Expect = 2e-08 Identities = 32/70 (45%), Positives = 32/70 (45%), Gaps = 11/70 (15%) Frame = +2 Query: 626 PPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPP-------PPXPPXP-XAGPP 772 PPPPPP PG PPPP P G P P A PPP PP PP P GPP Sbjct: 458 PPPPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPP 517 Query: 773 XPAAPXXXPP 802 P P PP Sbjct: 518 PPPMPGTGPP 527 Score = 55.2 bits (127), Expect = 2e-06 Identities = 28/81 (34%), Positives = 28/81 (34%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPP G P P PPPPP P PPPP Sbjct: 462 PPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPM 521 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 P GG PP Sbjct: 522 PGTGPPPPPPPMGGVPPPPPP 542 Score = 52.0 bits (119), Expect = 2e-05 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP G P P PPPPP P PPPP P G GG P Sbjct: 460 PPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPP 519 Query: 360 P 358 P Sbjct: 520 P 520 Score = 51.6 bits (118), Expect = 2e-05 Identities = 28/81 (34%), Positives = 28/81 (34%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPP G P P PPPPP P PPPPP Sbjct: 473 PPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPGT-GPPPPPP 531 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 P GG PP Sbjct: 532 PMGGVPPPPPPMGGPVPLPPP 552 Score = 50.4 bits (115), Expect = 6e-05 Identities = 30/91 (32%), Positives = 30/91 (32%), Gaps = 2/91 (2%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXX--KXPPPPXXGGGGGXXXXXTXXXPPPPPXXX 517 PP G G P G G PPPP G G PPPP Sbjct: 463 PPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMP 522 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 G P P PPPPPP PPPP Sbjct: 523 GTGPPPPPPPMGGVPPPPPPMGGPVPLPPPP 553 Score = 46.0 bits (104), Expect = 0.001 Identities = 31/76 (40%), Positives = 31/76 (40%), Gaps = 12/76 (15%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-------PXPPXP-XAGPPXPA 781 P PPPP PPPP P G P P A PPPP P PP P GPP P Sbjct: 456 PTPPPP-----PPPPM-PGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPP 509 Query: 782 AP----XXXPPXXGXG 817 P PP G G Sbjct: 510 MPGIGGPPPPPMPGTG 525 Score = 45.2 bits (102), Expect = 0.002 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 3/63 (4%) Frame = +2 Query: 641 PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP---AAPXXXPPXXG 811 P PPPP PP G P P PPPP P A PP P PP G Sbjct: 453 PTIPTPPPPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPG 512 Query: 812 XGG 820 GG Sbjct: 513 IGG 515 Score = 44.0 bits (99), Expect = 0.005 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPP G PPPPP P P PPPPP Sbjct: 479 GIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPPP----MG 534 Query: 439 XTPPPPPP 416 PPPPPP Sbjct: 535 GVPPPPPP 542 Score = 43.6 bits (98), Expect = 0.007 Identities = 29/97 (29%), Positives = 30/97 (30%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXX 313 P PPPPPP PPPPP P G G PP + Sbjct: 453 PTIPTPPPPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPG 512 Query: 312 XXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 P P G PPPP P P GGP Sbjct: 513 IGGPPPPPMPGTGPPPPPPPMGG---VPPPPPPMGGP 546 Score = 41.1 bits (92), Expect = 0.035 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = -1 Query: 601 PPPPXXXG-GGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP 425 PPPP G G PPPP G P PPPPP PPP Sbjct: 461 PPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPP 520 Query: 424 -----PPPP 413 PPPP Sbjct: 521 MPGTGPPPP 529 Score = 41.1 bits (92), Expect = 0.035 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 3/70 (4%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXP---XXPPPPPPXXXPXPPPXXPPXX 686 P G G P PPP G G P PPPPPP PPP PP Sbjct: 486 PPMPGIGAHPPPPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPPPMGGVPPP--PPPM 543 Query: 687 GGXXXXXXPP 716 GG PP Sbjct: 544 GGPVPLPPPP 553 Score = 39.9 bits (89), Expect = 0.081 Identities = 28/93 (30%), Positives = 29/93 (31%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXP 292 PPPPP P P PPPPP G G PP + P P Sbjct: 458 PPPPPPPPMPGIGAPPPPPMP---------GIGAPPPPPMPGIGAHPPPPMPGIVGPPPP 508 Query: 291 GXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 G PPPP P P P P P Sbjct: 509 PMPGIGGPPPPPMPGTGPPPPPPPMGGVPPPPP 541 Score = 37.1 bits (82), Expect = 0.57 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXP---XXPPPPPPXXXPXPPPXXPPXX 686 P G G P PPP G G P PPPPPP P P P PP Sbjct: 497 PPMPGIVGPPPPPMPGIGGPPPPPMPGTGPPPPPPPMGGVPPPPPPMGGPVPLP--PPPA 554 Query: 687 GG 692 GG Sbjct: 555 GG 556 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP-----XXPPPPPPXXXPXPPPXXPPXXG 689 P PPPP G G P PPPP P PPP P G Sbjct: 456 PTPPPPPPPPMPGIGAPPPPPMPGIGAPPPPPMPGIGAHPPPPMPGIVG 504 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 64.1 bits (149), Expect = 4e-09 Identities = 32/80 (40%), Positives = 32/80 (40%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA--PXXXAXPPPPP 742 PPPPP G PPPP P PPPP P G P A P A PPP Sbjct: 348 PPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPP 407 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P G P P PP Sbjct: 408 PPPPPLGGKFLPPPPPPPPP 427 Score = 60.9 bits (141), Expect = 4e-08 Identities = 31/77 (40%), Positives = 31/77 (40%), Gaps = 4/77 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXG----GXXXPXAPXXXAXPPP 736 PPPPP G PPPPPP PPPP PP P P PPP Sbjct: 294 PPPPPPPGTN---TTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPP 350 Query: 737 PPXPPXPXAGPPXPAAP 787 PP PP G P P P Sbjct: 351 PPPPPPGNMGVPPPPPP 367 Score = 60.1 bits (139), Expect = 7e-08 Identities = 34/87 (39%), Positives = 36/87 (41%), Gaps = 6/87 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP------XXXAXP 730 PPPPP G G PPPPPP PPPP PP G P P + P Sbjct: 336 PPPPPRPGNMGVP----PPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLP 391 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PP P PP + P P P PP G Sbjct: 392 PPAPPPPQNASMAPPPPPP---PPLGG 415 Score = 58.8 bits (136), Expect = 2e-07 Identities = 36/91 (39%), Positives = 36/91 (39%), Gaps = 13/91 (14%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX----PGPPPPXPPXXGG---XXXPXAPXXXAX 727 PPPPP G G PPPPPP P PPPP PP G P P Sbjct: 322 PPPPPPPGNMGVL------PPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPPPPGNMCI 375 Query: 728 PPPPPXPP------XPXAGPPXPAAPXXXPP 802 PPPPP PP P PP P PP Sbjct: 376 PPPPPPPPGYTGSSLPPPAPPPPQNASMAPP 406 Score = 55.6 bits (128), Expect = 2e-06 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 7/80 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX----PGPPPPXPPXXGGXXXPXAP---XXXAX 727 PPPPP G PPPPPP PPPP PP P P Sbjct: 275 PPPPPSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVL 334 Query: 728 PPPPPXPPXPXAGPPXPAAP 787 PPPPP P PP P P Sbjct: 335 PPPPPPRPGNMGVPPPPPPP 354 Score = 55.6 bits (128), Expect = 2e-06 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 7/80 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXP-PXXGGXXXPXAP----XXXAX 727 PPPPP G PPPPPP G PPPP P P G P P Sbjct: 309 PPPPPPPGN------MSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPPGNMGVP 362 Query: 728 PPPPPXPPXPXAGPPXPAAP 787 PPPPP PP PP P P Sbjct: 363 PPPPPPPPGNMCIPPPPPPP 382 Score = 54.4 bits (125), Expect = 4e-06 Identities = 27/64 (42%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX--PPPPPPXPXXPXXPPP 427 PPPP G T PPPPP P P PPPPPP P PPP Sbjct: 295 PPPPPPGTN----TTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPP 350 Query: 426 PPPP 415 PPPP Sbjct: 351 PPPP 354 Score = 50.8 bits (116), Expect = 4e-05 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX---PPPPPPXPXXPXXPP 430 PPPP G PPPPP P P PPPPPP P P Sbjct: 276 PPPPSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLP 335 Query: 429 PPPPP 415 PPPPP Sbjct: 336 PPPPP 340 Score = 49.2 bits (112), Expect = 1e-04 Identities = 34/97 (35%), Positives = 34/97 (35%), Gaps = 5/97 (5%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P G G PPPP G PPPPP G Sbjct: 339 PPRPGNMGVPPPPPPPPPGNMGVPPP----PPPPPPGN------MCIPPPPPPPPGYTGS 388 Query: 510 XXKXPXPXXXXX----PPPPPPXPXX-PXXPPPPPPP 415 P P PPPPPP P PPPPPPP Sbjct: 389 SLPPPAPPPPQNASMAPPPPPPPPLGGKFLPPPPPPP 425 Score = 48.8 bits (111), Expect = 2e-04 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 5/67 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXX-----KXPXPXXXXXPPPPPPXPXXPXX 436 PPPP G G PPPPP G P P PPPPPP P Sbjct: 323 PPPPPPGNMG--------VLPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPPPPGNMC 374 Query: 435 PPPPPPP 415 PPPPPP Sbjct: 375 IPPPPPP 381 Score = 48.4 bits (110), Expect = 2e-04 Identities = 40/134 (29%), Positives = 41/134 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G + PPPPP P PPPPP P PPPPP Sbjct: 275 PPPPPSPPPPGSVYGGSLVPPPPPP---------PGTNTTMTAPPPPPPPGNMSVPPPPP 325 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP G G PP P PG PPPP Sbjct: 326 PPP---------GNMGVLPPPP---PPRPGNMGVPPPPPPPPPGNMGVPPPPPPPPPGNM 373 Query: 240 PRXPXTPXXPGGPG 199 P P PG G Sbjct: 374 CIPPPPPPPPGYTG 387 Score = 48.4 bits (110), Expect = 2e-04 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 2/71 (2%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX--PPPPPXXXX 446 G + PPPP G G PPP P G P P PPPPP Sbjct: 316 GNMSVPPPPPPPPGN----MGVLPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPPPPG 371 Query: 445 XXXTPPPPPPP 413 PPPPPPP Sbjct: 372 NMCIPPPPPPP 382 Score = 48.4 bits (110), Expect = 2e-04 Identities = 27/66 (40%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX--PPPPPPXP--XXPXXP 433 PPPP G G PPPPP G P P PPPPPP P P Sbjct: 337 PPPPRPGNMG-----VPPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLP 391 Query: 432 PPPPPP 415 PP PPP Sbjct: 392 PPAPPP 397 Score = 48.0 bits (109), Expect = 3e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXA----XPPPPPXPPXPXAGPPXPAAP 787 PPPPPP P PPPP G P P PPPP PP + PP P P Sbjct: 273 PPPPPP---PSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPP 327 Score = 48.0 bits (109), Expect = 3e-04 Identities = 26/74 (35%), Positives = 26/74 (35%), Gaps = 1/74 (1%) Frame = -1 Query: 631 GGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX-PPPPPX 455 G G PPPP G PPPPP P P PPPPP Sbjct: 285 GSVYGGSLVPPPPPPP----GTNTTMTAPPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPP 340 Query: 454 XXXXXXTPPPPPPP 413 PPPPPPP Sbjct: 341 RPGNMGVPPPPPPP 354 Score = 47.6 bits (108), Expect = 4e-04 Identities = 26/74 (35%), Positives = 27/74 (36%), Gaps = 4/74 (5%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX----PPPPPXX 452 G PPPP G G PPPPP G P P PPPPP Sbjct: 329 GNMGVLPPPPPPRPGN---MGVPPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGY 385 Query: 451 XXXXXTPPPPPPPE 410 PP PPPP+ Sbjct: 386 TGSSLPPPAPPPPQ 399 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 4/67 (5%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX----PPPPPXXXXXXXT 434 PPPP G PPPPP G P P PPPPP Sbjct: 362 PPPPPPPPPGNMCI---PPPPPPPPGYTGSSLPPPAPPPPQNASMAPPPPPPPPLGGKFL 418 Query: 433 PPPPPPP 413 PPPPPPP Sbjct: 419 PPPPPPP 425 Score = 45.2 bits (102), Expect = 0.002 Identities = 30/94 (31%), Positives = 30/94 (31%), Gaps = 1/94 (1%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGE 512 PP G GG G A PPPP PPPPP G Sbjct: 281 PPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMS-------VPPPPPPPPGNMGV 333 Query: 511 XXKXPXX-PXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPPP PPPPPP Sbjct: 334 LPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPP 367 Score = 44.8 bits (101), Expect = 0.003 Identities = 31/91 (34%), Positives = 32/91 (35%), Gaps = 14/91 (15%) Frame = +2 Query: 572 PPP--PXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXG----GXXXPXAPXXXA 724 PPP P G PPPP G PPPP PP P P + Sbjct: 260 PPPLLPDDDMGDAPPPPPPPSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMS 319 Query: 725 XPPPPPXPP-----XPXAGPPXPAAPXXXPP 802 PPPPP PP P PP P PP Sbjct: 320 VPPPPPPPPGNMGVLPPPPPPRPGNMGVPPP 350 Score = 44.0 bits (99), Expect = 0.005 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 3/72 (4%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXP---XXXXXPPPPPXXX 449 G PPPP G G PPPPP P P PP PP Sbjct: 343 GNMGVPPPPPPPPPGN---MGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQ 399 Query: 448 XXXXTPPPPPPP 413 PPPPPPP Sbjct: 400 NASMAPPPPPPP 411 Score = 42.3 bits (95), Expect = 0.015 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G + P PPPP PPP PP GG PP P Sbjct: 376 PPPPPPPPGYTG-----SSLPPPAPPPPQNASMAPPPPPPPPLGGKFLPPPPPPPP 426 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXX-------PXPPPPPXXLXXXXNPPPPPPP 414 PPPPP G P P PPPPP PPPPPPP Sbjct: 379 PPPPPGYTGSSLPPPAPPPPQNASMAPPPPPPPPLGGKFLPPPPPPPPP 427 Score = 39.1 bits (87), Expect = 0.14 Identities = 34/138 (24%), Positives = 35/138 (25%), Gaps = 2/138 (1%) Frame = -2 Query: 600 PP--PPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PP P G + P P P P PPP P P Sbjct: 214 PPSVPASVGSSVAAPPDFSPASPSPSPLSVRSPSLPPFAYSDLSMLPPPLLPDDDMGDAP 273 Query: 426 PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 PPPP GG PP P PG PPPP Sbjct: 274 PPPPPPSPPPPGSVYGGSLVPPPP---PPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPGN 330 Query: 246 XPPRXPXTPXXPGGPGXP 193 P P PG G P Sbjct: 331 MGVLPPPPPPRPGNMGVP 348 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 536 PPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPP P P PPPP PPPPPPP Sbjct: 260 PPPLLPDDDMGDAPPPPPPPSPPPPGSVYGGSLVPPPPPPP 300 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 535 PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP + P PPPP PPPPPPP Sbjct: 260 PPPLLPDDDMGDAPPPPPPPSPPPPGSVYGGSLVPPPPPPP 300 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPX---PPPXXPPXXGGXXXXXXPPGXP 725 PPPP G PPPPPP PPP PP G PP P Sbjct: 276 PPPPSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPP--PPPPGNMSVPPPPPPPP 328 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG--PPXPAAPXXXPPXXG 811 PP P P P P P PPP P G PP P P PP Sbjct: 228 PPDFSPASPSPSPLSVRSPSLPPFAYSDLSMLPPPLLPDDDMGDAPPPPPPPSPPPPGSV 287 Query: 812 XGGA 823 GG+ Sbjct: 288 YGGS 291 Score = 34.3 bits (75), Expect = 4.0 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 11/73 (15%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXP-----------XXPPPPPPXXXPXPPPXXPPXX 686 G P PPP GG P PPPPPP PPP PP Sbjct: 270 GDAPPPPPPPSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPPPG 329 Query: 687 GGXXXXXXPPGXP 725 PP P Sbjct: 330 NMGVLPPPPPPRP 342 >UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Diaphanous - Aedes aegypti (Yellowfever mosquito) Length = 1014 Score = 64.1 bits (149), Expect = 4e-09 Identities = 33/70 (47%), Positives = 33/70 (47%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G GG PPPPPP PG P P PP G P P PPP P Sbjct: 443 PPPPPPPGSGGGM------PPPPPPPMMPGVPMP-PPMPGMGGAPRPPPMPGMGPPP--P 493 Query: 749 PXPXAGPPXP 778 P P GPP P Sbjct: 494 PMPGMGPPRP 503 Score = 60.1 bits (139), Expect = 7e-08 Identities = 33/78 (42%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP G G PPPPPP G PPPP PP G P P PP Sbjct: 432 PPPPQMPGMGPP------PPPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPP-- 483 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P GPP P P PP Sbjct: 484 PMPGMGPPPPPMPGMGPP 501 Score = 54.8 bits (126), Expect = 3e-06 Identities = 27/68 (39%), Positives = 27/68 (39%), Gaps = 5/68 (7%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG-----PPXPAAPXX 793 PPPP GPPPP PP G P P P P PP P G PP P Sbjct: 432 PPPPQMPGMGPPPPPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPPPMPGMGPP 491 Query: 794 XPPXXGXG 817 PP G G Sbjct: 492 PPPMPGMG 499 Score = 49.6 bits (113), Expect = 1e-04 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G GGG PPPPP G P P P PPP PPPPP Sbjct: 444 PPPPPPGSGGGMPP------PPPPPMMPGVPMPPPMPGMGGAPRPPP---MPGMGPPPPP 494 Query: 420 PPXXXXXXXXGXGG 379 P G G Sbjct: 495 MPGMGPPRPPGMPG 508 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPPP G P P P PPP P P PPP Sbjct: 432 PPPPQMPGMG-------PPPPPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPPP 484 Query: 420 PP 415 P Sbjct: 485 MP 486 Score = 43.2 bits (97), Expect = 0.009 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 4/75 (5%) Frame = +2 Query: 569 PPPPPXXGGG----GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP GGG P PPP G P PP G P P PP Sbjct: 445 PPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGG--APRPPPMPGMGPPPPPMPGMGPPR 502 Query: 737 PPXPPXPXAGPPXPA 781 PP P P PA Sbjct: 503 PPGMPGMIPMAPMPA 517 Score = 42.7 bits (96), Expect = 0.011 Identities = 25/63 (39%), Positives = 25/63 (39%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G GG PPPPP G P P P PPP PPPP Sbjct: 443 PPPPPPPGSGGGMP-----PPPPPPMMPG-VPMPPPMPGMGGAPRPPPMPGMG---PPPP 493 Query: 421 PPP 413 P P Sbjct: 494 PMP 496 Score = 41.5 bits (93), Expect = 0.026 Identities = 29/83 (34%), Positives = 29/83 (34%), Gaps = 5/83 (6%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPP----PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPX 682 P G GGG P PPP G GG P PPP GPPPP P Sbjct: 446 PPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGA--------PRPPPMPGMGPPPPPMPG 497 Query: 683 XGGXXXPXAPXXXAXPP-PPPXP 748 G P P P P P P Sbjct: 498 MGPPRPPGMPGMIPMAPMPAPLP 520 Score = 39.5 bits (88), Expect = 0.11 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 1/93 (1%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P G GGG PPPP G P PP G Sbjct: 434 PPQMPGMGPPPPPPPPGSGGG-----MPPPPPPPMMPGVPMPPPMPGMGGAPRPPPMPGM 488 Query: 510 XXKXPXPXXXXXPPPPPPXPXX-PXXPPPPPPP 415 P P PP PP P P P P P P Sbjct: 489 GPPPP-PMPGMGPPRPPGMPGMIPMAPMPAPLP 520 Score = 38.3 bits (85), Expect = 0.25 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP G G P PPPP P PPP P GG PG Sbjct: 438 PGMGPPPPPPPPGSG--GGMPPPPPPPMMPGVPMPPPM--PGMGGAPRPPPMPG 487 Score = 37.5 bits (83), Expect = 0.43 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 2/69 (2%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXP--PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXX 446 G PPPP GGG P P PP G P PPPPP Sbjct: 439 GMGPPPPPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPPPMPGMGPPPPPMPGM 498 Query: 445 XXXTPPPPP 419 PP P Sbjct: 499 GPPRPPGMP 507 Score = 36.3 bits (80), Expect = 1.00 Identities = 29/92 (31%), Positives = 29/92 (31%) Frame = -2 Query: 468 PPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPG 289 PPPP PPPPPPP G GGG PP P PG Sbjct: 432 PPPPQMPGMGPPPPPPPP--------GSGGGMPPPPPP--------PMMPGVPMPPPMPG 475 Query: 288 XXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP P PP P PG P Sbjct: 476 MGGAPRPPPMPGMGPPPPPMPGMGPPRPPGMP 507 Score = 35.9 bits (79), Expect = 1.3 Identities = 29/96 (30%), Positives = 29/96 (30%), Gaps = 1/96 (1%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG-GXXXPPXFFFLXXXXX 328 K P PPP P P PPPPPP G GGG PP Sbjct: 423 KSKLPQINIPPPPQMPGMGPP--PPPPPP---------GSGGGMPPPPPPPMMPGVPMPP 471 Query: 327 XXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTP 220 P G PPP PPR P P Sbjct: 472 PMPGMGGAPRPPPMPGMGPPPPPMPGMGPPRPPGMP 507 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPPXXXXXXXXXXGGGGXXXP 360 PPPPP G P P P PP P PPP P G G P Sbjct: 445 PPPPPGSGGGMPPPPPPPMMPGVPMPPPMPGMGGAPRPPPMPGMGPPPPPMPGMGPPRPP 504 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 64.1 bits (149), Expect = 4e-09 Identities = 35/86 (40%), Positives = 35/86 (40%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP PPP PP P P A PPPPP P Sbjct: 449 PPPPPLPA---------TQAPPPPPLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPMP 499 Query: 749 --PXPXAGPPXPAAPXXXPPXXGXGG 820 P P G P P P PP G GG Sbjct: 500 PMPAPSGGAPPPPPP---PPPGGMGG 522 Score = 58.0 bits (134), Expect = 3e-07 Identities = 32/80 (40%), Positives = 32/80 (40%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP PP PP PPPP P P P A PPPPP Sbjct: 417 PPLPPASSRPPPMLPTRSPAPPQAPPLPTSNAPPPPPLPATQAPPPPPLPATSAPPPPPP 476 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P A PP PAA PP Sbjct: 477 APPAPPA-PPLPAAHAPPPP 495 Score = 57.2 bits (132), Expect = 5e-07 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP---XPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PPPP P P PP P PP AP A PPPP Sbjct: 460 PPPPPLPATSA------PPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPP 513 Query: 740 PXPPXPXAG---PPXPAAPXXXPP 802 P PP G PP P P PP Sbjct: 514 PPPPGGMGGVPPPPPPPPPGGMPP 537 Score = 57.2 bits (132), Expect = 5e-07 Identities = 32/85 (37%), Positives = 32/85 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PP P P P P PPP P Sbjct: 472 PPPPPAPPAPPAPPLPAAHAPPPPP---PMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPP 528 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGGA 823 P P G P P AP PP G A Sbjct: 529 PPPPGGMPPPPAP-ALPPVDGSRSA 552 Score = 51.2 bits (117), Expect = 3e-05 Identities = 34/109 (31%), Positives = 34/109 (31%), Gaps = 4/109 (3%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP----PPPXXXXXXXXGX 385 T PPPPP P PPPPPP P P PP P PPP Sbjct: 445 TSNAPPPPPLPATQAPPPPPLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAP 504 Query: 384 GGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP 238 GG PP P P G PPPP PP Sbjct: 505 SGGAPPPPP--------PPPPGGMGGVPPPPPPPPPGGMPPPPAPALPP 545 Score = 50.0 bits (114), Expect = 8e-05 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP G PPP PP PP P P PPPP Sbjct: 406 PPLPPKAPGPAPPLPPASSRPPPMLPTRSPAPPQAPPLPTSNAPPPPPLPATQAPPPPPL 465 Query: 749 PXPXAGPPXPAAPXXXP 799 P A PP P AP P Sbjct: 466 PATSAPPPPPPAPPAPP 482 Score = 49.2 bits (112), Expect = 1e-04 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPPPX 745 P PP G PPP P P PP P P P P A PPPPP Sbjct: 407 PLPPKAPGPAPPLPPASSRPPPMLPTRSPAPPQAPPLPTSNAPPPPPLPATQA-PPPPPL 465 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P PP PA P P Sbjct: 466 PATSAPPPPPPAPPAPPAP 484 Score = 47.2 bits (107), Expect = 5e-04 Identities = 24/78 (30%), Positives = 25/78 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PP PPP P P + PPPP Sbjct: 395 PPPPPRNSAAQPPLPPKAPGPAPPLPPASSRPPPMLPTRSPAPPQAPPLPTSNAPPPPPL 454 Query: 749 PXPXAGPPXPAAPXXXPP 802 P A PP P PP Sbjct: 455 PATQAPPPPPLPATSAPP 472 Score = 46.0 bits (104), Expect = 0.001 Identities = 35/136 (25%), Positives = 36/136 (26%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PP P P P PPPPP P PPPPP Sbjct: 417 PPLPPASSRPPPMLPTRSPAPPQAPPLPTSNAPPPPPLPATQAPPPPPLPATSAPPPPPP 476 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P PP + P P G PPPP P Sbjct: 477 APPAPPAPPLPAAHAPPPPPP----MPPMPAPSGGAPPPPPPPPPGGMGGVPPPP----P 528 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P Sbjct: 529 PPPPGGMPPPPAPALP 544 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP-PXXPPXXG 689 PPPP GG G P PPPPPP P PP P PP G Sbjct: 511 PPPPPPPGGMGGV---PPPPPPPPPGGMPPPPAPALPPVDG 548 Score = 43.2 bits (97), Expect = 0.009 Identities = 24/78 (30%), Positives = 25/78 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G P PPP P PP P PPPPP P Sbjct: 299 PPPPPARRSGKLDTENHQEPAPPPRFAVP-PPIADAGKFAHSDPPRHTPSAPGPPPPPRP 357 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P+ PP Sbjct: 358 PKTPLEDQDPSQRFSVPP 375 Score = 42.3 bits (95), Expect = 0.015 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP PP P P A PP P P P PP P A PP Sbjct: 374 PPPFTGQRSVPPPPPSRSSVPPPPPPRNSAAQPPLP-PKAPGPAPPLPPASSRPPP 428 Score = 42.3 bits (95), Expect = 0.015 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 9/68 (13%) Frame = +2 Query: 626 PPPPPPXXXPGPP--------PPXPPXXGGXXXPXAPXXXAXPPP-PPXPPXPXAGPPXP 778 PPPP P PP PP PP G P P PP P P P PP P Sbjct: 385 PPPPSRSSVPPPPPPRNSAAQPPLPPKAPGPAPPLPPASSRPPPMLPTRSPAPPQAPPLP 444 Query: 779 AAPXXXPP 802 + PP Sbjct: 445 TSNAPPPP 452 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPX---PPPXXPPXXGGXXXXXXPPGXP 725 P P PP A P PPP PP P PPP PP GG PP P Sbjct: 472 PPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPPPP 530 Score = 38.3 bits (85), Expect = 0.25 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 10/68 (14%) Frame = +2 Query: 629 PPPPPXXXPGP---PPP------XPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP-XP 778 PPPPP P P PP G P P + PPPP P A PP P Sbjct: 351 PPPPPRPPKTPLEDQDPSQRFSVPPPFTGQRSVPPPPPSRSSVPPPPPPRNSAAQPPLPP 410 Query: 779 AAPXXXPP 802 AP PP Sbjct: 411 KAPGPAPP 418 Score = 37.9 bits (84), Expect = 0.33 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP GG PPPPP G P PPPPPP P P P Sbjct: 497 PMPPMPAPSGGAPP------PPPPPPPGGMGGVPP-------PPPPPPPGGMPPPPAPAL 543 Query: 420 PP 415 PP Sbjct: 544 PP 545 Score = 37.5 bits (83), Expect = 0.43 Identities = 35/144 (24%), Positives = 35/144 (24%), Gaps = 8/144 (5%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-- 427 PPPP P PP P PP PP P PPP Sbjct: 395 PPPPPRNSAAQPPLPPKAPGPAPPLPPASSRPPPMLPTRSPAPPQAPPLPTSNAPPPPPL 454 Query: 426 -----PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXP-GXXXXGXXP 265 PPPP PP P P G P Sbjct: 455 PATQAPPPPPLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPP 514 Query: 264 PPPXXXXPPRXPXTPXXPGGPGXP 193 PPP P P PGG P Sbjct: 515 PPPGGMGGVPPPPPPPPPGGMPPP 538 Score = 37.5 bits (83), Expect = 0.43 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 3/55 (5%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXX---PXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP P PPPPPP P PPP PP GG P P Sbjct: 493 PPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPPP--PPPPGGMPPPPAPALPP 545 Score = 36.7 bits (81), Expect = 0.75 Identities = 33/137 (24%), Positives = 34/137 (24%), Gaps = 1/137 (0%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPP P P PPPPPP P PP Sbjct: 352 PPPPRPPKTPLEDQDPSQRFSVPPPFTGQRSVPPPPPSRSSVPPPPPPRNSAAQPPLPPK 411 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPP-PXXXX 244 P P P P PPP P Sbjct: 412 APGPAPPLPPASSRPPPMLPTR-SPAPPQAPPLPTSNAPPPPPLPATQAPPPPPLPATSA 470 Query: 243 PPRXPXTPXXPGGPGXP 193 PP P P P P P Sbjct: 471 PPPPPPAPPAPPAPPLP 487 Score = 35.5 bits (78), Expect = 1.7 Identities = 21/55 (38%), Positives = 23/55 (41%), Gaps = 8/55 (14%) Frame = +2 Query: 626 PPPPPPXXXP-GP----PPPXPPXXGGXXXPXA---PXXXAXPPPPPXPPXPXAG 766 PPPPPP P GP PPP PP + P PPP PP +G Sbjct: 254 PPPPPPSAPPNGPAMRAPPPPPPAAAPRSVSESITPSTSRRGPVPPPPPPARRSG 308 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G P PPP PP P P PPPP Sbjct: 298 PPPPPPARRSGKLDTENHQEPAPPPRF-AVPPPIADAGKFAHSDPPRHTPSAPGPPPPPR 356 Query: 420 PP 415 PP Sbjct: 357 PP 358 Score = 34.7 bits (76), Expect = 3.0 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP G P P PPPPP P Sbjct: 489 AHAPPPPPPMPPMPAPSGGAPPPPPPPP--PGGMGGVPPPP-----PPPPP-----GGMP 536 Query: 430 PPPPP 416 PPP P Sbjct: 537 PPPAP 541 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = -2 Query: 474 PPPPPPXPXXPXXP----PPPPPP 415 PPPPPP P P PPPPPP Sbjct: 253 PPPPPPPSAPPNGPAMRAPPPPPP 276 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = -2 Query: 474 PPPPPPXPXXPXXPP----PPPPP 415 PPPPPP P P P PPPPP Sbjct: 252 PPPPPPPPSAPPNGPAMRAPPPPP 275 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/66 (28%), Positives = 20/66 (30%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PP G+ P P PPPPP P Sbjct: 348 APGPPPPPRPPKTPLEDQDPSQRFSVPPPFTGQRSVPPPPPSRSSVPPPPPPRNSAAQPP 407 Query: 430 PPPPPP 413 PP P Sbjct: 408 LPPKAP 413 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP P PP P P PP P PPPP Sbjct: 394 PPPPPPRNSAAQPPLPPKAPGPAPPLPPASSRPPPMLPTRSPAPPQAPPLPTSN-APPPP 452 Query: 421 PPP 413 P P Sbjct: 453 PLP 455 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 64.1 bits (149), Expect = 4e-09 Identities = 27/58 (46%), Positives = 27/58 (46%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP P PP P PP P P A P PP PP P A P PA P PP Sbjct: 763 PPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPP 820 Score = 60.9 bits (141), Expect = 4e-08 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PP PPP P PP P PP P P A P PP PP P A P P AP P Sbjct: 749 PPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPP 806 Score = 60.5 bits (140), Expect = 5e-08 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 P PP PPP P P PPPP P P P PP PP PP Sbjct: 747 PSPPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPP 806 Query: 752 XPXAGPPXPAAPXXXPP 802 P P P P PP Sbjct: 807 APAPAPAPPPPPPPPPP 823 Score = 60.1 bits (139), Expect = 7e-08 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPP P P PPPP PP P P P P P Sbjct: 789 PPPPPAPAPA-----PPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQP 843 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 844 PQPQPEPPVPPPKPQPPP 861 Score = 55.6 bits (128), Expect = 2e-06 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PPP P P PP PP P AP PPPP Sbjct: 763 PPPPPAPAPA---------PPAPPPPPAPAPAPPAPPP------PPAPAPAPPAPPPPPA 807 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P P Sbjct: 808 PAPAPAPPPPPPPPPPRP 825 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/77 (37%), Positives = 29/77 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PPP P P PP PP AP PPPPP P Sbjct: 776 PPPPPAPAPA---------PPAPPPPPAPAPAPPAPP----PPPAPAPAPAPPPPPPPPP 822 Query: 749 PXPXAGPPXPAAPXXXP 799 P P P P P Sbjct: 823 PRPELEPEPEPEPEPEP 839 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PP P P PP P P P P PPPPP Sbjct: 763 PPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPP 822 Query: 420 P 418 P Sbjct: 823 P 823 Score = 46.0 bits (104), Expect = 0.001 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXP---XXPXXPPPPPPP 415 PPPP P P PP PPP P P PPPPPPP Sbjct: 777 PPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPP 821 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/68 (35%), Positives = 24/68 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P P P P P PP PP Sbjct: 802 PPPPPAPAPA-----PAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPK 856 Query: 749 PXPXAGPP 772 P P PP Sbjct: 857 PQPPPPPP 864 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PP PPP P PP PPPP Sbjct: 764 PPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPP 805 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP--- 430 PP P PPPPP P P P PP P P P PP Sbjct: 799 PPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPPKPQ 858 Query: 429 PPPPP 415 PPPPP Sbjct: 859 PPPPP 863 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP---XXPPPPPPP 415 PPPPP P P PP PP P P PPPPPPP Sbjct: 776 PPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPP 820 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PP PP P P PP PPP Sbjct: 763 PPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPP 804 Score = 44.4 bits (100), Expect = 0.004 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPPPPP P P P P P P PP P Sbjct: 799 PPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQP----QPEPPVPP 854 Query: 749 PXPXAGPPXP 778 P P PP P Sbjct: 855 PKPQPPPPPP 864 Score = 43.6 bits (98), Expect = 0.007 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A P PP PPP P P P PPPP P Sbjct: 755 APAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAP 814 Query: 430 PPPPPP 413 PPPPPP Sbjct: 815 PPPPPP 820 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P PP PPP P PP PPPP Sbjct: 752 PPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPP 792 Score = 42.7 bits (96), Expect = 0.011 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PP P P PPPPPP P P P P Sbjct: 776 PPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEP 835 Query: 420 PP 415 P Sbjct: 836 EP 837 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PP PP P P PP PPP Sbjct: 750 PSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPP 791 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP----PPPPPXPXXPXXPPPPPPP 415 PP PP P P P PPPPP P P P PPPPP Sbjct: 749 PPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAP-APAPPAPPPPP 793 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP P PPPP P P PPP PP Sbjct: 780 PAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPP 820 Score = 38.3 bits (85), Expect = 0.25 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PP P PPPPP E P PP P P Sbjct: 796 APAPPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPEPPVPPP 855 Query: 430 ---PPPPPPE 410 PPPPPPE Sbjct: 856 KPQPPPPPPE 865 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A P PP PPP P P P PPPPP P Sbjct: 768 APAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPP--------P 819 Query: 430 PPPPPPE 410 PPPP PE Sbjct: 820 PPPPRPE 826 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXX-PPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPPPP PPPPP P Sbjct: 752 PPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAP 795 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PP P P P P PP P P P P PP Sbjct: 747 PSPPSPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPP 787 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPP---PXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P A P P PPPPP P PP PP PP P Sbjct: 761 PAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPP 820 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 APPPPP P PPPPP PPPPP P Sbjct: 762 APPPPPAPA---------PAPPAPPPPPAPAPAPPAPPPPPAP 795 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PP P P PP P P P PPP PP Sbjct: 782 PAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPP 822 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/75 (25%), Positives = 21/75 (28%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPX 754 PPP G P P P P P PP P + P P P Sbjct: 657 PPPDPGATPPPDLDANPQPQPDPGSPPSSDPESPPSSEPGYQPPSKPGPQPPSEPQPPSK 716 Query: 755 PXAGPPXPAAPXXXP 799 P PP + P Sbjct: 717 PDLNPPSDPSSQQDP 731 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPPP P P PP P PP P Sbjct: 767 PAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPP 822 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP A P PPPPP P P PP PP P Sbjct: 760 PPAPPPPPAP-------APAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAP 808 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P PP G P P P PP P + P PP Sbjct: 643 PPPYPFAHKQPTTAPPPDPGATPPPDLDANPQPQPDPGSPPSSDPESPPSSEPGYQPP 700 >UniRef50_UPI0000DA1F29 Cluster: PREDICTED: hypothetical protein; n=3; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 170 Score = 63.7 bits (148), Expect = 6e-09 Identities = 30/64 (46%), Positives = 30/64 (46%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P GG G G GG G GG GGGGG G G GG GGGG G GG Sbjct: 32 PESGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Query: 636 GGGG 625 GGGG Sbjct: 92 GGGG 95 Score = 62.9 bits (146), Expect = 1e-08 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P GG G G GG G GG GGGGG G G GG GGGG G G Sbjct: 32 PESGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Query: 639 GGGGG 625 GGGGG Sbjct: 92 GGGGG 96 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 Score = 47.6 bits (108), Expect = 4e-04 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG G G GGGGGG G G GGGGG GG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Query: 596 GG 601 GG Sbjct: 97 GG 98 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 Score = 44.4 bits (100), Expect = 0.004 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GGGGG G G GGGGGG G G GGGGG GG Sbjct: 35 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Query: 596 GG 601 GG Sbjct: 95 GG 96 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 712 GXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G W GG GGG G GGGGGG G GGGG G Sbjct: 26 GQFWHIPESGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 GGGGGGG GGGGG G G GGGGG R Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 100 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 GGGGGGG GGGGG G G GGGGG R Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRR 101 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 406 SXXGGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 S GGGGGGG GGGGG G G GGGGG Sbjct: 34 SGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 38.7 bits (86), Expect = 0.19 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG GGGGG G G GGGGG G Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Query: 594 GGG 602 GGG Sbjct: 97 GGG 99 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 35 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 93 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 94 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 95 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 96 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 97 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 98 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 44 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 99 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 63.7 bits (148), Expect = 6e-09 Identities = 33/79 (41%), Positives = 33/79 (41%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPP PPPPPP P PPPP PP P A PPPPP Sbjct: 974 PPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPP-PPVVRPPPPPPPAARPAPPPPPPVV 1032 Query: 743 XPPXPXAGPPXPAAPXXXP 799 PP P PP PAA P Sbjct: 1033 RPPPPPPPPPPPAARPAPP 1051 Score = 62.5 bits (145), Expect = 1e-08 Identities = 31/72 (43%), Positives = 31/72 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PPPP PPPP PP P P PPPPP P Sbjct: 983 PPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPP-P 1041 Query: 749 PXPXAGPPXPAA 784 P P A P PAA Sbjct: 1042 PPPAARPAPPAA 1053 Score = 61.3 bits (142), Expect = 3e-08 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP------XPPXXGGXXXPXAPXXXAXP 730 PPPPP P PPPP P PPPP PP P P P Sbjct: 933 PPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRP 992 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P A PP P PP Sbjct: 993 PPPPPPAARPAPPPPPPVVRPPPP 1016 Score = 59.7 bits (138), Expect = 9e-08 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPP P PPPP P P P A P PPP PP Sbjct: 954 PPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPV----VRPPPPPPPAARPAPPPPPP 1009 Query: 752 XPXAGPPXPAAPXXXPP 802 PP P A PP Sbjct: 1010 VVRPPPPPPPAARPAPP 1026 Score = 58.0 bits (134), Expect = 3e-07 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 6/82 (7%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP---- 739 PPPP P PPPP PPPP PP P P PPPP Sbjct: 963 PPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAAR 1022 Query: 740 --PXPPXPXAGPPXPAAPXXXP 799 P PP P PP P P P Sbjct: 1023 PAPPPPPPVVRPPPPPPPPPPP 1044 Score = 57.6 bits (133), Expect = 4e-07 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPPPPP P PPPP P P PPPPP P Sbjct: 964 PPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPP----PAARPAPPPPPPVVRPPPPPPP 1019 Query: 749 PXPXAGPPXPAAPXXXPP 802 A PP P PP Sbjct: 1020 AARPAPPPPPPVVRPPPP 1037 Score = 54.0 bits (124), Expect = 5e-06 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 7/80 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXX--CXXXXXPPPPPPXXXPGPPPP-----XPPXXGGXXXPXAPXXXAX 727 PPPPP PPPPP P PPPP PP P P A Sbjct: 963 PPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAAR 1022 Query: 728 PPPPPXPPXPXAGPPXPAAP 787 P PPP PP PP P P Sbjct: 1023 PAPPPPPPVVRPPPPPPPPP 1042 Score = 53.2 bits (122), Expect = 8e-06 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P PPPPP Sbjct: 984 PPPPPVVRPPPPPPPAARPAPPPPPPVV-RPPPPPPPAARPAPPPPPPVVRPPPPPPPPP 1042 Query: 420 PP 415 PP Sbjct: 1043 PP 1044 Score = 49.6 bits (113), Expect = 1e-04 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 5/66 (7%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP--XPXXPXXPP-- 430 PPP PPPPP P P PPPPPP P P PP Sbjct: 973 PPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVV 1032 Query: 429 -PPPPP 415 PPPPP Sbjct: 1033 RPPPPP 1038 Score = 49.2 bits (112), Expect = 1e-04 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 + PPPP PPPPP P P PPPPPP P P P Sbjct: 991 RPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAP 1050 Query: 426 P 424 P Sbjct: 1051 P 1051 Score = 48.4 bits (110), Expect = 2e-04 Identities = 34/121 (28%), Positives = 34/121 (28%), Gaps = 5/121 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPP-----PXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PPPPP P P PPPPP P P P PPPPP Sbjct: 941 PPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPPPAA 1000 Query: 375 GXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGX 196 PP P P PPPP PP P P P Sbjct: 1001 RPAPPP----------PPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAP 1050 Query: 195 P 193 P Sbjct: 1051 P 1051 Score = 48.0 bits (109), Expect = 3e-04 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP---PXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP P P P PP P P P P PPPP Sbjct: 886 PPPPPAAAREAPPPPAAERPKPAPAAERQTPPAVTRPAAPPPAARPAPPPPPVVRPPPPP 945 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P A PP P PP Sbjct: 946 PPPAAHPAPPPPVVRPAPPPP 966 Score = 48.0 bits (109), Expect = 3e-04 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 5/67 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-- 427 PPPP PPPPP P P PPPPPP P PPP Sbjct: 943 PPPPPPAAHPAPPPPVVRPAPPPPPVVR--QAPPPPPAARPAPPPPPPVVRPPPPPPPAA 1000 Query: 426 ---PPPP 415 PPPP Sbjct: 1001 RPAPPPP 1007 Score = 47.6 bits (108), Expect = 4e-04 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PPPPP P P PPPPP P Sbjct: 982 APPPPPPVVRPPPPPPPAARPAPPPPPPVVR---PPPPPPPAARPAPPPPPPVVRPPPPP 1038 Query: 430 PPPPPP 413 PPPPPP Sbjct: 1039 PPPPPP 1044 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP P PP Sbjct: 994 PPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAPPAA 1053 Query: 420 PP 415 P Sbjct: 1054 KP 1055 Score = 45.6 bits (103), Expect = 0.002 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP PPPP P P P P AP A P PPP Sbjct: 884 PPPPPPPAAA-------REAPPPPAAERPKPAPAAERQTPPAVTRPAAPPPAARPAPPPP 936 Query: 746 P-PXPXAGPPXPAAPXXXPP 802 P P PP PAA PP Sbjct: 937 PVVRPPPPPPPPAAHPAPPP 956 Score = 42.3 bits (95), Expect = 0.015 Identities = 31/102 (30%), Positives = 31/102 (30%), Gaps = 11/102 (10%) Frame = +2 Query: 527 GGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXX--PGPP------PPXPPX 682 G G P P GG P P P PG P P PP Sbjct: 806 GSNGQPLPAVPGAQAPGTPPAAGGKSAVPGSPPPAPAAPNAATRPGSPLPGANGQPLPPV 865 Query: 683 XGGXXXPXAPXXXAXPPPPPXPPXPXA---GPPXPAAPXXXP 799 P AP P PP PP P A PP PAA P Sbjct: 866 PASPPSPAAPAKSPSPTAPPPPPPPAAAREAPPPPAAERPKP 907 Score = 42.3 bits (95), Expect = 0.015 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPPP Sbjct: 964 PPPPVVRQAPPPPPAARPAPPPPPPVVR---PPPPPPPAARPAPPPPP----PVVRPPPP 1016 Query: 421 PPP 413 PPP Sbjct: 1017 PPP 1019 Score = 40.7 bits (91), Expect = 0.046 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX-PGPPPPXP--PXXGGXXXPXAPXXXAXPPPP 739 P PP PPPPPP PPPP P P P P Sbjct: 866 PASPPSPAAPAKSPSPTAPPPPPPPAAAREAPPPPAAERPKPAPAAERQTPPAVTRPAAP 925 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 926 PPAARPAPPPPPVVRPPPPPP 946 Score = 40.7 bits (91), Expect = 0.046 Identities = 32/120 (26%), Positives = 32/120 (26%), Gaps = 6/120 (5%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP------PPPPXXXXXXXXGXGGGG 373 PPP P P PPPPPP P PPP PPPP Sbjct: 925 PPP---AARPAPPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARP 981 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP P P PPP PP P P P P Sbjct: 982 APPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPP 1041 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PP Sbjct: 993 PPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPPPPPAARPAPPA 1052 Query: 421 PPP 413 P Sbjct: 1053 AKP 1055 Score = 39.5 bits (88), Expect = 0.11 Identities = 31/121 (25%), Positives = 32/121 (26%) Frame = -2 Query: 783 AAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXK 604 AA GGPA G+ G P G G P GG Sbjct: 785 AATPGGPAVSPNAKPASQALP---GSNGQPLPAVPGAQAPGTP--PAAGGKSAVPGSPPP 839 Query: 603 XPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 P P G P PP P PPPPP P PPP Sbjct: 840 APAAPNAATRPGSPLPGANGQPLPPVPASPPSPAAPAKSPSPTAPPPPPPPAAAREAPPP 899 Query: 423 P 421 P Sbjct: 900 P 900 Score = 38.7 bits (86), Expect = 0.19 Identities = 49/219 (22%), Positives = 51/219 (23%), Gaps = 9/219 (4%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 AP P G G PA G + GA G PP P Sbjct: 820 APGTPPAAGGKSAVPGSPPPAPAAPNAATRPG-SPLPGANGQPLPPV--------PASPP 870 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXX----KXPXPXXXXX 475 PPPP P P P + P Sbjct: 871 SPAAPAKSPSPTAPPPPPPPAAAREAPPPPAAERPKPAPAAERQTPPAVTRPAAPPPAAR 930 Query: 474 PPPPPPXPXXPXXPPPPP-----PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXX 310 P PPPP P PPPPP PP PP Sbjct: 931 PAPPPPPVVRPPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVV 990 Query: 309 XXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPPP PP P P P P Sbjct: 991 RPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPPPP 1029 Score = 37.1 bits (82), Expect = 0.57 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 P P G G PP P P P PP P P PPPP Sbjct: 850 PGSPLPGANGQPLPPVPASPPSPAAPAKSPSPTAPPP------PPPPAAAREAPPPPAAE 903 Query: 752 XPXAGPPXPAAPXXXPP 802 P P PAA PP Sbjct: 904 RPK---PAPAAERQTPP 917 Score = 37.1 bits (82), Expect = 0.57 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP---XXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 988 PVVRPPPPPPPAARPAPPPPPPVVRPPPPPPPAARPAPPP--PPPVVRPPPPPPPPPPP 1044 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP P PP P Sbjct: 941 PPPPPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPP 996 Score = 35.9 bits (79), Expect = 1.3 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 10/56 (17%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKX----PXPXXXXXPPPPPPXPXXPXXP------PPPPPP 415 T PPPPP + P PPPPPP P P PPPPPP Sbjct: 375 TYDVPPPPPEEVIYIERPVLMFDDPDFDFAPPPPPPVFFLPRRPVYFDDLPPPPPP 430 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP P PPPPP P PPP P P G P Sbjct: 1014 PPPPPPAARPAPPPPPPVVRPPPPPP--PPPPPAARPAPPAAKPCTLPNGQP 1063 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P PPP A P PPPPP P PPP Sbjct: 961 PAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPPPP 997 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP---PPPP 413 P PPP P P PPPPP PPP PPPP Sbjct: 952 PAPPPPVV--RPAPPPPPVVRQAPPPPPAARPAPPPPPPVVRPPPP 995 >UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Extensin - Volvox carteri Length = 464 Score = 63.7 bits (148), Expect = 6e-09 Identities = 32/81 (39%), Positives = 33/81 (40%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPP- 739 P PPP P PPPP P PPPP PP P P + PPPP Sbjct: 329 PSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPR 388 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP P PP PA PP Sbjct: 389 PPPPSPPPSPPPPATAAANPP 409 Score = 61.7 bits (143), Expect = 2e-08 Identities = 30/79 (37%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P P PP PP P +P + PPP P P Sbjct: 290 PPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPP-PPRSSPSPPPPSPPPPSPPPPRPSP 348 Query: 749 -PXPXAGPPXPAAPXXXPP 802 P P P P P PP Sbjct: 349 SPPPPRSSPSPPPPVVSPP 367 Score = 61.7 bits (143), Expect = 2e-08 Identities = 31/81 (38%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPPP 742 P PPP P PPPP P PPPP P P P A PPPPP Sbjct: 320 PSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPP 379 Query: 743 -XPPXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 380 ASSPPPPPRPPPPSPPPSPPP 400 Score = 60.1 bits (139), Expect = 7e-08 Identities = 32/86 (37%), Positives = 32/86 (37%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP-----XPPXXGGXXXPXAPXXXAXPP 733 PPPP PPPPPP P PPPP PP P P PP Sbjct: 292 PPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPP 351 Query: 734 PP---PXPPXPXAGPPXPAAPXXXPP 802 PP P PP P PP P PP Sbjct: 352 PPRSSPSPPPPVVSPPPPPPRASPPP 377 Score = 57.2 bits (132), Expect = 5e-07 Identities = 34/85 (40%), Positives = 36/85 (42%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP-XXXPGPPPP-----XPPXXGGXXXPXAPXXXAXP 730 PPPPP PPPPPP P PPPP PP P P + P Sbjct: 272 PPPPPRVPPSPPP--PVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSP 329 Query: 731 -PPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PP P PP P +P PP Sbjct: 330 SPPPPSPPPPSPPPPRP-SPSPPPP 353 Score = 53.6 bits (123), Expect = 6e-06 Identities = 29/75 (38%), Positives = 29/75 (38%), Gaps = 4/75 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPPPX 745 PP PP P PPPP P PPPP P P P P PPP Sbjct: 338 PPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPS 397 Query: 746 PPXP---XAGPPXPA 781 PP P A PP PA Sbjct: 398 PPPPATAAANPPSPA 412 Score = 53.6 bits (123), Expect = 6e-06 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PPPP PP P P A PP P P Sbjct: 366 PPPPPPRAS-----------PPPPPASSP-PPPPRPPPPSPPPSPPPPATAAANPPSPAP 413 Query: 749 PXPXA-GPPXPAAPXXXPP 802 A GPP P PP Sbjct: 414 SRSRAGGPPLGTRPPPPPP 432 Score = 48.0 bits (109), Expect = 3e-04 Identities = 32/116 (27%), Positives = 33/116 (28%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PP PP P P PPPP P P PPPPP P P Sbjct: 279 PPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPP--PPPPPRPSPSPPPPRSSPSPPPPSP 336 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P PPPP PP +P P P P Sbjct: 337 PPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPP 392 Score = 46.8 bits (106), Expect = 7e-04 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P PP PPP P P P P Sbjct: 291 PPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSP 350 Query: 420 PP 415 PP Sbjct: 351 PP 352 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PP P P P PPPP Sbjct: 310 PPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPP 369 Query: 420 PP 415 PP Sbjct: 370 PP 371 Score = 44.4 bits (100), Expect = 0.004 Identities = 20/61 (32%), Positives = 22/61 (36%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP + PPP + P PPPPP P P PP PPP Sbjct: 341 PPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPP 400 Query: 417 P 415 P Sbjct: 401 P 401 Score = 44.0 bits (99), Expect = 0.005 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 6/62 (9%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP------PXPPXPXAGPPXPAAPXX 793 PP P P PPP PP P P PPPP P PP P + PP P P Sbjct: 265 PPLPKTSPPPPPRVPPS------PPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRP 318 Query: 794 XP 799 P Sbjct: 319 SP 320 Score = 43.6 bits (98), Expect = 0.007 Identities = 31/130 (23%), Positives = 32/130 (24%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP PPPP P P PPPP P P PPPP Sbjct: 280 PSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPP 339 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P PP PPPP P Sbjct: 340 SPPPPRPSPSPPPPRSSPSPP--------PPVVSPPPPPPRASPPPPPASSPPPPPRPPP 391 Query: 240 PRXPXTPXXP 211 P P +P P Sbjct: 392 PSPPPSPPPP 401 Score = 43.2 bits (97), Expect = 0.009 Identities = 26/69 (37%), Positives = 27/69 (39%), Gaps = 11/69 (15%) Frame = +2 Query: 629 PPPPPXXXPGPPPP-----XPPXXGGXXXP-----XAPXXXAXPP-PPPXPPXPXAGPPX 775 PPPPP PPPP PP P +P A PP P PP P PP Sbjct: 222 PPPPPRVSTSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPS 281 Query: 776 PAAPXXXPP 802 P P PP Sbjct: 282 PPPPVASPP 290 Score = 42.7 bits (96), Expect = 0.011 Identities = 24/81 (29%), Positives = 25/81 (30%), Gaps = 4/81 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPP PP P P PP P P +P PPP Sbjct: 232 PPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPP 291 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP PP P PP Sbjct: 292 PPPPRVSPSPPPPQPVSSPPP 312 Score = 42.3 bits (95), Expect = 0.015 Identities = 29/88 (32%), Positives = 29/88 (32%), Gaps = 18/88 (20%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP-PPPPXXXPGPPPPX-----PPXXG-GXXXPXAPXXXAX 727 PPPPP PP PPPP P PPPP PP P Sbjct: 367 PPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTR 426 Query: 728 PPPPPX-----------PPXPXAGPPXP 778 PPPPP PP PP P Sbjct: 427 PPPPPPEDDAPPPDYYFPPPQDMSPPPP 454 Score = 40.3 bits (90), Expect = 0.061 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPP PPP PP P P P PPPPP Sbjct: 375 PPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGP--PLGTRPPPPPP 432 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P P PP Sbjct: 433 EDDAPPPDYYFPPPQDMSPP 452 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PPPPP P PP PP P Sbjct: 287 ASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRP 346 Query: 430 PPPPPP 413 P PPP Sbjct: 347 SPSPPP 352 Score = 37.9 bits (84), Expect = 0.33 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 10/72 (13%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPP----PPPXXX---GXXXKXPXPXXXXXPPPPPPXPXXP 442 PPPP + PP PPP P PPPPP P P Sbjct: 223 PPPPRVSTSPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSP 282 Query: 441 XXP---PPPPPP 415 P PPPPPP Sbjct: 283 PPPVASPPPPPP 294 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPP P PP PP PP P Sbjct: 346 PSPSPPPPRSSPSPPPPVVSP--PPPPPRASPPPPPASSPPPPPRPPPPSPPPSPP 399 Score = 37.1 bits (82), Expect = 0.57 Identities = 21/80 (26%), Positives = 22/80 (27%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP + PPP P P PP PPP P P PP Sbjct: 350 PPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPP 409 Query: 417 PXXXXXXXXGXGGGGXXXPP 358 G G PP Sbjct: 410 SPAPSRSRAGGPPLGTRPPP 429 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -1 Query: 541 PPP--PPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP PP P P P PPP PPPPP P Sbjct: 274 PPPRVPPSPPPPVASPPPPPPPRVSPSPPPPQPVSSPPPPPPPRP 318 Score = 35.9 bits (79), Expect = 1.3 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPP-PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP 425 PPPP PP PPP P P P PPP PP Sbjct: 313 PPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPV-----VSPP 367 Query: 424 PPPP 413 PPPP Sbjct: 368 PPPP 371 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P P PPPP P PPP PP P Sbjct: 316 PRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPP 371 Score = 35.9 bits (79), Expect = 1.3 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKX-PXXPXXXXXPPPPPXXXXXXXTP-- 431 PPPP PPP P + P P PPPPP P Sbjct: 322 PPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPAS 381 Query: 430 PPPPPP 413 PPPPP Sbjct: 382 SPPPPP 387 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 6/62 (9%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP------XXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP P PPPPPP P PPP P PP Sbjct: 337 PPPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASSPPPPPRPPPPSPPP 396 Query: 720 XP 725 P Sbjct: 397 SP 398 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 4/68 (5%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP--- 431 PPPP PP PP P P P P P Sbjct: 366 PPPPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGT 425 Query: 430 -PPPPPPE 410 PPPPPPE Sbjct: 426 RPPPPPPE 433 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP PPP PP P PPP PP Sbjct: 362 PVVSPPPPPPRASPPPPPASSPPPPPRPP--PPSPPPSPPP 400 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP P PPP P P PP P + P PP Sbjct: 301 PPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSSPSPP 360 Query: 418 PP 413 PP Sbjct: 361 PP 362 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 +PPPPP P P PPPPP +P PPPP Sbjct: 271 SPPPPPRVP---PSPPPPVASPPPPPPPRV-----SPSPPPP 304 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP--PPPPPXXXPXPPPXXPP 680 P P PP P P PPPP P PPP PP Sbjct: 295 PRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSSPSPPPPSPP 337 >UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 324 Score = 63.7 bits (148), Expect = 6e-09 Identities = 32/77 (41%), Positives = 32/77 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP G PPPP P PGPP P PP P P A PPPP P Sbjct: 16 PPPPGPPGRPPPPYDPFAPPPPPGPPGPPGPPGPPPP---SWHHPPPPDPFAPPPPPGPP 72 Query: 749 PXPXAGPPXPAAPXXXP 799 P GP P AP P Sbjct: 73 GPPPPGPYSPPAPPGPP 89 Score = 61.7 bits (143), Expect = 2e-08 Identities = 31/82 (37%), Positives = 31/82 (37%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPP P PPPP PP G P P PPP P P Sbjct: 7 PPPPYDPYAPPPPGPPGRPPPPYDPFAP-PPPPGPPGPPGPPGPPPPSWHHPPPPDPFAP 65 Query: 752 XPXAGPPXPAAPXXXPPXXGXG 817 P GPP P P P G Sbjct: 66 PPPPGPPGPPPPGPYSPPAPPG 87 Score = 51.2 bits (117), Expect = 3e-05 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 4/67 (5%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXG----GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPP PPPP PP P P PP PP PP P P P P P Sbjct: 7 PPPPYDPYAPPPPGPPGRPPPPYDPFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPP 66 Query: 800 PXXGXGG 820 P G G Sbjct: 67 PPPGPPG 73 Score = 50.0 bits (114), Expect = 8e-05 Identities = 27/64 (42%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX-PXPXXXXXPPPPPP-XPXXPXXPPP 427 PPPP G G PPPPP G P P PPPP P P P PP Sbjct: 16 PPPP--GPPGRPPPPYDPFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPPPPPGPPG 73 Query: 426 PPPP 415 PPPP Sbjct: 74 PPPP 77 Score = 43.2 bits (97), Expect = 0.009 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXX---PPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G G P PPPP P P PP P G PPG P Sbjct: 31 PFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPPPPPGPPGPPPPGPYSPPAPPGPP 89 Score = 37.9 bits (84), Expect = 0.33 Identities = 27/90 (30%), Positives = 28/90 (31%), Gaps = 5/90 (5%) Frame = -2 Query: 474 PPPP-----PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXX 310 PPPP PP P P PPPP P G G PP + Sbjct: 7 PPPPYDPYAPPPPGPPGRPPPPYDPFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPP 66 Query: 309 XXXPXPGXXXXGXXPPPPXXXXPPRXPXTP 220 PG PPPP PP P P Sbjct: 67 PPPGPPG-------PPPPGPYSPPAPPGPP 89 Score = 36.3 bits (80), Expect = 1.00 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP--P--PPPXPXXPXXP 433 PPPP G G PP PP P P PP P PPP P P P Sbjct: 35 PPPPGPPGPPG---------PPGPPPPSWHHPPPPDPFAPPPPPGPPGPPPPGPYSPPAP 85 Query: 432 PPPP 421 P PP Sbjct: 86 PGPP 89 Score = 33.5 bits (73), Expect = 7.0 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 462 PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXX 283 PP P P PPPP PP G PP F PG Sbjct: 7 PPPPYDPYAPPPPGPP-------------GRPPPPYDPFAPPPPPGP---------PGPP 44 Query: 282 XXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PPP PP P P P GP P Sbjct: 45 GPPGPPPPSWHHPPPPDPFAPPPPPGPPGP 74 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 4/66 (6%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP----PXXXXXXXTP 431 PPP G PPP P P PPPP P P Sbjct: 7 PPPPYDPYAPPPPGPPGRPPPPYDPFAPPPPPGPPGPPGPPGPPPPSWHHPPPPDPFAPP 66 Query: 430 PPPPPP 413 PPP PP Sbjct: 67 PPPGPP 72 >UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23; n=5; Bilateria|Rep: Putative uncharacterized protein grl-23 - Caenorhabditis elegans Length = 385 Score = 63.7 bits (148), Expect = 6e-09 Identities = 39/100 (39%), Positives = 39/100 (39%), Gaps = 4/100 (4%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G GG GGGGG G PP G G GG G GGGGGG Sbjct: 23 GGGGGGGGGCGGGCGGGGGCGGGGGCG---GGCAPPPPPPACGGGCGGGGGGCGGGGGGC 79 Query: 621 XXXXXKXPPPPXXGGG----GGXXXXXTXXXPPPPPXXXG 514 GGG GG PPPPP G Sbjct: 80 GGGGGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACG 119 Score = 62.1 bits (144), Expect = 2e-08 Identities = 35/80 (43%), Positives = 35/80 (43%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG PPPP P GGGG GG G G GGG GG G G GGGG Sbjct: 49 GGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGG-----GGCGGGG 103 Query: 539 GXXXVXXXXXPPPPPXXGGG 598 G PPPPP GGG Sbjct: 104 GCGG--GCAPPPPPPACGGG 121 Score = 60.9 bits (141), Expect = 4e-08 Identities = 39/84 (46%), Positives = 39/84 (46%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P GG G G GG G GG GGGGG G G GG GGGG G Sbjct: 56 PPPPACGGGCGG--GGGGCGGGGGGCGGGGG----CGGGG-------GGCGGGGGGC--- 99 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGG PPPP GGG G Sbjct: 100 GGGGGCGGGCAPPPPPPACGGGCG 123 Score = 60.5 bits (140), Expect = 5e-08 Identities = 29/64 (45%), Positives = 29/64 (45%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP GG G G GG G GG G GGG G G GG GGGG G G Sbjct: 114 PPPACGGGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGG 173 Query: 639 GGGG 628 GGGG Sbjct: 174 GGGG 177 Score = 58.8 bits (136), Expect = 2e-07 Identities = 35/86 (40%), Positives = 35/86 (40%), Gaps = 8/86 (9%) Frame = -2 Query: 801 GGXXXGAAGXGG--------PAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXX 646 GG G G GG PA G G GGGGG G G GG G GG G Sbjct: 39 GGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGG 98 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGG PPP GG GG Sbjct: 99 CGGGGGCGGGCAPPPPPPACGGGCGG 124 Score = 58.8 bits (136), Expect = 2e-07 Identities = 34/83 (40%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXX-----PPXXGGXGGGGPGXXXGG 637 GG G G GG G GG GGGGG G G PP GG GGG G GG Sbjct: 73 GGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGG 132 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGG GGGGG Sbjct: 133 CGGGGGGGCGGGGGGGCGGGGGG 155 Score = 58.8 bits (136), Expect = 2e-07 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GG GG G G GG GGGG G GGGGGG Sbjct: 127 GGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGG 185 Score = 58.4 bits (135), Expect = 2e-07 Identities = 40/116 (34%), Positives = 40/116 (34%), Gaps = 2/116 (1%) Frame = +2 Query: 200 PGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPP 379 P PP G G GG GGGG G GG PP Sbjct: 56 PPPPACGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGG---CGGGCAPP 112 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXG--GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 PP P GGGG GG G G G GGGGG G G GGGGG Sbjct: 113 PPPPACGGGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGG 168 Score = 56.0 bits (129), Expect = 1e-06 Identities = 31/66 (46%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXX 643 PP P GG G G GG G GG GGGG G G GG GG GG G Sbjct: 113 PPPPACGGGCGG--GGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGC 170 Query: 642 GGGGGG 625 GGGGGG Sbjct: 171 GGGGGG 176 Score = 50.4 bits (115), Expect = 6e-05 Identities = 25/57 (43%), Positives = 25/57 (43%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 GG G G GG G GG G GGG G G GG GGGG G GG G Sbjct: 135 GGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGGCGGGCG 191 Score = 47.2 bits (107), Expect = 5e-04 Identities = 32/84 (38%), Positives = 32/84 (38%), Gaps = 6/84 (7%) Frame = -2 Query: 801 GGXXXGAAGXGG------PAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 GG G G GG P GG GGGG G G GG GGGG G G Sbjct: 96 GGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGG----GGGGCGGGGGGGCGG 151 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGG 568 GGGG GGGGG Sbjct: 152 GGGGCGGGGGGCGGGGGGCGGGGG 175 Score = 46.8 bits (106), Expect = 7e-04 Identities = 35/96 (36%), Positives = 35/96 (36%), Gaps = 4/96 (4%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGG-GGGXXXXXGXGXFXXFPXXXG--GGGGXXXVXXXXXPPPPPX 586 GGGGGGG G G GGG GGG G P G GGGG Sbjct: 25 GGGGGGGCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGGGG 84 Query: 587 XGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGG 691 GGGG C G PPP PP GG Sbjct: 85 CGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGG 120 Score = 46.8 bits (106), Expect = 7e-04 Identities = 28/75 (37%), Positives = 28/75 (37%), Gaps = 5/75 (6%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGG-----GXXGXXAXXPPPPXXXGGGGXXX 560 G GG PP GG GGG G GGGGG G G GGGG Sbjct: 47 GCGGGCAPPPPPPACGGGCGGGGGGCGGGGGGCGGGGGCGGGGGGCGGGGGGCGGGGGCG 106 Query: 559 GXXXXXPPPPPXXXG 515 G PPPP G Sbjct: 107 GGCAPPPPPPACGGG 121 Score = 42.7 bits (96), Expect = 0.011 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGG----GGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGG GG G A PPPP GG G G Sbjct: 83 GGCGGGGGGCGGGGGGCGGGGGCGGGCAPPPPPPACGGGCGGGGG 127 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXG-----GGGGGXXXXXXKXPPPPXXGGGGG 568 P GG GGGG G G GGGGG PPPP GGG G Sbjct: 21 PSGGGGGGGGGCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCG 66 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG PP GG GGG G GG GGG G GGGG G Sbjct: 104 GCGGGCAPPPPPPACGGGCGGGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGG 159 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G GGGGGG G G GGG G Sbjct: 150 GGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGGCGGGCG 191 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGGG G GGGG G Sbjct: 131 GGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCG 171 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 406 SXXGGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 S GGGGGGG GG GG G G P GGG G Sbjct: 22 SGGGGGGGGGCGGGCGGGGGCGGGGGCGGGCAPPPPPPACGGGCG 66 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 GGGGG G GGGGG G G GGGGG Sbjct: 136 GGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGG 177 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGG G GGGG G Sbjct: 124 GGGGGCGGGCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCG 179 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGG G G GGGG G Sbjct: 132 GCGGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGGCG 187 >UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000013088 - Anopheles gambiae str. PEST Length = 157 Score = 63.7 bits (148), Expect = 6e-09 Identities = 34/85 (40%), Positives = 35/85 (41%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP-----GPPPPXP--PXXGGXXXPXAPXXXAX 727 PPPPP G PPPPP P GPPPP P P P A Sbjct: 45 PPPPPRPVYGPPPVHHAPPPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYGPPPPVHHAP 104 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP PP P GPP + PP Sbjct: 105 PPPPPPPPRPVYGPPPQQSYGPPPP 129 Score = 60.9 bits (141), Expect = 4e-08 Identities = 30/70 (42%), Positives = 30/70 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP G PPPPPP GPPP P P A PPPPP P Sbjct: 88 PPPPQSYGPPPPVHHAPPPPPPPPPRPVYGPPPQQS------YGPPPPVHHAPPPPPPPP 141 Query: 749 PXPXAGPPXP 778 P P GPP P Sbjct: 142 PRPVYGPPPP 151 Score = 50.8 bits (116), Expect = 4e-05 Identities = 28/82 (34%), Positives = 28/82 (34%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPPPP P P P P P P PPPP Sbjct: 45 PPPPPRPVYGPPPVHHAPPPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYG-PPPPVHHA 103 Query: 752 XPXAGPPXPAAPXXXPPXXGXG 817 P PP P PP G Sbjct: 104 PPPPPPPPPRPVYGPPPQQSYG 125 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/64 (39%), Positives = 26/64 (40%), Gaps = 4/64 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXX-GXXXKX---PXPXXXXXPPPPPPXPXXPXXP 433 PPPP G PPPPP G + P P PPPPPP P P Sbjct: 88 PPPPQSYGPPPPVHHAPPPPPPPPPRPVYGPPPQQSYGPPPPVHHAPPPPPPPPPRPVYG 147 Query: 432 PPPP 421 PPPP Sbjct: 148 PPPP 151 Score = 45.6 bits (103), Expect = 0.002 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 7/69 (10%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX---PXPXXXXXPPPP----PPXPXXP 442 PPPP G PPPPP G P P PPPP PP P Sbjct: 45 PPPPPRPVYGPPPVHHAP--PPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYGPPPPVHH 102 Query: 441 XXPPPPPPP 415 PPPPPPP Sbjct: 103 APPPPPPPP 111 Score = 43.2 bits (97), Expect = 0.009 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPPP---XPPXPXAGPPXPAAPXXXPP 802 GPPPP P G AP PPPPP PP P GPP P + PP Sbjct: 44 GPPPPPRPVYGPPPVHHAP----PPPPPPAYGPPPAPVYGPPPPQSYGPPPP 91 Score = 41.9 bits (94), Expect = 0.020 Identities = 35/117 (29%), Positives = 35/117 (29%), Gaps = 1/117 (0%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP P P PPP G P Sbjct: 45 PPPPPRPV----YGPPPVHHAPPPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYG----P 96 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXP-GGPGXP 193 P P G PPPP PP P P P GP P Sbjct: 97 PPPVHHAPPPPPPPPPRPVYGPPPQQSYG--PPPPVHHAPPPPPPPPPRPVYGPPPP 151 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP G PPPP PPPP PP P P A P Sbjct: 107 PPPPPPRPVYGPPPQQSYGPPPP---VHHAPPPPPPPPPRPVYGPPPPVHHAPP 157 Score = 34.3 bits (75), Expect = 4.0 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 9/72 (12%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKX---PXXPXXXXXPPP------PPXXX 449 PPPP G PPPPP G P P PPP PP Sbjct: 46 PPPPRPVYG---PPPVHHAPPPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYGPPPPVHH 102 Query: 448 XXXXTPPPPPPP 413 PPPPP P Sbjct: 103 APPPPPPPPPRP 114 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP G PPP P PPPPP P P P PP Sbjct: 62 PPPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYGPPPPVHHAPPPPPPP--PPRPVYGPP 119 Query: 417 P 415 P Sbjct: 120 P 120 >UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: Formin A - Trypanosoma cruzi strain CL Brener Length = 1178 Score = 63.7 bits (148), Expect = 6e-09 Identities = 32/79 (40%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP G G PPPP G PPPP PP G +P PPPPP Sbjct: 619 PPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPP--PPPPPP 676 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP A P P PP Sbjct: 677 PPGAGAKSGLPPPPPPPPP 695 Score = 63.3 bits (147), Expect = 8e-09 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPP G PPP PP P A PPPPP P Sbjct: 603 PPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPP------PGAGAKSGLPPPPPPP 656 Query: 749 PXPXA----GPPXPAAPXXXPPXXG 811 P A PP P P PP G Sbjct: 657 PGAGAKSGLSPPPPPPPPPPPPGAG 681 Score = 61.7 bits (143), Expect = 2e-08 Identities = 34/91 (37%), Positives = 34/91 (37%), Gaps = 8/91 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP----- 733 PPPPP G G PPPP G PPP PP G P PP Sbjct: 523 PPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAK 582 Query: 734 ---PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP PP P AG P PP G G Sbjct: 583 SGLPPPPPPPPGAG-AKSGLPPPPPPPPGAG 612 Score = 61.7 bits (143), Expect = 2e-08 Identities = 34/91 (37%), Positives = 34/91 (37%), Gaps = 8/91 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP----- 733 PPPPP G G PPPP G PPP PP G P PP Sbjct: 571 PPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAK 630 Query: 734 ---PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP PP P AG P PP G G Sbjct: 631 SGLPPPPPPPPGAG-AKSGLPPPPPPPPGAG 660 Score = 61.7 bits (143), Expect = 2e-08 Identities = 34/82 (41%), Positives = 34/82 (41%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP----PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP G G PPPPP P PPPP PP G P PPP Sbjct: 618 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPP-PPGAGAKSGLSPP-----PPP 671 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 PP PP P AG P PP Sbjct: 672 PPPPPPPGAGAKSGLPPPPPPP 693 Score = 60.9 bits (141), Expect = 4e-08 Identities = 35/92 (38%), Positives = 35/92 (38%), Gaps = 9/92 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP-PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP---- 733 PPPPP G G PPPPP G PPP PP G P PP Sbjct: 554 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGA 613 Query: 734 ----PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP PP P AG P PP G G Sbjct: 614 KSGLPPPPPPPPGAG-AKSGLPPPPPPPPGAG 644 Score = 60.1 bits (139), Expect = 7e-08 Identities = 42/143 (29%), Positives = 42/143 (29%), Gaps = 8/143 (5%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGG--------GGGXAXXXGAXGXXXPPXXGGXGG 664 PP P G G P G G G G A PP G G Sbjct: 557 PPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSG 616 Query: 663 GGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXX 484 P G G PPPP G G PPPPP P P Sbjct: 617 LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPP-----PPPPPGAGAKSGLSPPPPP 671 Query: 483 XXXPPPPPPXPXXPXXPPPPPPP 415 PPPP PPPPPPP Sbjct: 672 PPPPPPPGAGAKSGLPPPPPPPP 694 Score = 59.7 bits (138), Expect = 9e-08 Identities = 47/162 (29%), Positives = 47/162 (29%), Gaps = 8/162 (4%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGG--------GGGXAXXXGAXGXXXPPXXGGXGG 664 PP P G G P G G G G A PP G G Sbjct: 541 PPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSG 600 Query: 663 GGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXX 484 P G G PPPP G G PPPPP G P P Sbjct: 601 LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPP------PPPPPPGAGAKSGLPPP-- 652 Query: 483 XXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPP PPPPPP G G PP Sbjct: 653 ---PPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPPPP 691 Score = 59.3 bits (137), Expect = 1e-07 Identities = 47/162 (29%), Positives = 47/162 (29%), Gaps = 8/162 (4%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGG--------GGGXAXXXGAXGXXXPPXXGGXGG 664 PP P G G P G G G G A PP G G Sbjct: 525 PPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSG 584 Query: 663 GGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXX 484 P G G PPPP G G PPPPP G K P Sbjct: 585 LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGL--------PPPPPPPPGAGAKSGLPP- 635 Query: 483 XXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPPP PPPPPP G PP Sbjct: 636 ---PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPP 674 Score = 56.8 bits (131), Expect = 7e-07 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP-----PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G G PPPPP P PPPP PP P A PP Sbjct: 634 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPPPPP-----PGAGAKSGLPP 688 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P P P Sbjct: 689 PPPPPPPKAKSRPAQTGPTRSIP 711 Score = 54.4 bits (125), Expect = 4e-06 Identities = 34/93 (36%), Positives = 34/93 (36%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGE 512 PP G G G G G PPPP G G G PPPPP G Sbjct: 528 PPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGL----PPPPPPPPGA 579 Query: 511 XXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 K P PPPPP PPPPPPP Sbjct: 580 GAKSGLPPP----PPPPPGAGAKSGLPPPPPPP 608 Score = 54.4 bits (125), Expect = 4e-06 Identities = 34/93 (36%), Positives = 34/93 (36%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGE 512 PP G G G G G PPPP G G G PPPPP G Sbjct: 544 PPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGL----PPPPPPPPGA 595 Query: 511 XXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 K P PPPPP PPPPPPP Sbjct: 596 GAKSGLPPP----PPPPPGAGAKSGLPPPPPPP 624 Score = 54.0 bits (124), Expect = 5e-06 Identities = 34/97 (35%), Positives = 35/97 (36%), Gaps = 3/97 (3%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGE 512 PP G G G G G PPPP G G G PPPPP G Sbjct: 608 PPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGL----PPPPPPPPGA 659 Query: 511 XXKXPXXPXXXXXPPPPPXXXXXXX---TPPPPPPPE 410 K P PPPPP PPPPPPP+ Sbjct: 660 GAKSGLSPPPPPPPPPPPPGAGAKSGLPPPPPPPPPK 696 Score = 52.4 bits (120), Expect = 1e-05 Identities = 27/63 (42%), Positives = 27/63 (42%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G G G PPPPP G K P PPPPP PPPP Sbjct: 522 PPPPPPPPGAGAKSGL----PPPPPPPPGAGAKSGLPPP----PPPPPGAGAKSGLPPPP 573 Query: 421 PPP 413 PPP Sbjct: 574 PPP 576 Score = 52.0 bits (119), Expect = 2e-05 Identities = 37/128 (28%), Positives = 37/128 (28%), Gaps = 7/128 (5%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGG-------GGGXAXXXGAXGXXXPPXXGGXGGG 661 PP P G G P G G G G G PP G G Sbjct: 573 PPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSG 632 Query: 660 GPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXX 481 P G G PPPP G PPPPP G P P Sbjct: 633 LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPP--- 689 Query: 480 XXPPPPPP 457 PPPPPP Sbjct: 690 --PPPPPP 695 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP G P P PPPPP PPPPPPP Sbjct: 652 PPPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPPPPPP 693 Score = 48.4 bits (110), Expect = 2e-04 Identities = 29/69 (42%), Positives = 29/69 (42%), Gaps = 5/69 (7%) Frame = +2 Query: 626 PPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPX 790 PPPPPP G PPPP PP P A PPPPP PP A P P Sbjct: 522 PPPPPPPPGAGAKSGLPPPPPPP-------PGAGAKSGLPPPPPPPPGAGAKSGLPPPP- 573 Query: 791 XXPPXXGXG 817 PP G G Sbjct: 574 --PPPPGAG 580 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP G P P PPPPP PPPPP Sbjct: 521 PPPPPPPPPGAGAKSGLPPPPPPPP-GAGAKSGLPPP-----PPPPPGAGAKSGLPPPPP 574 Query: 420 PP 415 PP Sbjct: 575 PP 576 Score = 46.8 bits (106), Expect = 7e-04 Identities = 31/92 (33%), Positives = 31/92 (33%), Gaps = 9/92 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP-XXXPGPPPPXPPXXGGXXXPXAPXXXAXPP---- 733 P P G PPPPP G PPP PP G P PP Sbjct: 506 PAAPSLRGIAASSGLPPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGA 565 Query: 734 ----PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP PP P AG P PP G G Sbjct: 566 KSGLPPPPPPPPGAG-AKSGLPPPPPPPPGAG 596 Score = 46.8 bits (106), Expect = 7e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP G K P P PPPPP PPPPPPP Sbjct: 522 PPPPPPPPGAGAKSGLP---PPPPPPPGAGAKSGLPPPPPPP 560 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/75 (34%), Positives = 27/75 (36%), Gaps = 2/75 (2%) Frame = +3 Query: 507 LXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPP 680 L P G G P PPPP G G + P PPPPP PPP PP Sbjct: 537 LPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGLPPPPPPPPGAGAKSGLPPPPPPP 592 Query: 681 XXGGXXXXXXPPGXP 725 G PP P Sbjct: 593 PGAGAKSGLPPPPPP 607 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/75 (34%), Positives = 27/75 (36%), Gaps = 2/75 (2%) Frame = +3 Query: 507 LXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPP 680 L P G G P PPPP G G + P PPPPP PPP PP Sbjct: 553 LPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGLPPPPPPPPGAGAKSGLPPPPPPP 608 Query: 681 XXGGXXXXXXPPGXP 725 G PP P Sbjct: 609 PGAGAKSGLPPPPPP 623 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/75 (34%), Positives = 27/75 (36%), Gaps = 2/75 (2%) Frame = +3 Query: 507 LXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPP 680 L P G G P PPPP G G + P PPPPP PPP PP Sbjct: 569 LPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGLPPPPPPPPGAGAKSGLPPPPPPP 624 Query: 681 XXGGXXXXXXPPGXP 725 G PP P Sbjct: 625 PGAGAKSGLPPPPPP 639 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/75 (34%), Positives = 27/75 (36%), Gaps = 2/75 (2%) Frame = +3 Query: 507 LXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPP 680 L P G G P PPPP G G + P PPPPP PPP PP Sbjct: 585 LPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGLPPPPPPPPGAGAKSGLPPPPPPP 640 Query: 681 XXGGXXXXXXPPGXP 725 G PP P Sbjct: 641 PGAGAKSGLPPPPPP 655 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/75 (34%), Positives = 27/75 (36%), Gaps = 2/75 (2%) Frame = +3 Query: 507 LXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPP 680 L P G G P PPPP G G + P PPPPP PPP PP Sbjct: 601 LPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGLPPPPPPPPGAGAKSGLPPPPPPP 656 Query: 681 XXGGXXXXXXPPGXP 725 G PP P Sbjct: 657 PGAGAKSGLSPPPPP 671 Score = 45.2 bits (102), Expect = 0.002 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 6/79 (7%) Frame = +3 Query: 507 LXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPP------PXXXPXPPP 668 L P G G P PPPP G G + P PPPPP P PPP Sbjct: 617 LPPPPPPPPGAGAKSGLPPPPPPPP----GAGAKSGLPPPPPPPPGAGAKSGLSPPPPPP 672 Query: 669 XXPPXXGGXXXXXXPPGXP 725 PP G PP P Sbjct: 673 PPPPPPGAGAKSGLPPPPP 691 Score = 44.8 bits (101), Expect = 0.003 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 5/63 (7%) Frame = +3 Query: 507 LXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPP-----XXXPXPPPX 671 L P G G P PPPP G P PPPPPP P PPP Sbjct: 633 LPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPPPPP 692 Query: 672 XPP 680 PP Sbjct: 693 PPP 695 Score = 44.4 bits (100), Expect = 0.004 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = +3 Query: 534 GGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPPXXGGXXXXX 707 G G P PPPP G G + P PPPPP PPP PP G Sbjct: 530 GAGAKSGLPPPPPPPP----GAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGL 585 Query: 708 XPPGXP 725 PP P Sbjct: 586 PPPPPP 591 Score = 44.0 bits (99), Expect = 0.005 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 4/64 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX----PXXP 433 PPPP G G PPPPP G K P PPPPPP P P Sbjct: 524 PPPPPPGAGA------KSGLPPPPPPPPGAGAKSGLPP----PPPPPPGAGAKSGLPPPP 573 Query: 432 PPPP 421 PPPP Sbjct: 574 PPPP 577 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P G G P PPPP G G + P PPPPPP P P Sbjct: 653 PPPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPPPPPPPPPKAKSRPAQTGP 706 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G G + P PPPPP PPP PP G PP P Sbjct: 522 PPPPPPPP----GAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPP 575 Score = 39.9 bits (89), Expect = 0.081 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPPP G K P PPPPP PPPPPPP Sbjct: 519 GLPPPPPPPPP---GAGAKSGLPP----PPPPPPGAGAKSGLPPPPPPP 560 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P G G P PPPP G G P PPPPPP P P Sbjct: 654 PPPPGAGAKSGLSPPPPPPPPPPPPGAGAKSGLPP--PPPPPPPKAKSRPAQTGP 706 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 536 PPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 P P G P P PPPPP PPPPPPP Sbjct: 506 PAAPSLRGIAASSGLPP--PPPPPPPGAGAKSGLPPPPPPP 544 >UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 994 Score = 63.7 bits (148), Expect = 6e-09 Identities = 47/148 (31%), Positives = 47/148 (31%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G G G G P G G GGG G PP G G G P G GGG Sbjct: 511 GKVPGGGQGWGQPPPGAGQ---GGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGG-- 565 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP 442 PPPP G GGG PP G P P PPPP Sbjct: 566 -------PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPP--GAGQ 616 Query: 441 XXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP G G G PP Sbjct: 617 EGPPPPGAGQGGGPPPPGAGQGWGLPPP 644 Score = 58.0 bits (134), Expect = 3e-07 Identities = 46/138 (33%), Positives = 46/138 (33%), Gaps = 7/138 (5%) Frame = +2 Query: 425 GGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGX 604 GGG G G G GG G G GGG PPP GGG Sbjct: 515 GGGQGWGQPPPGAGQGGGPPPPGAGQ--------GGGPPPPGAGQGWGQPPPGAGQGGG- 565 Query: 605 XCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP------PPXPPXPXAG 766 PPPP GPPPP G P A PPP PP P G Sbjct: 566 -------PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPPGAGQEG 618 Query: 767 PPXP-AAPXXXPPXXGXG 817 PP P A PP G G Sbjct: 619 PPPPGAGQGGGPPPPGAG 636 Score = 57.2 bits (132), Expect = 5e-07 Identities = 43/129 (33%), Positives = 43/129 (33%), Gaps = 7/129 (5%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGG G G G GGG G G P G G PPPP G G Sbjct: 515 GGGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQG 574 Query: 599 GXXCXXXXXPPPPPPXXXPGPPPP-------XPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 G PPPP G PPP PP G P P PPPP Sbjct: 575 G-------GPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGGPPPPGAGQEGPPPPG-AGQ 626 Query: 758 XAGPPXPAA 784 GPP P A Sbjct: 627 GGGPPPPGA 635 Score = 56.8 bits (131), Expect = 7e-07 Identities = 40/126 (31%), Positives = 40/126 (31%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 G PPPP G G G G G GGG G G P G G Sbjct: 528 GQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWG 587 Query: 539 GXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXX 718 PPP G GG PPPP GPPPP GG P A Sbjct: 588 QPPPGAGQGWGQPPPGAGQGG---------PPPPGAGQEGPPPPGAGQGGGPPPPGAGQG 638 Query: 719 XAXPPP 736 PPP Sbjct: 639 WGLPPP 644 Score = 54.4 bits (125), Expect = 4e-06 Identities = 43/134 (32%), Positives = 43/134 (32%), Gaps = 2/134 (1%) Frame = -2 Query: 819 PPXPXXGGXXX--GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXX 646 PP GG GA GGP G G G G G PP G GGG P Sbjct: 524 PPGAGQGGGPPPPGAGQGGGPPPP--GAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPG 581 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP 466 G G G PPP G G G PPPP P P P Sbjct: 582 AGQGWG---------QPPPGAGQGWGQPPPGAGQGGPPPP--GAGQEGPPPPGAGQGGGP 630 Query: 465 PPPXPXXPXXPPPP 424 PPP PPP Sbjct: 631 PPPGAGQGWGLPPP 644 Score = 41.9 bits (94), Expect = 0.020 Identities = 33/94 (35%), Positives = 33/94 (35%), Gaps = 12/94 (12%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP----- 739 PPP G GG PPPP G PPP G P PPPP Sbjct: 523 PPPGAGQGGG--------PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQG 574 Query: 740 PXPPXPXA----GPPXPAAP---XXXPPXXGXGG 820 PP P A G P P A PP G GG Sbjct: 575 GGPPPPGAGQGWGQPPPGAGQGWGQPPPGAGQGG 608 >UniRef50_A1Z8H7 Cluster: CG13214-PA, isoform A; n=5; Eukaryota|Rep: CG13214-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 610 Score = 63.7 bits (148), Expect = 6e-09 Identities = 34/78 (43%), Positives = 36/78 (46%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G+ G GG A G GG G GGG + GA G P GG GG G G GG GGG Sbjct: 264 GGAGGGSGGGGGGAGGGGGYGSGGG-SGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGA 322 Query: 621 XXXXXKXPPPPXXGGGGG 568 P GGG G Sbjct: 323 GRGGSPGGPGSPGGGGFG 340 Score = 61.7 bits (143), Expect = 2e-08 Identities = 34/78 (43%), Positives = 35/78 (44%), Gaps = 1/78 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXXGGGGGG 625 G G G GG G GG GG GG A G+ G P GG GG GG G GGGGGG Sbjct: 297 GPGAPGGGGFGGQGGG-GGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGG 355 Query: 624 XXXXXXKXPPPPXXGGGG 571 P GGGG Sbjct: 356 GRGGGGAPGAPGSPGGGG 373 Score = 61.7 bits (143), Expect = 2e-08 Identities = 42/136 (30%), Positives = 42/136 (30%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG PG G G GG GGGG PG G Sbjct: 364 GAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGG 423 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 P P GG GG G G G GGG GG G F GGGG Sbjct: 424 GAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGA 483 Query: 554 XXXXXPPPPPXXGGGG 601 P P GGGG Sbjct: 484 GRGGAPGAPGSPGGGG 499 Score = 61.3 bits (142), Expect = 3e-08 Identities = 36/81 (44%), Positives = 36/81 (44%), Gaps = 3/81 (3%) Frame = -2 Query: 801 GGXXXGAAGX--GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXXGGGG 631 GG GA G GG G GG GG GG GA G P GG GG GG G GGGG Sbjct: 359 GGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGG 418 Query: 630 GGXXXXXXKXPPPPXXGGGGG 568 G P P GGGG Sbjct: 419 GRGGGGAPGAPGAPGSPGGGG 439 Score = 58.4 bits (135), Expect = 2e-07 Identities = 35/86 (40%), Positives = 35/86 (40%), Gaps = 1/86 (1%) Frame = -2 Query: 822 APPXPXX-GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXX 646 AP P GG G G GG G GG GGG G G G GG GG G G Sbjct: 294 APGGPGAPGGGGFGGQGGGG---GYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYG 350 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGG P P GG GG Sbjct: 351 GGGGGGRGGGGAPGAPGSPGGGGFGG 376 Score = 58.4 bits (135), Expect = 2e-07 Identities = 33/74 (44%), Positives = 33/74 (44%), Gaps = 1/74 (1%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG-GGGXXXXX 610 G G GG G GG GGGGG GA G GG GG G G GGG GGG Sbjct: 370 GGGGFGGQGGG-GGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGA 428 Query: 609 XKXPPPPXXGGGGG 568 P P GG GG Sbjct: 429 PGAPGSPGGGGFGG 442 Score = 58.0 bits (134), Expect = 3e-07 Identities = 35/83 (42%), Positives = 35/83 (42%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P GG G G GG G GG GGGG GA G P GG GG G G GG Sbjct: 396 PGSPGGGGYGGQGGAGGGYGGGGGRGGGGAP----GAPGAPGSPGGGGFGGQGGGGGFGG 451 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGG P P GG GG Sbjct: 452 GGG--RGGAPGAPGSPGGGGFGG 472 Score = 57.6 bits (133), Expect = 4e-07 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G G G GG G GG GGGG G G GG GGG GGG G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGL 93 Query: 621 XXXXXKXPPPPXXGGGGG 568 P P GGGGG Sbjct: 94 GGFANGRPIAPGGGGGGG 111 Score = 57.2 bits (132), Expect = 5e-07 Identities = 35/80 (43%), Positives = 35/80 (43%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGX-GGPAXGX-GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG GA G G P G GG GGGGG G G P G GGGG G GGGG Sbjct: 422 GGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAP--GSPGGGGFGGQGGGGGY 479 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G P P GGGG Sbjct: 480 GGGAGRGGAPGAPGSPGGGG 499 Score = 56.8 bits (131), Expect = 7e-07 Identities = 34/82 (41%), Positives = 37/82 (45%), Gaps = 4/82 (4%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGX-GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG-G 628 GG G G GG + G GG GGGGG G+ P G GGGG G GGGG G Sbjct: 257 GGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYG 316 Query: 627 GXXXXXXKXPPP--PXXGGGGG 568 G + P P GGGG Sbjct: 317 GAGGGAGRGGSPGGPGSPGGGG 338 Score = 56.8 bits (131), Expect = 7e-07 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGX-GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G GG G GG GGG G G G P G GGGG G GGGG G Sbjct: 325 GGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFG 384 Query: 624 XXXXXXKXPPPPXXGGGGG 568 P P GGGG Sbjct: 385 GGGGRGGAPGAPGSPGGGG 403 Score = 56.8 bits (131), Expect = 7e-07 Identities = 35/83 (42%), Positives = 35/83 (42%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P GG G G GG G GG G GGG GA G P GG GG G G GG Sbjct: 331 PGSPGGGGFGGQGGAGGGYGGGGGGGRGGG-----GAPGAPGSPGGGGFGGQGGGGGFGG 385 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGG P P GG GG Sbjct: 386 GGG--RGGAPGAPGSPGGGGYGG 406 Score = 54.0 bits (124), Expect = 5e-06 Identities = 43/144 (29%), Positives = 43/144 (29%), Gaps = 8/144 (5%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG PG G G GG G GG PG GG Sbjct: 296 GGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGG 355 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGG--------GXXXXXGXGXFXXFPXXXG 529 GGGG GG G G GGGGG G G G G Sbjct: 356 GRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYG 415 Query: 530 GGGGXXXVXXXXXPPPPPXXGGGG 601 GGGG P P GGGG Sbjct: 416 GGGGRGGGGAPGAPGAPGSPGGGG 439 Score = 54.0 bits (124), Expect = 5e-06 Identities = 34/80 (42%), Positives = 34/80 (42%), Gaps = 3/80 (3%) Frame = -2 Query: 798 GXXXGAAGX--GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXXGGGGG 628 G GA G GG G GG GG GG A GA G P GG GG GG G GGG Sbjct: 456 GGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGR 515 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G P P G GG Sbjct: 516 GGAGGAPGGPGSPGGPGYGG 535 Score = 53.6 bits (123), Expect = 6e-06 Identities = 31/74 (41%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGP-GXXXGGGGGGXXXXX 610 G G GG G GG GGG G GA G GG GGGG G G GG G Sbjct: 466 GGGGFGGQGGG-GGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGG 524 Query: 609 XKXPPPPXXGGGGG 568 P P GGG G Sbjct: 525 PGSPGGPGYGGGAG 538 Score = 53.2 bits (122), Expect = 8e-06 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G G G GG G GGG G G GG GG G G G GGG Sbjct: 234 GGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGG---SGGGGGGAGGGGGYGSGGGSG 290 Query: 621 XXXXXKXPPPPXXGGGGG 568 P P GG GG Sbjct: 291 RGGAPGGPGAPGGGGFGG 308 Score = 53.2 bits (122), Expect = 8e-06 Identities = 36/87 (41%), Positives = 36/87 (41%), Gaps = 9/87 (10%) Frame = -2 Query: 801 GGXXXGAA--GXGGPAXGX-GGXGGGGGXAXXXGAXGXXXPPXX-GGXGGGGPGXXXG-- 640 GG G A G G P G GG GGGGG G G P G GGGG G G Sbjct: 287 GGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAG 346 Query: 639 ---GGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGG P P GGGG Sbjct: 347 GGYGGGGGGGRGGGGAPGAPGSPGGGG 373 Score = 52.4 bits (120), Expect = 1e-05 Identities = 36/86 (41%), Positives = 36/86 (41%), Gaps = 1/86 (1%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXX 646 AP P G G G GG G GG GGGGG GA G P GG GG GG G Sbjct: 425 APGAPGAPGSP-GGGGFGGQGGG-GGFGGGGGRGGAPGAPGS---PGGGGFGGQGGGGGY 479 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGG 568 GG G G P GG GG Sbjct: 480 GGGAGRGGAPGAPGSPGGGGFGGQGG 505 Score = 51.6 bits (118), Expect = 2e-05 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG--- 631 GG GA G G G G G GGG GA P G GGGG G GGGG Sbjct: 452 GGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGA 511 Query: 630 GGXXXXXXKXPPPPXXGGGGG 568 GG P P GG G Sbjct: 512 GGGRGGAGGAPGGPGSPGGPG 532 Score = 51.2 bits (117), Expect = 3e-05 Identities = 30/74 (40%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG-GGGXXXXX 610 G GGP G GGGGG + G G GG GGGG G GGG G G Sbjct: 233 GGGYSGGPGGQGAGGGGGGG-SGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGR 291 Query: 609 XKXPPPPXXGGGGG 568 P P GGGG Sbjct: 292 GGAPGGPGAPGGGG 305 Score = 51.2 bits (117), Expect = 3e-05 Identities = 28/71 (39%), Positives = 28/71 (39%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G GG G GG G GGG GA G P G GGG G GG G Sbjct: 496 GGGGFGGQGGG-GGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPG 554 Query: 606 KXPPPPXXGGG 574 PP GGG Sbjct: 555 NQYVPPAAGGG 565 Score = 50.8 bits (116), Expect = 4e-05 Identities = 58/206 (28%), Positives = 58/206 (28%), Gaps = 15/206 (7%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG G G G GG GG G PG GG Sbjct: 397 GSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRG 456 Query: 374 PPPPXPXXXXXXFXGGGGG-GGXXGXXGXGG--------GGGGXXXXXGXGXFXXFPXXX 526 P P GG GG GG G G GG GGGG G G F Sbjct: 457 GAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGF----GAG 512 Query: 527 GGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG-XXXP 703 GG GG P P GGG P P PG P GG P Sbjct: 513 GGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGP--GLPGNQYVPPAAGGGAPGSP 570 Query: 704 XAPXXXAXPPP-----PPXPPXPXAG 766 P P PP P P G Sbjct: 571 GRPGSGGVPGTGSQYIPPAPGAPGGG 596 Score = 50.0 bits (114), Expect = 8e-05 Identities = 33/91 (36%), Positives = 33/91 (36%), Gaps = 1/91 (1%) Frame = +2 Query: 410 FXGGGG-GGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPX 586 F GGGG GGG G GGGGGG G G GGG P P Sbjct: 47 FGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGG 106 Query: 587 XGGGGXXCXXXXXPPPPPPXXXPGPPPPXPP 679 GGGG P P P PP PP Sbjct: 107 GGGGG------GAPAPRPSPSGGAPPTSGPP 131 Score = 50.0 bits (114), Expect = 8e-05 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXG--GXGGGGGXAXXXGAXGXXX-PPXXGGXGGGGPGXXXGGGG 631 GG G GGP G G G GG GG G G PP GG G PG G G Sbjct: 519 GGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPGNQYVPPAAGGGAPGSPGRP--GSG 576 Query: 630 GGXXXXXXKXPPPPXXGGGG 571 G PP P GGG Sbjct: 577 GVPGTGSQYIPPAPGAPGGG 596 Score = 49.6 bits (113), Expect = 1e-04 Identities = 42/139 (30%), Positives = 42/139 (30%), Gaps = 3/139 (2%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G G PG G G GG GGG G G Sbjct: 235 GYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGA 294 Query: 374 P-PPPXPXXXXXXFXGGGGG-GGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXG-GGGGX 544 P P P GGGGG GG G G GG GG G G G GGGG Sbjct: 295 PGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGG 354 Query: 545 XXVXXXXXPPPPPXXGGGG 601 P P GGGG Sbjct: 355 GGRGGGGAPGAPGSPGGGG 373 Score = 49.6 bits (113), Expect = 1e-04 Identities = 33/83 (39%), Positives = 35/83 (42%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P GG G G GG G GG GG GG G+ G P GG G GGPG GG Sbjct: 492 PGSPGGGGFGGQGGGGGFGAG-GGRGGAGGAPGGPGSPGG---PGYGG-GAGGPG-GAGG 545 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GG + PP GG G Sbjct: 546 RPGGPGLPGNQYVPPAAGGGAPG 568 Score = 49.2 bits (112), Expect = 1e-04 Identities = 39/135 (28%), Positives = 39/135 (28%), Gaps = 2/135 (1%) Frame = +2 Query: 203 GPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPP 382 G G G G GG GG G PG G P Sbjct: 269 GSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSP 328 Query: 383 PXPXXXXXXFXGG--GGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVX 556 P GG G GGG G G G GGGG G F GGGG Sbjct: 329 GGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGG 388 Query: 557 XXXXPPPPPXXGGGG 601 P P GGGG Sbjct: 389 RGGAPGAPGSPGGGG 403 Score = 47.6 bits (108), Expect = 4e-04 Identities = 34/84 (40%), Positives = 35/84 (41%), Gaps = 6/84 (7%) Frame = -2 Query: 801 GGXXXGAAGX-GGPAXGX-GGXGG-GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG-GG 634 GG GA G G P G GG GG GGG G G P G G G G G GG Sbjct: 386 GGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGG 445 Query: 633 GGGXXXXXXK--XPPPPXXGGGGG 568 GGG + P P GGGG Sbjct: 446 GGGFGGGGGRGGAPGAPGSPGGGG 469 Score = 47.2 bits (107), Expect = 5e-04 Identities = 28/61 (45%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG--GGPGXXXGGGGG 628 GG G AG GG A G G GGGG G G GG GG GGPG G G G Sbjct: 476 GGGYGGGAGRGG-APGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYG 534 Query: 627 G 625 G Sbjct: 535 G 535 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 8/65 (12%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXG--------AXGXXXPPXXGGXGGGGPGXXX 643 G G G GGPA G GG GGGG G A G P GG GGG P Sbjct: 59 GGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGGAPAPRP 118 Query: 642 GGGGG 628 GG Sbjct: 119 SPSGG 123 Score = 44.0 bits (99), Expect = 0.005 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G G GGGG G G GG GG G G G GG Sbjct: 241 GGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGA----GGGGGYGSGGGSGRGGAPG 296 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 297 GPGAPGGGGFGGQGGGGG 314 Score = 41.1 bits (92), Expect = 0.035 Identities = 37/139 (26%), Positives = 37/139 (26%), Gaps = 3/139 (2%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG PG G G GG GG G PG G Sbjct: 460 GAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAG 519 Query: 374 PPPPXPXXXXXXFXGGGGGG--GXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXX 547 P P GGG GG G G G G G G G GG Sbjct: 520 GAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPGNQYVPPAAGGGAPGSPGRPGSGGVP 579 Query: 548 XVXXXXXPPPP-PXXGGGG 601 PP P GG G Sbjct: 580 GTGSQYIPPAPGAPGGGRG 598 Score = 39.5 bits (88), Expect = 0.11 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 2/90 (2%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGG--GGXXXXXPXXXPPPPXX 587 GGG GGG GGG G G G P G G GG P Sbjct: 44 GGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIA 103 Query: 588 XGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 GGGG P P P P P P Sbjct: 104 PGGGGGGGGAPAPRPSPSGGAPPTSGPPIP 133 Score = 39.1 bits (87), Expect = 0.14 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXX 590 +GGGGGGG GGGG G G G GGG P P Sbjct: 245 AGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGG 304 Query: 591 GGGG 602 G GG Sbjct: 305 GFGG 308 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 G GG GG GG G GG GGG G P GGGG G Sbjct: 57 GAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGGAPAP 116 Query: 544 XPPP 533 P P Sbjct: 117 RPSP 120 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG G G G GGGGGG G F G GGG Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGG 273 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G GGGGGG G G GGGG Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGG 274 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GG GGG G P G GG G Sbjct: 44 GGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAG 84 Score = 33.9 bits (74), Expect = 5.3 Identities = 30/108 (27%), Positives = 30/108 (27%), Gaps = 7/108 (6%) Frame = -1 Query: 715 GGXXWXXXPPXXGGXXG--GGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXX 542 GG P GG G GG G GGG GG G P GGG Sbjct: 486 GGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 545 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT-----PPPPPPP 413 P P G P P P T PP P P Sbjct: 546 RPGGPGLPGNQYVPPAAGGGAPGSPGRPGSGGVPGTGSQYIPPAPGAP 593 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG G G G G GGG G P P G GG G Sbjct: 272 GGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGG 312 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G PG GG GG G G GGGG G P G GG G Sbjct: 34 GSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGG 89 Score = 33.1 bits (72), Expect = 9.3 Identities = 28/90 (31%), Positives = 29/90 (32%), Gaps = 3/90 (3%) Frame = -1 Query: 679 GGXXGGGXGXXXG-GGGGGXXGXXAXXP--PPPXXXGGGGXXXGXXXXXPPPPPXXXGEX 509 GG GGG G G GGGGG G P GGG G P P G Sbjct: 51 GGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGG 110 Query: 508 XKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 P P P P + PP P Sbjct: 111 GGAP-------APRPSPSGGAPPTSGPPIP 133 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 G PGG G GGG G GG GGG G GGG G Sbjct: 238 GGPGGQG-AGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPG 296 Query: 544 XPPPP 530 P P Sbjct: 297 GPGAP 301 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 63.7 bits (148), Expect = 6e-09 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA 781 PPPPPP P PPPP PP P P PPPPP PP P PP A Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPRRA 61 Score = 63.3 bits (147), Expect = 8e-09 Identities = 27/54 (50%), Positives = 27/54 (50%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPPP P PPPP PP P P PPPPP PP P PP P P Sbjct: 9 PPPPPPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 58.4 bits (135), Expect = 2e-07 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T PPPPP P P PPPPPP P P PPPPPPP Sbjct: 8 TPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 41.9 bits (94), Expect = 0.020 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 9 PPPPPPPPPPP------PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 63.7 bits (148), Expect = 6e-09 Identities = 29/65 (44%), Positives = 32/65 (49%) Frame = +2 Query: 608 CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 C PPPPPP P P PP PP P P + PPP P PP P + PP PA+P Sbjct: 147 CKLPSPPPPPPPPSPPPPSPPSPPPPS----PPPPPPPSPPPPSPPPPSP-SPPPPPASP 201 Query: 788 XXXPP 802 PP Sbjct: 202 PPPPP 206 Score = 56.4 bits (130), Expect = 9e-07 Identities = 26/66 (39%), Positives = 27/66 (40%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PPP P PPPP PP P + PPPPP Sbjct: 152 PPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPS---PSPPPPPASPPPPPPAL 208 Query: 749 PXPXAG 766 P P G Sbjct: 209 PYPQCG 214 Score = 52.0 bits (119), Expect = 2e-05 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP---PPPP 415 PPPPP P P PPPPPP P P PPP PPPP Sbjct: 153 PPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPP 197 Score = 48.0 bits (109), Expect = 3e-04 Identities = 26/75 (34%), Positives = 26/75 (34%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPP P P P PPPPP Sbjct: 154 PPPPPPSPPPPSPPSPPPPSPPPPPP--------PSPPPPSPPPPSPSPPPPPASPPPPP 205 Query: 420 PPXXXXXXXXGXGGG 376 P GGG Sbjct: 206 PALPYPQCGIKKGGG 220 Score = 46.8 bits (106), Expect = 7e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P P PPP PPP Sbjct: 152 PPPPPPPPSP----PPPSPPSPPPPSPPPPPPPSPPPPSPPP 189 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPP P P P PPPP P P P PPPP Sbjct: 150 PSPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPP 190 Score = 40.3 bits (90), Expect = 0.061 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 +PPPPP P PPPPP +PPPP P Sbjct: 151 SPPPPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSP 192 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PP PP PP P Sbjct: 152 PPPPPPPPSPPPPSPPSPPPPSPPPPPPP--SPPPPSPPPPSPSPPPPPASPPPPP 205 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPP P P P PPPP PP Sbjct: 150 PSPPPPPPPPSPPPPSPPSPPPPSPP 175 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP P PPPPP P PPP P Sbjct: 170 PPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPPALP 209 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 504 KXPXPXXXXXPP-PPPPXPXXPXXPPPPPPP 415 K P P PP PPPP P P PP PPPP Sbjct: 148 KLPSPPPPPPPPSPPPPSPPSPP-PPSPPPP 177 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P P PPP PP PP P Sbjct: 150 PSPPPPPPPP----SPPPPSPPSPPPPSP---PPPPPPSPPPPSPPPPSPSPPPPP 198 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPPP P PPP P PP P Sbjct: 154 PPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPPALP 209 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 63.3 bits (147), Expect = 8e-09 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP---XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PPPPPP P PPPP PP P P PPPP Sbjct: 569 PPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPP------PPILPNRSVPPPPP 622 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP P P P PP Sbjct: 623 PPPPLPNHSVLPPPPPPPPPP 643 Score = 60.5 bits (140), Expect = 5e-08 Identities = 35/86 (40%), Positives = 36/86 (41%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX---PGPPPPXPPXXGGXXXPX-APXXXAXPPP 736 PPPPP PPPP P P PPPP PP P A PPP Sbjct: 637 PPPPPPPS-----LPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPP 691 Query: 737 PPXPPXPXA----GPPXPAAPXXXPP 802 PP PP P A GP P+AP PP Sbjct: 692 PPPPPLPPANRTNGPGVPSAPPPPPP 717 Score = 57.6 bits (133), Expect = 4e-07 Identities = 32/78 (41%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPPP P PPPP P P PPPPP P Sbjct: 547 PPPPPPPPSGNKPAFS---PPPPPP---PPPPPPLPQSNYASSQP--------PPPPPPP 592 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P P PP Sbjct: 593 PLPNCLVPSPPPPPPPPP 610 Score = 57.2 bits (132), Expect = 5e-07 Identities = 34/89 (38%), Positives = 34/89 (38%), Gaps = 11/89 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX----PGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP PPPPPP P PPPP PP P P PPP Sbjct: 586 PPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPP---PPPP 642 Query: 737 P-------PXPPXPXAGPPXPAAPXXXPP 802 P P PP P G PA P PP Sbjct: 643 PSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 54.4 bits (125), Expect = 4e-06 Identities = 33/89 (37%), Positives = 34/89 (38%), Gaps = 13/89 (14%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXP-----------GPPPPXPPXXGGXXXPXAPXX 718 PPPP G G PPPPPP GPPPP PP P Sbjct: 651 PPPPAPGIGNKF--PAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPGV 708 Query: 719 XAXPPPPPXPPXPXA--GPPXPAAPXXXP 799 + PPPPP PP GP PA P P Sbjct: 709 PSAPPPPPPPPPANRSNGPSAPAPPLPPP 737 Score = 50.8 bits (116), Expect = 4e-05 Identities = 25/63 (39%), Positives = 27/63 (42%), Gaps = 5/63 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG-----PPXPAAPX 790 P P P P PPPP PP G +P PPPPP PP P + PP P P Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSP--PPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Query: 791 XXP 799 P Sbjct: 593 PLP 595 Score = 50.0 bits (114), Expect = 8e-05 Identities = 30/80 (37%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXX--CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPPPPP PP P G P AP PPPPP Sbjct: 668 PPPPPRSSSRTPTGAATSSKGPPPPPP-----PPLPPANRTNGPGVPSAP-----PPPPP 717 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP + P AP PP Sbjct: 718 PPPANRSNGPSAPAPPLPPP 737 Score = 49.6 bits (113), Expect = 1e-04 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP + P PPP P PPPP Sbjct: 548 PPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPP 607 Query: 421 PPP 413 PPP Sbjct: 608 PPP 610 Score = 49.2 bits (112), Expect = 1e-04 Identities = 23/66 (34%), Positives = 24/66 (36%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP PPPPP +P Sbjct: 543 APPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSP 602 Query: 430 PPPPPP 413 PPPPPP Sbjct: 603 PPPPPP 608 Score = 48.8 bits (111), Expect = 2e-04 Identities = 28/78 (35%), Positives = 29/78 (37%), Gaps = 8/78 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX-----PGPPPPXPPXXGGXXXPXAPXXXAX-- 727 PPPPP PPPPPP P PPPP PP P P Sbjct: 602 PPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNK 661 Query: 728 -PPPPPXPPXPXAGPPXP 778 P PPP PP P + P Sbjct: 662 FPAPPPPPPPPRSSSRTP 679 Score = 48.4 bits (110), Expect = 2e-04 Identities = 39/147 (26%), Positives = 40/147 (27%), Gaps = 11/147 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP-------PPPPXPXX- 445 P PP + PPPPP P P PP PPPP P Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIG 659 Query: 444 ---PXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXG 274 P PPPPPPP G PP PG Sbjct: 660 NKFPAPPPPPPPPRSSSRTPTGAATSSKGPPP-------PPPPPLPPANRTNGPGVPSAP 712 Query: 273 XXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PPPP P P P P P Sbjct: 713 PPPPPPPPANRSNGPSAPAPPLPPPLP 739 Score = 48.4 bits (110), Expect = 2e-04 Identities = 29/89 (32%), Positives = 29/89 (32%), Gaps = 1/89 (1%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXGG 691 P G G PPPP G PP P PP PP PP G Sbjct: 699 PANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPPLMTG 758 Query: 692 XXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 P P PPPP P P PP P Sbjct: 759 KKAPAPP-----PPPPQAPKPPGTVPPPP 782 Score = 48.0 bits (109), Expect = 3e-04 Identities = 38/145 (26%), Positives = 38/145 (26%), Gaps = 9/145 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX---------PX 448 PPPP G G PPPPP PPPPPP P Sbjct: 651 PPPPAPGIGN---KFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPG 707 Query: 447 XPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXX 268 P PPPPPPP G PP Sbjct: 708 VPSAPPPPPPPPPANRSN-GPSAPAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPP 766 Query: 267 PPPPXXXXPPRXPXTPXXPGGPGXP 193 PPP P P P G G P Sbjct: 767 PPPQAPKPPGTVPPPPPLHGASGRP 791 Score = 47.6 bits (108), Expect = 4e-04 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 11/95 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP--XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP G PPPPPP GP P PP PPPPP Sbjct: 695 PPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPP 754 Query: 743 ---------XPPXPXAGPPXPAAPXXXPPXXGXGG 820 PP P P P PP G G Sbjct: 755 LMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHGASG 789 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP P P PPP P P PP Sbjct: 693 PPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAP-APPLPPPLPAAANKRNPPAPP 751 Query: 421 PPP 413 PPP Sbjct: 752 PPP 754 Score = 45.2 bits (102), Expect = 0.002 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPPP PPPP Sbjct: 568 PPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPP-----PPPPPILPNRSVPPPPP 622 Query: 421 PPP 413 PPP Sbjct: 623 PPP 625 Score = 44.8 bits (101), Expect = 0.003 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXP---XXPXXPPPPPPP 415 PPPPP P PPPPPP P PPPPPPP Sbjct: 547 PPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPP 591 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPPPP P P PPP P P PPPPP Sbjct: 566 PPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Query: 420 P 418 P Sbjct: 626 P 626 Score = 44.8 bits (101), Expect = 0.003 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP--XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G PPPPPP PG PP PP G P P P P Sbjct: 750 PPPPPLMTG-----KKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRPHPPSSKGLNAPAP 804 Query: 743 XP 748 P Sbjct: 805 PP 806 Score = 44.4 bits (100), Expect = 0.004 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 536 PPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPP P P PPPPP PPPPPPP Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Score = 44.0 bits (99), Expect = 0.005 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPPP P P PPP P PPPPPPP Sbjct: 601 SPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPP 643 Score = 42.3 bits (95), Expect = 0.015 Identities = 23/75 (30%), Positives = 24/75 (32%), Gaps = 5/75 (6%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPP-----XXXPXPPPXXPP 680 P G P PPPP + P PPPPPP P PPP PP Sbjct: 551 PPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPP 610 Query: 681 XXGGXXXXXXPPGXP 725 PP P Sbjct: 611 ILPNRSVPPPPPPPP 625 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P PPPPP PPPP Sbjct: 586 PPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPP-------PPPPPLPNHSVLPPPPP 638 Query: 421 PPP 413 PPP Sbjct: 639 PPP 641 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 8/64 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--------XPPPXXPPXXGGXXXXXXP 713 P PPPP G P PPPPPP P PPP PP P Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPP 603 Query: 714 PGXP 725 P P Sbjct: 604 PPPP 607 Score = 41.5 bits (93), Expect = 0.026 Identities = 33/134 (24%), Positives = 33/134 (24%), Gaps = 3/134 (2%) Frame = -2 Query: 600 PPPPXXGGG---GGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPPP G PPPPP P PPPPPP P Sbjct: 669 PPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPS 728 Query: 429 PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXX 250 P PP PP P P G PPPP Sbjct: 729 APAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPKP----PGTVPPPPPL 784 Query: 249 XXPPRXPXTPXXPG 208 P P G Sbjct: 785 HGASGRPHPPSSKG 798 Score = 41.1 bits (92), Expect = 0.035 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 6/79 (7%) Frame = -2 Query: 633 GGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXP------XXXXXP 472 G G PPPP G PP P P P P Sbjct: 705 GPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAP 764 Query: 471 PPPPPXPXXPXXPPPPPPP 415 PPPPP P PPPPP Sbjct: 765 PPPPPQAPKPPGTVPPPPP 783 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPP P PPPPPPP Sbjct: 634 PPPPPPPP-----PPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 7/73 (9%) Frame = -1 Query: 610 AXXPPPPXXXGG-----GGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPP--XX 452 A PPPP G PPPPP P P PPPPP Sbjct: 664 APPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANR 723 Query: 451 XXXXXTPPPPPPP 413 P PP PP Sbjct: 724 SNGPSAPAPPLPP 736 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 Query: 491 PXXXPXPPPPPXXLXXXXNPPPPPPP 414 P P PPPPP +PPPPPPP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPP 569 Score = 36.7 bits (81), Expect = 0.75 Identities = 32/123 (26%), Positives = 32/123 (26%), Gaps = 7/123 (5%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXX-------PPPPPPPXXXXXXXXGXG 382 PP K P P PPPPP P P PPPPPPP Sbjct: 521 PPEVQHESPSDRKLPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNY 580 Query: 381 GGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 PP P P PPPP P P P P Sbjct: 581 ASSQPPPPP---------------PPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Query: 201 GXP 193 P Sbjct: 626 PLP 628 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG------PPXPAAPXXXPP 802 PP P A PPPPP PP P +G PP P P PP Sbjct: 521 PPEVQHESPSDRKLPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPPPP P PP P G PP P Sbjct: 618 PPPPPPPPPLPN----HSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 35.9 bits (79), Expect = 1.3 Identities = 27/87 (31%), Positives = 27/87 (31%), Gaps = 4/87 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP----PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PP PP PPPP P PPPP P G P P A P Sbjct: 732 PPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRP 791 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXGXG 817 P P P P PP G G Sbjct: 792 HP-PSSKGLNAPAP------PPLLGRG 811 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 491 PXXXPXPPPPPXXLXXXXNPPPPPPP 414 P P PPPP PPPPPPP Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPP 570 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PP P P PPP PP Sbjct: 602 PPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPP 642 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/71 (28%), Positives = 20/71 (28%), Gaps = 7/71 (9%) Frame = +3 Query: 534 GGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPP-------XXXPXPPPXXPPXXGG 692 G P PPPP P PPPPPP P P PP Sbjct: 681 GAATSSKGPPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPA 740 Query: 693 XXXXXXPPGXP 725 PP P Sbjct: 741 AANKRNPPAPP 751 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T PPPPP P PPPPP P PPPPP P Sbjct: 540 TAAAPPPPPPPP----PPPSGNKPAFSPPPPPPP-----PPPPPLP 576 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 A PPPP P P PPPPP PPPPP Sbjct: 542 AAPPPPPPPPPPPSGNKPAFSPPPPPPP---------PPPPP 574 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX---PXPPPXXPP 680 P PPPP P PPPP P P PPP PP Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPP 643 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P PPPP G P P PP P PPP Sbjct: 747 PPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPP 783 >UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamydomonas reinhardtii|Rep: Cell wall glycoprotein GP2 - Chlamydomonas reinhardtii Length = 1226 Score = 63.3 bits (147), Expect = 8e-09 Identities = 28/61 (45%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP--PPPPXPPXPXAGPPXPAAPXXXP 799 PP PPP P PPPP PP P P P PPPP PP P PP P P P Sbjct: 951 PPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPP 1010 Query: 800 P 802 P Sbjct: 1011 P 1011 Score = 60.1 bits (139), Expect = 7e-08 Identities = 30/78 (38%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PP PPP P P PPP P P P A PPP P P Sbjct: 967 PPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPP 1026 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P + PP A PP Sbjct: 1027 PPPPSPPPPVARLPPWPP 1044 Score = 55.6 bits (128), Expect = 2e-06 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP PPP PP P P PPPP PP P PP P PP Sbjct: 963 PPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPP 1021 Score = 55.2 bits (127), Expect = 2e-06 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPP P P PPPP PP P P PPPP P Sbjct: 979 PPPSPPPPAPPPPSPPPPVPPPPSPPP-PSPPPPSPPPAAASPPPSPPP----PPPPSPP 1033 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P P P Sbjct: 1034 PPVARLPPWPPLPVNNVP 1051 Score = 52.0 bits (119), Expect = 2e-05 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPP P P P P PPPP P P PPP P Sbjct: 954 PPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSP 1013 Query: 420 PP 415 PP Sbjct: 1014 PP 1015 Score = 48.0 bits (109), Expect = 3e-04 Identities = 21/56 (37%), Positives = 22/56 (39%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP P P P P P + PP PP PP P PP PA P PP Sbjct: 565 PPDLMQPSTSCPLSPPPSPSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPP 620 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX--PXXPPP 427 PPPP PPPP P P PPP PP P PPP Sbjct: 967 PPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPP 1026 Query: 426 PPPP 415 PPPP Sbjct: 1027 PPPP 1030 Score = 46.8 bits (106), Expect = 7e-04 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXPPX 754 PP C P P PP P PP P P P +P A P PPPP PP Sbjct: 565 PPDLMQPSTSCPLSPPPSPSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPPAPPA 624 Query: 755 PXAG 766 G Sbjct: 625 AFCG 628 Score = 46.4 bits (105), Expect = 0.001 Identities = 22/53 (41%), Positives = 23/53 (43%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAA 784 P PPP P P PP PP P P + PP PP P P PP P A Sbjct: 576 PLSPPPSPSPPPSPPQPPSP----PPVPPSPPSPPPSPPSPANPSPPPPAPPA 624 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPP--PPXPXXPXXPPPPPPP 415 PPPP K P P PP P PP P P PPPPPP Sbjct: 777 PPPPPAPSPPPKPPTPSPPPLPPQPNPPPAPPSPNPSPPPPPP 819 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPP P P PPP PP P P PPP PP Sbjct: 583 PSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPPAPP 623 Score = 44.4 bits (100), Expect = 0.004 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 PPPPP P PPP P P P P PPP PP P PP P Sbjct: 777 PPPPPA--PSPPPKPP-------TPSPPPLPPQPNPPPAPPSPNPSPPPP 817 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +2 Query: 608 CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 C PP PP P P PP P P +P PP P P P PP P Sbjct: 282 CKTTSRPPSPPLPPSPPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPPSPLPPAP 338 Score = 44.0 bits (99), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP P P PP P PP P P PPP PP Sbjct: 778 PPPPAPSPPPKPPTPSPPPLPPQPNPPPAPPSPNPSPPPPPP 819 Score = 43.2 bits (97), Expect = 0.009 Identities = 24/58 (41%), Positives = 25/58 (43%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP P PP P PP P P PPP P PP P PP P +P P Sbjct: 291 PPLPPSPPPQPPSPLPPSPA----PLPPS----PPPSPLPPSPK--PPTPPSPLPPAP 338 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP PP P P PPP P P P P PPPP Sbjct: 951 PPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPP 991 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP PP PP P Sbjct: 974 PPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPP 1029 Score = 41.5 bits (93), Expect = 0.026 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP-PPPXPXXPXXPPPPPP 418 PPP P + P P PP PPP P P P PPPP Sbjct: 579 PPPSPSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPP 620 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = +2 Query: 608 CXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA 781 C PP P P PPP P P +P PP PP PP P P+ Sbjct: 559 CATILTPPDLMQPSTSCPLSPPPSPSPPPSPPQPPSPPPV--PPSPPSPPPSPPSPANPS 616 Query: 782 APXXXPP 802 P PP Sbjct: 617 PPPPAPP 623 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP A P PPPP P PPP PP PP P Sbjct: 970 PVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPP 1025 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PPPP P PPP PP PP P Sbjct: 975 PPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPP 1030 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP P P PPP P P P PPPP Sbjct: 998 PPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPP 1035 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPPP +PPP PPP Sbjct: 984 PPPAPPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPP 1026 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP---PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP P PPP PP P PPPP PP P P PP Sbjct: 994 PPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPWPPLPVNNVPPA 1053 Query: 740 P 742 P Sbjct: 1054 P 1054 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPP---PPPPXPXXPXXPPPPPPP 415 P PPP P P PP PP P P P P PP PP Sbjct: 295 PSPPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPPSPLPPAPP 339 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPXPP-XPXAGPPXPAAP 787 PPP PP P P P PP P +P P P PP PP G AP Sbjct: 297 PPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPPSPLPPAPPTQQFTGSVFVYAP 352 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXX---PPPPPPXPXXPXXPPPPPP 418 T PP PP + P P PP PPP P P PP PP Sbjct: 284 TTSRPPSPPLPPSPPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPP 331 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PP PP +PPPP PP Sbjct: 967 PPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPP 1009 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +2 Query: 665 PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PP PP P P P PPP PP P PP P +P PP G Sbjct: 777 PPPPPA------PSPPPKPPTPSPPPLPPQPNP-PPAPPSPNPSPPPPPPG 820 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P PPPP P P PPP PP Sbjct: 952 PSPPPPTPPSPPPPSPPPPVLSPPPSPP 979 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPP-PPXXXXXXXTPPPPPPP 413 PPPP P P PPP PP PPPP PP Sbjct: 962 PPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPP 1004 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PPPP P P PP PP Sbjct: 988 PPPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPP---PPPPSPPPPVARLPPWPP 1044 Query: 420 PP 415 P Sbjct: 1045 LP 1046 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP P P PPPP PP PPPP Sbjct: 964 PPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPP 1006 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPP 680 P PPPP P P PPPP P PPP PP Sbjct: 963 PPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPP 1004 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PP P A P PPPPPP P P PP Sbjct: 1001 PSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPP 1041 Score = 35.9 bits (79), Expect = 1.3 Identities = 26/94 (27%), Positives = 26/94 (27%), Gaps = 1/94 (1%) Frame = -2 Query: 471 PPPPPXPXXPXXPPP-PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX 295 PP PP P P PPP PPPP PP P Sbjct: 951 PPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSPPP 1010 Query: 294 PGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P PPP PP P P P P Sbjct: 1011 PSPPPAAASPPPSPPPPPPPSPPPPVARLPPWPP 1044 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP P P P PPP P P P P PP P Sbjct: 294 PPSPPPQPPSPLPPSPAPLPPSPPPSPLPPSPKPPTPPSP 333 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +P PPP P P PPP P +PPPP PP Sbjct: 582 SPSPPPSPPQPPSPPPVPPSPPSPPPSPPS-PANPSPPPPAPP 623 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP P PP PP P PPP PP Sbjct: 583 PSPPPSPPQPPSPPPVPPSPPSPPPSPPSPANPSPPPPAPP 623 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPP P PPP PP Sbjct: 994 PPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPP 1034 Score = 34.7 bits (76), Expect = 3.0 Identities = 27/98 (27%), Positives = 27/98 (27%), Gaps = 4/98 (4%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPP--PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXX 319 P PPP PP P P PPP PPP PP Sbjct: 949 PLPPSPPPPTPPSPPPPSPPPPVLSPPPSPPPPSPPPPAPPPPSPPPPVPPPPSPPPPSP 1008 Query: 318 XXXXXXPXPGXXXXGXXPPPPXXXXPP--RXPXTPXXP 211 P PPPP PP R P P P Sbjct: 1009 PPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPWPPLP 1046 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP----PPXXXPXPPPXXPP 680 P PPPP P PPP PP P PPP PP Sbjct: 989 PPPSPPPPVPPPPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPP 1033 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 689 GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 G P + + PP PP PP P PP P P P Sbjct: 275 GFFLPPSCKTTSRPPSPPLPPSPPPQPPSPLPPSPAP 311 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 + P P PPP PP P P P PP P Sbjct: 287 RPPSPPLPPSPPPQPPSPLPPSPAPLPPSP 316 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 AP PPP P P P PP NP PPPPP Sbjct: 782 APSPPPKPPTPSPPPLPPQPNPPPAPP------SPNPSPPPPP 818 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP----PXXPP 680 P PPP A P PPPPP P PP P PP Sbjct: 1000 PPSPPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPWPP 1044 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 3/64 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP---PPXPXXPXXPP 430 PPPP + P PPP P P PPP PP P P Sbjct: 993 PPPPVPPPPS--PPPPSPPPPSPPPAAASPPPSPPPPPPPSPPPPVARLPPWPPLPVNNV 1050 Query: 429 PPPP 418 PP P Sbjct: 1051 PPAP 1054 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 63.3 bits (147), Expect = 8e-09 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PPPP PP P P PPPPP PP P PP P P PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPP-----PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 61.7 bits (143), Expect = 2e-08 Identities = 26/52 (50%), Positives = 27/52 (51%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA 781 PPPPPP P PPPP PP P P PPPPP PP P PP P+ Sbjct: 62 PPPPPPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPLPPPPPPS 109 Score = 54.8 bits (126), Expect = 3e-06 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPPPPP P P PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 54.4 bits (125), Expect = 4e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPPPP P P PPPPPPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 54.4 bits (125), Expect = 4e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PPPPPP P P PPPPPPP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPPPP P P PPPPPPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPPPP P P PPPPPPP Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPP P Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLP 103 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPP PP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPP 104 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPP PPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P P PPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 53.6 bits (123), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 41.9 bits (94), Expect = 0.020 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP PP PP P Sbjct: 59 PPAPPPPPPPP------PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 40.3 bits (90), Expect = 0.061 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 PPP P PPPPPP P PPP PP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP PPP P PPP PP PP P Sbjct: 56 PPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PPPP P PPP PP PP P Sbjct: 57 PLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 92 >UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding; n=1; Yarrowia lipolytica|Rep: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding - Yarrowia lipolytica (Candida lipolytica) Length = 1851 Score = 63.3 bits (147), Expect = 8e-09 Identities = 34/76 (44%), Positives = 34/76 (44%), Gaps = 5/76 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP GG PPPPPP PG PP P GG P PPPPP Sbjct: 1048 PPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPG--FTGGPPPPPP 1105 Query: 743 XPPXP---XAGPPXPA 781 PP P GPP PA Sbjct: 1106 PPPLPPGFTGGPPPPA 1121 Score = 54.8 bits (126), Expect = 3e-06 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG T PPPPP P P PPPP P PPPPP Sbjct: 1048 PPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPP 1107 Query: 420 P 418 P Sbjct: 1108 P 1108 Score = 54.4 bits (125), Expect = 4e-06 Identities = 31/95 (32%), Positives = 32/95 (33%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P GG PPPPP G G PPPP GPPPP PP Sbjct: 1052 PPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPP----- 1106 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P P PPPP P P P+ P Sbjct: 1107 --PPLPPGFTGGPPPPAPAFVAGATPSPSPSPQLP 1139 Score = 53.6 bits (123), Expect = 6e-06 Identities = 31/81 (38%), Positives = 31/81 (38%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP--- 739 PPPPP GG PPP PPPP PP G P P PPPP Sbjct: 1049 PPPPPMFTGG-----------PPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFT 1097 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 PP P PP P PP Sbjct: 1098 GGPPPPPPPPPLPPGFTGGPP 1118 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/64 (43%), Positives = 28/64 (43%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPPPP PPPP P GG P PPPPP PP GPP P PP Sbjct: 1043 PPPPP-----PPPPPPMFTGGP--PPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPG 1095 Query: 809 GXGG 820 GG Sbjct: 1096 FTGG 1099 Score = 53.2 bits (122), Expect = 8e-06 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG PPPPP G P P PPPP P PPPPP Sbjct: 1049 PPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPPP 1108 Query: 420 PP 415 P Sbjct: 1109 LP 1110 Score = 50.4 bits (115), Expect = 6e-05 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 9/73 (12%) Frame = +2 Query: 626 PPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXPPPP-----PXPPXPXAGPPXP 778 PPPPPP P GPPP P P PPPP P PP GPP P Sbjct: 1044 PPPPPPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPP 1103 Query: 779 AAPXXXPPXXGXG 817 P PP G Sbjct: 1104 PPPPPLPPGFTGG 1116 Score = 49.2 bits (112), Expect = 1e-04 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP P PPPP G GG P Sbjct: 1045 PPPPPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPP 1104 Query: 360 P 358 P Sbjct: 1105 P 1105 Score = 48.0 bits (109), Expect = 3e-04 Identities = 24/69 (34%), Positives = 24/69 (34%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP GG PPPPP P P PPPP Sbjct: 1042 GPPPPPPPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPP 1101 Query: 439 XTPPPPPPP 413 PPPPP P Sbjct: 1102 PPPPPPPLP 1110 Score = 46.4 bits (105), Expect = 0.001 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G GG PPPP G P P PPPPPP P PPPP Sbjct: 1071 PPPPPPGFTGGPPPPGFTGGPPPPGFTGG-----PPP-----PPPPPPLPPGFTGGPPPP 1120 Query: 420 PP 415 P Sbjct: 1121 AP 1122 Score = 41.1 bits (92), Expect = 0.035 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = -1 Query: 643 GGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXG---EXXKXPXXPXXXXX 473 GG G PPPP GG PPPP G P P Sbjct: 1057 GGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPPPLPPGFTGG 1116 Query: 472 PPPPPXXXXXXXTPPPPPPPE 410 PPPP TP P P P+ Sbjct: 1117 PPPPAPAFVAGATPSPSPSPQ 1137 Score = 38.3 bits (85), Expect = 0.25 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 T PPPPP P P PPP P PPPPPPP G G Sbjct: 1040 TGGPPPPPP---------PPPPPMFTGGPPPMFTGGPP-PPPPPPPPGFTGGPPPPGFTG 1089 Query: 372 XXXPPXF 352 PP F Sbjct: 1090 GPPPPGF 1096 Score = 38.3 bits (85), Expect = 0.25 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 8/64 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP----XPPP----XXPPXXGGXXXXXXP 713 P PPPP GG PPPPPP P PPP PP G P Sbjct: 1044 PPPPPPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPP 1103 Query: 714 PGXP 725 P P Sbjct: 1104 PPPP 1107 Score = 37.9 bits (84), Expect = 0.33 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 9/65 (13%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXX-AXXPXXPPPPPP---XXXPXPP-----PXXPPXXGGXXXXXX 710 P PPPP GG P PPPPPP P PP P P GG Sbjct: 1046 PPPPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPP 1105 Query: 711 PPGXP 725 PP P Sbjct: 1106 PPPLP 1110 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 5/54 (9%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP-----PPPP 413 G PPPPP P PPPPP PPP PPPP Sbjct: 1041 GGPPPPPPPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPP 1094 Score = 35.5 bits (78), Expect = 1.7 Identities = 29/96 (30%), Positives = 29/96 (30%) Frame = -2 Query: 702 GXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPX 523 G P GG P G GG PPPP GG PPPPP Sbjct: 1057 GGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGG-------PPPPPPPPPL 1109 Query: 522 XXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPP P P P P P Sbjct: 1110 ---------PPGFTGGPPPPAPAFVAGATPSPSPSP 1136 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 63.3 bits (147), Expect = 8e-09 Identities = 28/67 (41%), Positives = 28/67 (41%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP P PPPP PP AP PPPPP PP Sbjct: 38 PPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPP 97 Query: 752 XPXAGPP 772 P P Sbjct: 98 PPPLQKP 104 Score = 50.4 bits (115), Expect = 6e-05 Identities = 21/41 (51%), Positives = 22/41 (53%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP + P P PPPPPP P P PPPPPPP Sbjct: 38 PPPPKL-----EDPPPTVEEQPPPPPPPPPPPPPPPPPPPP 73 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 10/67 (14%) Frame = +2 Query: 608 CXXXXXPPP----PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP------PPPPXPPXP 757 C PPP PPP PPPP PP P P P PPPP PP P Sbjct: 33 CPVIRPPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPP 92 Query: 758 XAGPPXP 778 PP P Sbjct: 93 PPPPPPP 99 Score = 48.4 bits (110), Expect = 2e-04 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAP-----XXXAXPPPPPXPPXPXAGPPXP 778 PPP P PPPP PP P P PPPPP PP P PP P Sbjct: 46 PPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPP 100 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPX---PXXXXXPPPPPPXPXXPXXPP 430 PPPP PPPPP P P PPPPP P P PP Sbjct: 38 PPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPPP--PPPPP 95 Query: 429 PPPPP 415 PPPPP Sbjct: 96 PPPPP 100 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP P PPP P PP P Sbjct: 34 PVIRPPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPP 89 Score = 41.9 bits (94), Expect = 0.020 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 9/74 (12%) Frame = +2 Query: 608 CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP---------X 760 C P P P P PP P P P PPPPP PP P Sbjct: 23 CPCPCPCPCPCPVIRPPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEPDKFEE 82 Query: 761 AGPPXPAAPXXXPP 802 A PP P P PP Sbjct: 83 APPPPPPPPPPPPP 96 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 P P P P P P P P PPPPP PP P PP P Sbjct: 22 PCPCPCPCPCPCPVIRPPPPKLEDPPPTVEEQPPPPPPPPPPPPPPPPPP 71 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP E K P PPPPP PPPPPP Sbjct: 67 PPPPPPPQIEPDKFEEAPPPPPPPPPPP---------PPPPPP 100 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPP P P PPPPP PPPPPPP Sbjct: 38 PPPPKLEDPPPTVEEQPPPPPPPPPPP--------PPPPPPP 71 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP P PPPPPP P PP P Sbjct: 65 PPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPPLQKP 104 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPP--XXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 54 PPPPPP--------PPPPPPPPPPPPPPQIEPDKFEEAPPPPPPP 90 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPPPP P PPPPPP P P P Sbjct: 68 PPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPPLQKP 104 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P P P PPP P PPPPPPP Sbjct: 24 PCPCPCPCPCPVIRPPPPKLEDPPPTVEEQPPPPPPPPPPPP 65 >UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Protein enabled - Drosophila melanogaster (Fruit fly) Length = 829 Score = 63.3 bits (147), Expect = 8e-09 Identities = 35/86 (40%), Positives = 35/86 (40%), Gaps = 8/86 (9%) Frame = +2 Query: 536 GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPP------PPPPXXXPGPP--PPXPPXXGG 691 GG PPPPP GG PP PPPP GPP PP PP GG Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 603 Query: 692 XXXPXAPXXXAXPPPPPXPPXPXAGP 769 P AP PPPPP PP P Sbjct: 604 -GPPPAPGGPGAPPPPPPPPGLGGAP 628 Score = 53.6 bits (123), Expect = 6e-06 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 5/79 (6%) Frame = -2 Query: 636 GGGGXXXXXXKXPPPPXXGG--GGGXXXXXTXXX---PPPPPXXXGXXXKXPXPXXXXXP 472 GG G PPPP GG GGG PPPP G P P Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMG 602 Query: 471 PPPPPXPXXPXXPPPPPPP 415 PPP P P PPPPPPP Sbjct: 603 GGPPPAPGGPGAPPPPPPP 621 Score = 49.6 bits (113), Expect = 1e-04 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 7/80 (8%) Frame = -1 Query: 631 GGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPP-------PPPXXXGEXXKXPXXPXXXXX 473 GG G A PPPP GG G PP PPP G P P Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 603 Query: 472 PPPPPXXXXXXXTPPPPPPP 413 PPP PPPPPPP Sbjct: 604 GPPPAPGGPG--APPPPPPP 621 Score = 46.8 bits (106), Expect = 7e-04 Identities = 33/105 (31%), Positives = 33/105 (31%) Frame = -2 Query: 732 GGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXX 553 GG PP GG GGGP PPPP GGG Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPP------APPQMFNGAPPPPAMGGG------- 590 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP PP G P P PPPPPP P P P Sbjct: 591 PPPAPPAPPAMGGGPP--PAPGGPGAPPPPPPPPGLGGAPKKEDP 633 Score = 43.2 bits (97), Expect = 0.009 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 3/75 (4%) Frame = -2 Query: 573 GGXXXXXTXXXPPPPPXXXGXXX---KXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXX 403 GG PPPPP G P P PPPP P PP PP Sbjct: 544 GGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGG 603 Query: 402 XXXXGXGGGGXXXPP 358 GG G PP Sbjct: 604 GPPPAPGGPGAPPPP 618 Score = 42.3 bits (95), Expect = 0.015 Identities = 35/111 (31%), Positives = 35/111 (31%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG PP P P F G GGG F P GG Sbjct: 544 GGPGGPPAPAPPPPPPSF--------------GGAAGGGPPPPAPPQMFNGAPPPPAMGG 589 Query: 539 GXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG 691 G PP PP GGG PPP P PPPP PP GG Sbjct: 590 GPPPA-----PPAPPAMGGG---------PPPAPGGPGAPPPPPPPPGLGG 626 Score = 40.7 bits (91), Expect = 0.046 Identities = 28/73 (38%), Positives = 28/73 (38%), Gaps = 7/73 (9%) Frame = +3 Query: 528 GGGGGXXXXXPXXXPPPPXXXG--GGGXXAXXP-----XXPPPPPPXXXPXPPPXXPPXX 686 GG GG P PPPP G GGG P PPPP P P P PP Sbjct: 544 GGPGGPPAPAPP--PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAM 601 Query: 687 GGXXXXXXPPGXP 725 GG PG P Sbjct: 602 GG--GPPPAPGGP 612 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/72 (27%), Positives = 20/72 (27%) Frame = -1 Query: 631 GGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXX 452 GG G P PP G PP PP P P PPPPP Sbjct: 562 GGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Query: 451 XXXXXTPPPPPP 416 P P Sbjct: 622 PGLGGAPKKEDP 633 Score = 37.5 bits (83), Expect = 0.43 Identities = 26/76 (34%), Positives = 26/76 (34%), Gaps = 10/76 (13%) Frame = +3 Query: 516 PXXXGG--GGGXXXXXPXXX----PPPPXXXGGGGXXAXXPXX----PPPPPPXXXPXPP 665 P GG GGG P PPPP GG P PPP P PP Sbjct: 558 PPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPP 617 Query: 666 PXXPPXXGGXXXXXXP 713 P PP GG P Sbjct: 618 PPPPPGLGGAPKKEDP 633 Score = 36.7 bits (81), Expect = 0.75 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 1/88 (1%) Frame = -2 Query: 453 PXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP-PXFFFLXXXXXXXXXXXXXXPXPGXXXX 277 P P P PPPPP G GGG P P F P Sbjct: 546 PGGPPAPAPPPPPPSFG----GAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAM 601 Query: 276 GXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 G PPP P P P PG G P Sbjct: 602 GGGPPPAPGG-PGAPPPPPPPPGLGGAP 628 Score = 34.7 bits (76), Expect = 3.0 Identities = 31/94 (32%), Positives = 31/94 (32%), Gaps = 10/94 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPP 739 PP PP PPP P PG P GG P AP PP Sbjct: 502 PPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPA------PP 555 Query: 740 PXPP----XPXAGPPXPAAP---XXXPPXXGXGG 820 P PP GPP PA P PP GG Sbjct: 556 PPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGG 589 Score = 34.7 bits (76), Expect = 3.0 Identities = 31/104 (29%), Positives = 32/104 (30%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG A P+ G GG A G PP GG P GGG Sbjct: 547 GGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGG-- 604 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXP 490 PPP GG G PPPPP G K P Sbjct: 605 --------PPPAPGGPGA-------PPPPPPPPGLGGAPKKEDP 633 Score = 34.3 bits (75), Expect = 4.0 Identities = 26/81 (32%), Positives = 26/81 (32%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P GG AAG G P G G PP GGG P G Sbjct: 556 PPPPSFGG----AAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGG 611 Query: 639 GGGGGXXXXXXKXPPPPXXGG 577 G PPPP GG Sbjct: 612 PGA------PPPPPPPPGLGG 626 >UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Euteleostomi|Rep: Protein diaphanous homolog 1 - Homo sapiens (Human) Length = 1248 Score = 63.3 bits (147), Expect = 8e-09 Identities = 34/83 (40%), Positives = 34/83 (40%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPP G PPP PP GG PPPPP P Sbjct: 668 PPPPPLPGSAGIP------PPPPPLPGEAGMPPPPPPLPGG---------PGIPPPPPFP 712 Query: 749 PXPXAGPPXPAAPXXXPPXXGXG 817 P PP P PP G G Sbjct: 713 GGPGIPPPPPGMGMPPPPPFGFG 735 Score = 59.3 bits (137), Expect = 1e-07 Identities = 31/70 (44%), Positives = 31/70 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPP PG PPP PP GG P P PPPPP Sbjct: 681 PPPPPLPGEAGMP------PPPPPLPGGPGIPPP-PPFPGGPGIPPPPPGMGMPPPPPFG 733 Query: 749 PXPXAGPPXP 778 A P P Sbjct: 734 FGVPAAPVLP 743 Score = 58.0 bits (134), Expect = 3e-07 Identities = 35/95 (36%), Positives = 35/95 (36%), Gaps = 12/95 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXX-----PPPPPPXXXPGPPPPXPPXXGGXXXPXAP-----XX 718 PPPPP G G PPPPP PPP PP G P P Sbjct: 631 PPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEA 690 Query: 719 XAXPPPPPXPPXP--XAGPPXPAAPXXXPPXXGXG 817 PPPPP P P PP P P PP G G Sbjct: 691 GMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMG 725 Score = 57.6 bits (133), Expect = 4e-07 Identities = 40/136 (29%), Positives = 40/136 (29%), Gaps = 1/136 (0%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-PPPPPXPXXPXXPPPPP 421 PPP G PPPPP G P P PPPPP P P P Sbjct: 588 PPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSS 647 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P G PP P P G PPPP Sbjct: 648 LPGGTAIPPPPPLPGSARIPPP-----PPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGG 702 Query: 240 PRXPXTPXXPGGPGXP 193 P P P PGGPG P Sbjct: 703 PGIPPPPPFPGGPGIP 718 Score = 55.2 bits (127), Expect = 2e-06 Identities = 35/91 (38%), Positives = 37/91 (40%), Gaps = 7/91 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA-PXXXAXPPPPPX 745 PPPPP GG PPPP PPPP P G P + P A PPPPP Sbjct: 607 PPPPPLPGGTAIS------PPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPL 660 Query: 746 P---PXPXAGPPXPAA---PXXXPPXXGXGG 820 P P PP P + P PP G G Sbjct: 661 PGSARIPPPPPPLPGSAGIPPPPPPLPGEAG 691 Score = 54.4 bits (125), Expect = 4e-06 Identities = 39/118 (33%), Positives = 39/118 (33%), Gaps = 4/118 (3%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P GG PPPP G PPPPP G Sbjct: 634 PPLPEGVGIPSPSSLPGGTA---------IPPPPPLPGSA--------RIPPPPPPLPGS 676 Query: 510 XX----KXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFF 349 P P PPPPPP P P PPPPP P G G PP F Sbjct: 677 AGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGF 734 Score = 52.0 bits (119), Expect = 2e-05 Identities = 32/90 (35%), Positives = 33/90 (36%), Gaps = 9/90 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP----PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PP PP G G P PPPP P PPPP P P PPP Sbjct: 574 PPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPP 633 Query: 737 PPXP-----PXPXAGPPXPAAPXXXPPXXG 811 PP P P P + P A P PP G Sbjct: 634 PPLPEGVGIPSPSSLPGGTAIP-PPPPLPG 662 Score = 50.4 bits (115), Expect = 6e-05 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PP P P PP P P G P P PPP PP P PP P PP Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPP 623 Query: 809 GXGGA 823 G A Sbjct: 624 LSGDA 628 Score = 46.4 bits (105), Expect = 0.001 Identities = 34/118 (28%), Positives = 34/118 (28%), Gaps = 2/118 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PP P P P PPPP P PPPPPPP G G P Sbjct: 564 PPSVPSRAPVPPAPPLPGDSGTIIPPPPAPGDSTTPPPPPPPPPPPPPLPG-GTAISPPP 622 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXG--XXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P G PPPP P P PG G P Sbjct: 623 PLSGDATIPPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIP 680 Score = 37.9 bits (84), Expect = 0.33 Identities = 30/89 (33%), Positives = 30/89 (33%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P G G PPPP GG G PPPPP G Sbjct: 671 PPLPGSAGIPPPPPPLPGEAG------MPPPPPPLPGGPG---------IPPPPPFPGGP 715 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 P P PPPPP P P P Sbjct: 716 GIPPPPPGMGM-PPPPPFGFGVPAAPVLP 743 Score = 37.5 bits (83), Expect = 0.43 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 12/81 (14%) Frame = -1 Query: 619 GXXAXX-------PPPPXXXGGGG----XXXGXXXXXPPPPPXXXGEXXKXP-XXPXXXX 476 G PPPP GG PPPPP G P P Sbjct: 594 GDSTTPPPPPPPPPPPPPLPGGTAISPPPPLSGDATIPPPPPLPEGVGIPSPSSLPGGTA 653 Query: 475 XPPPPPXXXXXXXTPPPPPPP 413 PPPPP PPPPP P Sbjct: 654 IPPPPPLPGSARIPPPPPPLP 674 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP---XXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PP P G P PPPPPP P PP GG PPG Sbjct: 667 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPGIPPPPPG 723 >UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 4076 Score = 62.9 bits (146), Expect = 1e-08 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP P PPPP PP P P PPPP PP P PP P P PP Sbjct: 2073 PSPPPPSPPPSPPPPSPPPPS---PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 57.6 bits (133), Expect = 4e-07 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 P PPP P PPPP PP P P PP PP P P PP P Sbjct: 2078 PSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPMHDFDETDT 2137 Query: 806 XGXGG 820 G GG Sbjct: 2138 DGSGG 2142 Score = 49.6 bits (113), Expect = 1e-04 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-PPPPXXXXXXXXGXGGGG 373 PP PP P P P PPPP P P PPP PPPP G GG Sbjct: 2086 PPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPMHDFDETDTDGSGG 2142 Score = 49.2 bits (112), Expect = 1e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG 766 PPP PP PPPP PP P P PPPP PP P AG Sbjct: 84 PPPSPPPPPSPPPPPSPPP---PPSPPPPSPPPSPPPPSPPPPPGAG 127 Score = 49.2 bits (112), Expect = 1e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPPP P P PPP PPP Sbjct: 2071 PPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPP 2112 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P P PPPP P P PPP PPP Sbjct: 2076 PPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPP 2117 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P P PPPP P P PPP PPP Sbjct: 2081 PPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 2122 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPPP P PPP PP PP P Sbjct: 2071 PPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 2126 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PP PPP P PPPP PP Sbjct: 2075 PPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPP 2116 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PP PPP P PPPP PP Sbjct: 2080 PPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPP 2121 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP P P P PPPP P P P PPPPP Sbjct: 84 PPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPPP 124 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPP P P PPPP P P P P PPPP Sbjct: 2073 PSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPP 2113 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPP P P PPPP P P P P PPPP Sbjct: 2078 PSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPP 2118 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP + P PPPP P P PPP PP PP P Sbjct: 2070 PPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPP 2121 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPP PP P P PPPP P Sbjct: 2084 PPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSP 2125 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP P P PPP PP P P P PPPP Sbjct: 2070 PPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPP 2108 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPP P PP PPPP Sbjct: 84 PPPSPPPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPP 123 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P PP PPP P P PPPP P Sbjct: 2070 PPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSP 2110 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P PPPPP P PP PPPP Sbjct: 2072 PPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPP 2113 Score = 41.1 bits (92), Expect = 0.035 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P PPPP P P PPP PPP Sbjct: 1869 PPPSPPPPPSPPPPSPPPPSPPPPSPPP 1896 Score = 41.1 bits (92), Expect = 0.035 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P PPPP P P P P PPPPP Sbjct: 1871 PSPPPPPSPPPPSPPPPSPPPPSPPPPP 1898 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/39 (48%), Positives = 21/39 (53%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PPP P PPPP PP P +P + PPPPP Sbjct: 1870 PPSPPP--PPSPPPPSPP-------PPSPPPPSPPPPPP 1899 Score = 40.3 bits (90), Expect = 0.061 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 701 PXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P +P PPPPP PP P + PP P+ P PP Sbjct: 85 PPSPPPPPSPPPPPSPPPPPS-PPPPSPPPSPPP 117 Score = 40.3 bits (90), Expect = 0.061 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPPPP PP P PP P P PP G Sbjct: 1873 PPPPPSPPPPSPPPPSPPPPSPPPPPPG 1900 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 R +PPPP P P P PPP +PPPP PP Sbjct: 2066 RIASPPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPP 2111 Score = 39.9 bits (89), Expect = 0.081 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPP P P PPPP P PPP P P PP P PP Sbjct: 84 PPPSPPPPPSPPPP-------------------PSPPPPPSPPPPSPPPSPPPPSPPPPP 124 Query: 809 GXGGA 823 G G A Sbjct: 125 GAGAA 129 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXG 382 P P PP PPP P P PPP PP G G Sbjct: 89 PPPPSPPPPPSPPPPPSPPPPSPPPSPPPPSPPPPPGAG 127 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP PPP P P PPPPPP Sbjct: 1670 PPPSPPPPSPPPSPPPPSPSPPPPPP 1695 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPP P P PPPP PP P +P P PPP PP Sbjct: 1869 PPPSPPPPPSPPPPSPP-------PPSPPP---PSPPPPPP 1899 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPP 421 P P P PPPP P P PPPPP Sbjct: 1874 PPPPSPPPPSPPPPSPPPPSPPPPPP 1899 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 G P PPPP P P PPPP P PPP PP G Sbjct: 78 GIANCSPPPSPPPPPSPP---PPPSPPPPPSPPPPSPPPSPPPPSPPPPPG 125 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPP PPP PPP Sbjct: 2070 PPPPSPPPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPP 2112 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP + P PPPP P PPP PP PP Sbjct: 2076 PPPSPPPSPPPPSPPPPSPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 2128 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +2 Query: 722 AXPPPP-PXPPXPXAGPPXPAAPXXXPP 802 A PPPP P PP P PP P+ P PP Sbjct: 2068 ASPPPPSPPPPSPPPSPPPPSPPPPSPP 2095 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = +2 Query: 662 PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA 781 PPP PP P +P + PPP P PP P PP A Sbjct: 1869 PPPSPPP------PPSPPPPSPPPPSPPPPSPPPPPPGKA 1902 Score = 35.9 bits (79), Expect = 1.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 468 PPPPXPXXPXXPPPPPP 418 PPPP P P PPPPPP Sbjct: 1481 PPPPSPPPPSPPPPPPP 1497 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P P PPP PP PPPP Sbjct: 88 PPPPP-------SPPPPPSPPPPPSPPPPSPPPSPPPPSPPPP 123 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP PP P P PPPPP Sbjct: 1669 PPPPSPPPPSPPPSPPPPSPSPPPPP 1694 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPP 421 P P PPP P P P PPPPP Sbjct: 1670 PPPSPPPPSPPPSPPPPSPSPPPPPP 1695 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P P P PPP P PPPPPP Sbjct: 1669 PPPPSPPPPSPPPSPPPPSPSPPPPPP 1695 Score = 35.1 bits (77), Expect = 2.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 609 AXXPXXPPPPPPXXXPXPPPXXPP 680 A P PPPPP P PPP PP Sbjct: 1867 ASPPPSPPPPPSPPPPSPPPPSPP 1890 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P PPP P P PP P+ P PP G A Sbjct: 1871 PSPPPPPSPPPPSPPPPSPPPPSPPPPPPGKA 1902 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPP P PP P PP P +P PP G Sbjct: 1670 PPPSPPPPSPPPSPP-PPSPSPPPPPPG 1696 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPPP PPP PPP Sbjct: 85 PPSPPPPPSPPPPPSPPPPPSPPPPSPPP 113 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 707 APXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 +P PPP P PP P P P +P PP Sbjct: 1868 SPPPSPPPPPSPPPPSPPPPSPPPPSPPPPPP 1899 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP P PPP PP P +P + PPPPP Sbjct: 1669 PPPPSPPPPSPPPSPP-------PPSP---SPPPPPP 1695 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXG 688 PPP PP P PP P PP G Sbjct: 1880 PPPSPPPPSPPPPSPPPPPPG 1900 Score = 33.1 bits (72), Expect = 9.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPP 679 PPPP P PPPP PP Sbjct: 1481 PPPPSPPPPSPPPPPPP 1497 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG 766 PPPP PP P +P + PPPP P AG Sbjct: 1669 PPPPSPPPPS---PPPSPPPPSPSPPPPPPGKAVAG 1701 Score = 33.1 bits (72), Expect = 9.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXP 676 P PPPP P PPPP P Sbjct: 1672 PSPPPPSPPPSPPPPSP 1688 Score = 33.1 bits (72), Expect = 9.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXP 676 PPP PP P PPPP P Sbjct: 1679 PPPSPPPPSPSPPPPPP 1695 >UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 444 Score = 62.9 bits (146), Expect = 1e-08 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G G G GGP GG GGGGG G G P GG GGG P GGGGGG Sbjct: 170 GRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGGG 229 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 230 GALKCVV----GGGGGGG 243 Score = 62.5 bits (145), Expect = 1e-08 Identities = 38/86 (44%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAX--GXXXPPXXGGXGGGGPGXX 646 PP P GG G G P GG GGGG A G G P GG GGGGPG Sbjct: 132 PPAPGGGG------GGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRA 185 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGGG P GGGGG Sbjct: 186 PGGGGGGGGPGRA-----PGGGGGGG 206 Score = 58.0 bits (134), Expect = 3e-07 Identities = 39/91 (42%), Positives = 40/91 (43%), Gaps = 10/91 (10%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXX--PPXXGGXGGGG-PGXXXG 640 P GG G G GG A GG GGGG + GA G PP GG GGGG P G Sbjct: 91 PPGGGGAPGPLGGGG-ARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLG 149 Query: 639 GGGGG-------XXXXXXKXPPPPXXGGGGG 568 GGGGG PP GGGGG Sbjct: 150 GGGGGGALARPPGGGRGGALGRPPGGGGGGG 180 Score = 53.6 bits (123), Expect = 6e-06 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 5/83 (6%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGG-----PGXXXGG 637 GG G G G P G G GGGGG G GG G GG P GG Sbjct: 300 GGGGGGGGGHGAPELGFSGGGGGGGGGEIAGTVDLRG----GGGGAGGVFPPTPDLGGGG 355 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGGG P GGGGG Sbjct: 356 GGGGGGTKVRVCAPKDISGGGGG 378 Score = 52.4 bits (120), Expect = 1e-05 Identities = 44/146 (30%), Positives = 45/146 (30%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G GP G G GGG G PP GG GG P GGGGGG Sbjct: 89 GLPPGGGGAPGPLGGGGARPPGGGG----GGGPPSLPPGAGGGGGARPPAPGGGGGGG-- 142 Query: 618 XXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPX 439 P GGGGG PP G + P P P Sbjct: 143 ------APRRVLGGGGGGGALAR----PPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGG 192 Query: 438 XPPPPPPPXXXXXXXXGXGGGGXXXP 361 P P G GGGG P Sbjct: 193 GGPGRAPGGGGGGGGPGGGGGGGGAP 218 Score = 52.0 bits (119), Expect = 2e-05 Identities = 37/92 (40%), Positives = 37/92 (40%), Gaps = 7/92 (7%) Frame = -2 Query: 822 APPXPXXGGXXXGA-----AGXGGPAXGX--GGXGGGGGXAXXXGAXGXXXPPXXGGXGG 664 AP GG GA G G A G GG GGGGG G G P GG Sbjct: 143 APRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGG 202 Query: 663 GGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGG 568 GG G GGGGGG P GGGGG Sbjct: 203 GGGGGPGGGGGGG-------GAPERVIGGGGG 227 Score = 51.6 bits (118), Expect = 2e-05 Identities = 35/89 (39%), Positives = 35/89 (39%), Gaps = 5/89 (5%) Frame = -2 Query: 819 PPXPXXGGXXXGAA-----GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGP 655 PP GG G A G GGP GG GGGGG G G GG GGGG Sbjct: 172 PPGGGGGGGGPGRAPGGGGGGGGPGRAPGG-GGGGGGPGGGGGGGGAPERVIGGGGGGGG 230 Query: 654 GXXXGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGG K GGGGG Sbjct: 231 ALKCVVGGGGGGGGALKR--AAGSGGGGG 257 Score = 51.2 bits (117), Expect = 3e-05 Identities = 35/83 (42%), Positives = 35/83 (42%), Gaps = 5/83 (6%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG-----G 637 GG A G G GG GGGGG G G GG GGGG G G G Sbjct: 282 GGGALENAREDGAEGGGGGGGGGGG-----GGHGAPELGFSGGGGGGGGGEIAGTVDLRG 336 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGGG PP P GGGGG Sbjct: 337 GGGGAGGV---FPPTPDLGGGGG 356 Score = 50.4 bits (115), Expect = 6e-05 Identities = 40/125 (32%), Positives = 42/125 (33%), Gaps = 11/125 (8%) Frame = +2 Query: 200 PGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXX----KKKKXGGX 367 PG G G G G GGGG P PG ++ GG Sbjct: 92 PGGGGAPGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGG 151 Query: 368 XX------PPPPXPXXXXXXFXGGGGGGGXXGXX-GXGGGGGGXXXXXGXGXFXXFPXXX 526 PP GGGGGGG G G GGGGGG G G P Sbjct: 152 GGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGG 211 Query: 527 GGGGG 541 GGGGG Sbjct: 212 GGGGG 216 Score = 50.4 bits (115), Expect = 6e-05 Identities = 30/77 (38%), Positives = 30/77 (38%), Gaps = 4/77 (5%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGX----AXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G GG GGGGG A G G GG GGGG GGGGGG Sbjct: 225 GGGGGGALKCVVGGGGGGGGALKRAAGSGGGGGALECEIGGGGGGGGTDRNKGGGGGGGG 284 Query: 618 XXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 285 ALENAREDGAEGGGGGG 301 Score = 47.2 bits (107), Expect = 5e-04 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 5/83 (6%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGX---AXXXGAXGXXXPPXXGGXGGGGPG--XXXGG 637 GG G G G P GG GGGGG G G G GGGG GG Sbjct: 206 GGPGGGGGGGGAPERVIGGGGGGGGALKCVVGGGGGGGGALKRAAGSGGGGGALECEIGG 265 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGGG K GGGGG Sbjct: 266 GGGGGGTDRNKG----GGGGGGG 284 Score = 47.2 bits (107), Expect = 5e-04 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 4/76 (5%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGG---XAXXXGAXGXXXPPXXGGXGG-GGPGXXXGGGGGGXX 619 G G GG GG GGGGG A GA G GG GG G P GGGGG Sbjct: 265 GGGGGGGTDRNKGGGGGGGGALENAREDGAEGGGGGGGGGGGGGHGAPELGFSGGGGGGG 324 Query: 618 XXXXKXPPPPXXGGGG 571 GGGG Sbjct: 325 GGEIAGTVDLRGGGGG 340 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 GGGGGGG GGGGG G G P GGGGGA R Sbjct: 175 GGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPER 220 Score = 44.8 bits (101), Expect = 0.003 Identities = 37/133 (27%), Positives = 39/133 (29%), Gaps = 1/133 (0%) Frame = +2 Query: 206 PPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPPP 385 PPG G G G GGGG P G ++ GG Sbjct: 172 PPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGGGGA 231 Query: 386 XPXXXXXXFXGGGGGGGXXGXXGXGGGGGG-XXXXXGXGXFXXFPXXXGGGGGXXXVXXX 562 GGGGGG G GGGGG G G GGGGG Sbjct: 232 LKCVVGG---GGGGGGALKRAAGSGGGGGALECEIGGGGGGGGTDRNKGGGGGGGGALEN 288 Query: 563 XXPPPPPXXGGGG 601 GGGG Sbjct: 289 AREDGAEGGGGGG 301 Score = 44.4 bits (100), Expect = 0.004 Identities = 30/68 (44%), Positives = 30/68 (44%), Gaps = 6/68 (8%) Frame = +2 Query: 416 GGGGGGGXXGXXG------XGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPP 577 GGGGGGG G G GGGGGG G G GGGGG V PP Sbjct: 298 GGGGGGGGGGGHGAPELGFSGGGGGG-----GGGEIAGTVDLRGGGGGAGGV----FPPT 348 Query: 578 PPXXGGGG 601 P GGGG Sbjct: 349 PDLGGGGG 356 Score = 44.0 bits (99), Expect = 0.005 Identities = 36/100 (36%), Positives = 36/100 (36%), Gaps = 16/100 (16%) Frame = -2 Query: 819 PPXPXXGGXXX----GAAGXGGPAXGXGGXGGGGGXAXXX----GAXGXXXPPXXGGXGG 664 PP GG GA G GG G GGGGG G G P GG GG Sbjct: 108 PPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGG 167 Query: 663 G---GPGXXXGGGG-----GGXXXXXXKXPPPPXXGGGGG 568 PG GGGG GG P GGGGG Sbjct: 168 ALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGG 207 Score = 44.0 bits (99), Expect = 0.005 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 4/82 (4%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGX----GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 GG AAG GG GG GGGGG G G G G GGG Sbjct: 243 GGALKRAAGSGGGGGALECEIGGGGGGGGTDRNKGGGGGGGGALENAREDGAEGGGGGGG 302 Query: 633 GGGXXXXXXKXPPPPXXGGGGG 568 GGG P GGGGG Sbjct: 303 GGGGGGHG--APELGFSGGGGG 322 Score = 41.5 bits (93), Expect = 0.026 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 3/67 (4%) Frame = +2 Query: 410 FXGGGGGGG---XXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPP 580 F GGGGGGG G GGGGG G F P GGGGG P Sbjct: 316 FSGGGGGGGGGEIAGTVDLRGGGGG-----AGGVFPPTPDLGGGGGGGGGGTKVRVCAPK 370 Query: 581 PXXGGGG 601 GGGG Sbjct: 371 DISGGGG 377 Score = 39.5 bits (88), Expect = 0.11 Identities = 28/75 (37%), Positives = 28/75 (37%) Frame = +2 Query: 377 PPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVX 556 P P P GGGG G G G GGG G G P GGGGG Sbjct: 80 PRPLPIKLLGLPPGGGGAPGPLGGGGARPPGGG-----GGGGPPSLPPGAGGGGGAR--- 131 Query: 557 XXXXPPPPPXXGGGG 601 PP P GGGG Sbjct: 132 -----PPAPGGGGGG 141 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG P GG G G GGGGGG G P GGGG G Sbjct: 175 GGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGGGG 230 Score = 39.1 bits (87), Expect = 0.14 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 5/63 (7%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPG-----XXXGGG 634 G GA G P GG GGGGG P G GGGG G GGG Sbjct: 336 GGGGGAGGVFPPTPDLGGGGGGGGGGTKVRVCA---PKDISGGGGGGGGMLDKPDEAGGG 392 Query: 633 GGG 625 GGG Sbjct: 393 GGG 395 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GGGGG G G GGGGG Sbjct: 188 GGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGGGG 230 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG G GG G G +P GGG G Sbjct: 278 GGGGGGGALENAREDGAEGGGGGGGGGGGGGHGAPELGFSGGGGGGGGGEIAGTVDLRGG 337 Query: 594 GGGXXAXXPXXP 629 GGG P P Sbjct: 338 GGGAGGVFPPTP 349 Score = 36.7 bits (81), Expect = 0.75 Identities = 23/63 (36%), Positives = 25/63 (39%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGG GGV GGGGG G + +P GGGG P G Sbjct: 337 GGGGAGGVFPPTPDLGGGGG--GGGGGTKVRVCAPKDISGGGGGGGG--MLDKPDEAGGG 392 Query: 594 GGG 602 GGG Sbjct: 393 GGG 395 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG P GG GG GGGGGG G P GGG G Sbjct: 174 GGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGGG 229 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +1 Query: 406 SXXGGGGGGG-XXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 S GGGGGGG GGGGG G F P GGGGG Sbjct: 317 SGGGGGGGGGEIAGTVDLRGGGGGAG-----GVFPPTPDLGGGGGG 357 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 GGGGG G GGGG G G P GGGG Sbjct: 336 GGGGGAGGVFPPTPDLGGGGGGGGGGTKVRVCAPKDISGGGG 377 Score = 33.5 bits (73), Expect = 7.0 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXG-----GGGGGXXGXXAXXPPPPXXXGGGGXXX 560 G GG GG GGG G G GGGGG G P P GGGG Sbjct: 303 GGGGGGHGAPELGFSGGGGGGGGGEIAGTVDLRGGGGGAGG--VFPPTPDLGGGGGGGGG 360 Query: 559 G 557 G Sbjct: 361 G 361 Score = 33.1 bits (72), Expect = 9.3 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG GGGG G G +P GGGGG P Sbjct: 320 GGGGGGGEIAGTVDLRGGGG-----GAGGVFPPTPDL-GGGGGGGGGGTKVRVCAPKDIS 373 Query: 594 GGG 602 GGG Sbjct: 374 GGG 376 >UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 134 Score = 62.9 bits (146), Expect = 1e-08 Identities = 30/65 (46%), Positives = 30/65 (46%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P GG G G GG G GG GGGGG G G GG GGGG G G Sbjct: 26 PQANKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 85 Query: 639 GGGGG 625 GGGGG Sbjct: 86 GGGGG 90 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 60.9 bits (141), Expect = 4e-08 Identities = 29/64 (45%), Positives = 29/64 (45%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Query: 606 KXPP 595 PP Sbjct: 93 YYPP 96 Score = 60.1 bits (139), Expect = 7e-08 Identities = 30/67 (44%), Positives = 30/67 (44%) Frame = -2 Query: 777 GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXP 598 G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGY 93 Query: 597 PPPXXGG 577 PP GG Sbjct: 94 YPPWNGG 100 Score = 59.7 bits (138), Expect = 9e-08 Identities = 29/65 (44%), Positives = 29/65 (44%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Query: 606 KXPPP 592 PP Sbjct: 92 GYYPP 96 Score = 50.8 bits (116), Expect = 4e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPG 652 GG G G GG G GG GGGGG G G PP GG GPG Sbjct: 58 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPSGPG 107 Score = 49.2 bits (112), Expect = 1e-04 Identities = 26/60 (43%), Positives = 26/60 (43%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG G G GGGGGG G G GGGGG PP GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGG 100 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 73 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 74 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 75 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 76 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 78 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 79 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 80 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 81 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 G GG GG GGG G GGGGGG G GGGG G Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGY 93 Query: 544 XPP 536 PP Sbjct: 94 YPP 96 Score = 40.3 bits (90), Expect = 0.061 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 G GG GG GGG G GGGGGG G GGGG G Sbjct: 33 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Query: 544 XPPP 533 PP Sbjct: 93 YYPP 96 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFP 517 GGGGGGG G G GGGGGG G + P Sbjct: 73 GGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPSGP 106 Score = 39.5 bits (88), Expect = 0.11 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKX 500 GG GGG G GGGGGG G GGGG G PP G Sbjct: 46 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPSG 105 Query: 499 P 497 P Sbjct: 106 P 106 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 G GG GG GGG G GGGGGG G GGGG G Sbjct: 32 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Query: 544 XPPPP 530 PP Sbjct: 92 GYYPP 96 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG GGGGG G G GGGGG PP G Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGG 100 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GGGGG G G GGGGG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 82 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGG 575 G GG GG GGG G GGGGGG G P GG Sbjct: 51 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGG 100 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 688 PXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 P GGG G GGGGGG G GGGG G Sbjct: 26 PQANKQGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 69 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 62.9 bits (146), Expect = 1e-08 Identities = 33/83 (39%), Positives = 33/83 (39%), Gaps = 6/83 (7%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPG------PPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPP G PPPPPP PG PPPP PP G P PP Sbjct: 597 PPPPPVGA--------PPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPP 648 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P PP P P P Sbjct: 649 PPPPPGAPGMPPPPPGMPRAPAP 671 Score = 54.8 bits (126), Expect = 3e-06 Identities = 30/73 (41%), Positives = 30/73 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP G PP PP G P P A PPP P Sbjct: 605 PPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPP-PPVGAGILPPPPPPPGAPGMPPPPP 663 Query: 749 PXPXAGPPXPAAP 787 P A P PA P Sbjct: 664 GMPRA--PAPARP 674 Score = 54.4 bits (125), Expect = 4e-06 Identities = 27/65 (41%), Positives = 27/65 (41%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPPPP P PPPP PP P A PPPPP P PP P PP Sbjct: 597 PPPPPVGAPPPPPPPPPP------PPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPP 650 Query: 809 GXGGA 823 GA Sbjct: 651 PPPGA 655 Score = 50.0 bits (114), Expect = 8e-05 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP G P P PPPPP P P PPPPP Sbjct: 606 PPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVP--PPPVGAGILPPPPPPPGAPGMPPPPP 663 Score = 49.6 bits (113), Expect = 1e-04 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 6/66 (9%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXX------PPPPPPPXXXXXXXXGXGGG 376 PPP G P P PPPPPP P P PPPPPPP G Sbjct: 584 PPPTDLAGAPPVAPPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGA 643 Query: 375 GXXXPP 358 G PP Sbjct: 644 GILPPP 649 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/74 (33%), Positives = 25/74 (33%), Gaps = 6/74 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP------PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP G PPP PPP G PP PP G P P Sbjct: 609 PPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPPPGMPRA 668 Query: 731 PPPPXPPXPXAGPP 772 P P P PP Sbjct: 669 PAPARPKKKNEAPP 682 Score = 43.2 bits (97), Expect = 0.009 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP G P P PPPP P Sbjct: 604 APPPPPPPPP----PPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMP 659 Query: 430 PPPP 419 PPPP Sbjct: 660 PPPP 663 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P P PPP PPPPP Sbjct: 597 PPPPPVGA-----PPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPP 651 Query: 420 PP 415 PP Sbjct: 652 PP 653 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPP G P PPPPP P PPP PP G PP P Sbjct: 584 PPPTDLAGA------PPVAPPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPP 628 Score = 39.9 bits (89), Expect = 0.081 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP------PXXPPXXGGXXXXXXPPG 719 P PPPP G A P PPP P PP P PP G PPG Sbjct: 605 PPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPGMPPPPPG 664 Query: 720 XP 725 P Sbjct: 665 MP 666 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G PPPP P P PPPP Sbjct: 591 GAPPVAPPPPPV----GAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGIL 646 Query: 439 XTPPPPPPP 413 PPPPPPP Sbjct: 647 --PPPPPPP 653 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP G P PPPPP PPP PP Sbjct: 593 PPVAPPPPPV----GAPPPPPPPPPPPPGVAAAAPPPPPPP 629 Score = 36.3 bits (80), Expect = 1.00 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXP 292 PPPPP P PPPPPPP G PP P P Sbjct: 597 PPPPPVGAPPPPPPPPPPPP-------GVAAAAPPPPPP----------PPGLAGLVPPP 639 Query: 291 GXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 PPPP P P P P P Sbjct: 640 PVGAGILPPPPPPPGAPGMPPPPPGMPRAP 669 >UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; n=1; Candida albicans|Rep: Putative uncharacterized protein BNI1 - Candida albicans (Yeast) Length = 1732 Score = 62.9 bits (146), Expect = 1e-08 Identities = 31/65 (47%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP----XAGPPXPAAPXXX 796 PPPPP P PPPP PP GG AP PPPPP PP P +G P AP Sbjct: 1051 PPPPPPPPPPPPPPLPPILGGNNSSAAP-----PPPPPPPPPPAFLNGSGSVIPPAPPLP 1105 Query: 797 PPXXG 811 PP G Sbjct: 1106 PPSSG 1110 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPP P G P P PPPPP L + PP PP Sbjct: 1062 PPPLPPILGGNNSSAAPPPPPPPPPPPAFLNGSGSVIPPAPP 1103 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 6/53 (11%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXP------XXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P P PPPPPP P PPPPPPP G G PP Sbjct: 1051 PPPPPPPPPPPPPPLPPILGGNNSSAAPPPPPPPPPPPAFLNGSGSVIPPAPP 1103 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = +3 Query: 591 GGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 G + P PPPPP P PPP PP GG PP P Sbjct: 1042 GNSTTSSAAPPPPPPPP----PPPPPPLPPILGGNNSSAAPPPPP 1082 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 8/52 (15%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP--------XXXPXPPPXXPPXXG 689 P PP P GG A P PPPPPP P PP PP G Sbjct: 1059 PPPPPPLPPILGGNNSSAAPPPPPPPPPPPAFLNGSGSVIPPAPPLPPPSSG 1110 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 707 APXXXAXPPPPPXPPXP--XAGPPXPAAPXXXPP 802 AP PPPPP PP P G AAP PP Sbjct: 1050 APPPPPPPPPPPPPPLPPILGGNNSSAAPPPPPP 1083 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 62.9 bits (146), Expect = 1e-08 Identities = 32/80 (40%), Positives = 32/80 (40%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPPP GP PP PP GG P PPPPP PP Sbjct: 351 PPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGG------PPMPPPPPPPPPPP 404 Query: 752 XPXAGPPXPAAPXXXPPXXG 811 GP P P P G Sbjct: 405 SSGNGPAPPPLPPALVPAGG 424 Score = 56.8 bits (131), Expect = 7e-07 Identities = 35/94 (37%), Positives = 35/94 (37%), Gaps = 11/94 (11%) Frame = +2 Query: 569 PPPPPXXGG---------GGXXCXXXXXPPPPPPXXXPGPPP--PXPPXXGGXXXPXAPX 715 PPPPP GG GG PP P P P P P PP GG P P Sbjct: 315 PPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPA 374 Query: 716 XXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 P PP PP GPP P P PP G Sbjct: 375 TGRSGPLPPPPPG-AGGPPMPPPPPPPPPPPSSG 407 Score = 51.6 bits (118), Expect = 2e-05 Identities = 36/109 (33%), Positives = 37/109 (33%), Gaps = 4/109 (3%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXX---PPPPPXX 520 PP GG G G + PPPP GG T PPPPP Sbjct: 329 PPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPGA 388 Query: 519 XGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP-PPXXXXXXXXGXGGG 376 G P PPPPPP P P PPP PP GGG Sbjct: 389 GGPPMPPP-------PPPPPPPPSSGNGPAPPPLPPALVPAGGLAPGGG 430 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPP P PPP PP P P P PPP P Sbjct: 369 PPPPPATGRSG------PLPPPPPGAGGPPMPPPPPP------PPPPPSSGNGPAPPPLP 416 Query: 749 P 751 P Sbjct: 417 P 417 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPP G P P P PPP P P PPPPP G G PP Sbjct: 359 PPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 417 Score = 44.0 bits (99), Expect = 0.005 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 3/67 (4%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP---AAPXXXP 799 PPPPP G P PP GG P P PP P GPP P P P Sbjct: 314 PPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTP-RGPPPPGRGGPPPPPP 372 Query: 800 PXXGXGG 820 P G G Sbjct: 373 PATGRSG 379 Score = 42.7 bits (96), Expect = 0.011 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = -1 Query: 631 GGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXX 452 GG G PP P G PPPP G P PPPP Sbjct: 333 GGNKGRSGPLPPVPL-----GIAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPLPPPPPG 387 Query: 451 XXXXXTPPPPPPP 413 PPPPPPP Sbjct: 388 AGGPPMPPPPPPP 400 Score = 42.3 bits (95), Expect = 0.015 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 4/80 (5%) Frame = +3 Query: 498 GFXLXSPXXXGGGGGXXXXXPXXX----PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP 665 G L P GG G P PPPP G P PPPPP P Sbjct: 323 GNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPP-PPPPPATGRSGPL 381 Query: 666 PXXPPXXGGXXXXXXPPGXP 725 P PP GG PP P Sbjct: 382 PPPPPGAGGPPMPPPPPPPP 401 Score = 41.1 bits (92), Expect = 0.035 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 12/92 (13%) Frame = -2 Query: 600 PPPPXXGGG---GGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX--PXX 436 P PP GG G PPPP G P P PPPPPP P Sbjct: 327 PRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGP----PPPGRGGPPPPPPPATGRSGPLP 382 Query: 435 PPPP-------PPPXXXXXXXXGXGGGGXXXP 361 PPPP PPP G G P Sbjct: 383 PPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPP 414 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT--PP 428 PPPP GG PP G P P PPP P PP Sbjct: 315 PPPPPSRGGN------QLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPP 368 Query: 427 PPPPP 413 PPPPP Sbjct: 369 PPPPP 373 Score = 33.9 bits (74), Expect = 5.3 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +2 Query: 443 GXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXX 622 G G GG G P G GG PPPPP G G Sbjct: 358 GPPPPGRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNG-------P 410 Query: 623 XPPPPPPXXXP 655 PPP PP P Sbjct: 411 APPPLPPALVP 421 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 62.9 bits (146), Expect = 1e-08 Identities = 32/78 (41%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPPP GPPPP G P + A PPPPP Sbjct: 278 PPPPPSRGG---------PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPS 328 Query: 749 PXPXAGPPXPAAPXXXPP 802 A PP P PP Sbjct: 329 RPSVAVPPPPPNRMYPPP 346 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/59 (44%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP PPPP PP G P A A PPPP P PP P+ P P Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVP 335 Score = 59.7 bits (138), Expect = 9e-08 Identities = 29/72 (40%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP-GPPPPXPPXXGGXXXPXAPXXXAXPPPPP- 742 PPPPP G PPPPP P PPP PP P P PPPPP Sbjct: 290 PPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPA 349 Query: 743 XPPXPXAGPPXP 778 P +GPP P Sbjct: 350 LPSSAPSGPPPP 361 Score = 58.0 bits (134), Expect = 3e-07 Identities = 32/86 (37%), Positives = 32/86 (37%), Gaps = 5/86 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP---PPPPPXXXP--GPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G G P PPPPP P PPP P P P P Sbjct: 299 PPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGP 358 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPP P GP P P PP G Sbjct: 359 PPPPPSVLGVGPVAPPPPPPPPPPPG 384 Score = 53.2 bits (122), Expect = 8e-06 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG PPPP G P P PPPP P P PPP Sbjct: 278 PPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPP 337 Query: 420 PP 415 PP Sbjct: 338 PP 339 Score = 53.2 bits (122), Expect = 8e-06 Identities = 33/77 (42%), Positives = 33/77 (42%), Gaps = 4/77 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXX--PPPPP--PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP PPPPP P P PPP PP G P AP PPP Sbjct: 323 PPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVG-PVAPPP---PPP 378 Query: 737 PPXPPXPXAGPPXPAAP 787 PP PP P PP P P Sbjct: 379 PPPPPGP---PPPPGLP 392 Score = 52.0 bits (119), Expect = 2e-05 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXX--PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP G G PPPPP P P PPPPP P PP Sbjct: 300 PPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPP 359 Query: 426 PPPP 415 PPPP Sbjct: 360 PPPP 363 Score = 48.4 bits (110), Expect = 2e-04 Identities = 37/125 (29%), Positives = 37/125 (29%), Gaps = 9/125 (7%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPP---------PPPPXPXXPXXPPPPPPPXXXXXXXXG 388 PPPPP G P P PP PPPP P PPPPPP Sbjct: 277 PPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPP 336 Query: 387 XGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG 208 PP P P G PPP PP P P P Sbjct: 337 PPPNRMYPPP-----PPALPSSAPSGPPPPPPSVLGVGPVAPPP----PPPPPPPPGPPP 387 Query: 207 GPGXP 193 PG P Sbjct: 388 PPGLP 392 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/65 (35%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXX--GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP 428 PPPP G G PPPP P P PPPPP + P Sbjct: 299 PPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGP 358 Query: 427 PPPPP 413 PPPPP Sbjct: 359 PPPPP 363 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP G G A P PPPPPP P PPP P Sbjct: 355 PSGPPPPPPSVLGVGPVAPPPPPPPPPPP--GPPPPPGLP 392 Score = 43.6 bits (98), Expect = 0.007 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P P PPP P PPPP Sbjct: 290 PPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPA 349 Query: 420 PP 415 P Sbjct: 350 LP 351 Score = 41.9 bits (94), Expect = 0.020 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 10/70 (14%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPX---PXXXXXPPPP-------PPXP 451 PPPP GG PPPPP P P PPPP PP P Sbjct: 279 PPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPP 338 Query: 450 XXPXXPPPPP 421 PPPPP Sbjct: 339 PNRMYPPPPP 348 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP GG PPPPP G P P PPPP PPPPP Sbjct: 277 PPPPPPSRGG------PPPPPPPPHNSG----PPPPPARGRGAPPPPPSRAPTAAPPPPP 326 Query: 418 P 416 P Sbjct: 327 P 327 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXP 703 PPPPP G G PPPPPP PPPP P G P Sbjct: 359 PPPPPSVLGVGPVAPP---PPPPPPPPPGPPPPPGLPSDGDHQVP 400 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPP 420 R APPPPP G P PPPPP PPPPP Sbjct: 273 RRQAPPPPPPSRGGPPPPPPPPHNSGPPPPP--ARGRGAPPPPP 314 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP G A PPPPP PP PP PP Sbjct: 287 PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPP 339 Score = 35.5 bits (78), Expect = 1.7 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 7/73 (9%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX-------PPPPPXX 452 A PPPP PPPPP P P PPPPP Sbjct: 321 APPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPP- 379 Query: 451 XXXXXTPPPPPPP 413 P PPPPP Sbjct: 380 ---PPPPGPPPPP 389 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPP-------PPPPP 414 R PPPPP G P PPPP PP PPPPP Sbjct: 274 RQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPP 326 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 62.9 bits (146), Expect = 1e-08 Identities = 32/82 (39%), Positives = 33/82 (40%), Gaps = 1/82 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PP P PPPP PP P PPPPP P Sbjct: 876 PPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPL-------PPPSSAGPPPPPPPP 928 Query: 749 PXPXA-GPPXPAAPXXXPPXXG 811 P P + PP P P PP G Sbjct: 929 PLPNSPAPPNPGGPPPAPPPPG 950 Score = 56.0 bits (129), Expect = 1e-06 Identities = 28/59 (47%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXX-PXAPXXXAXPP-PPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPPP P G P P A PP PPP PP P PP A P PP Sbjct: 869 PPPPASIP-PPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPP 926 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/71 (39%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP-PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP PP G PP PPP P PPPP PP P +P PPP Sbjct: 892 PPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPP------LPNSPAPPNPGGPPPA 945 Query: 746 PPXPXAGPPXP 778 PP P PP P Sbjct: 946 PPPPGLAPPPP 956 Score = 49.6 bits (113), Expect = 1e-04 Identities = 30/81 (37%), Positives = 30/81 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PP PP G P P PP PPP P PPPPP Sbjct: 877 PPPPLPSGLGSLSPA-----PPMPPVSAGPPLPPPPPPP---PPLPPPSSAGPP-PPPPP 927 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 PP GG PP Sbjct: 928 PPLPNSPAPPNPGGPPPAPPP 948 Score = 47.6 bits (108), Expect = 4e-04 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 11/72 (15%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXP------XXXXXPPPPPPXPXXP-----XXPPPPPPPXXXXXXX 394 PPPPP G P P PPPPPP P P PPPPPPP Sbjct: 876 PPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPA 935 Query: 393 XGXGGGGXXXPP 358 GG PP Sbjct: 936 PPNPGGPPPAPP 947 Score = 44.8 bits (101), Expect = 0.003 Identities = 27/83 (32%), Positives = 27/83 (32%) Frame = +2 Query: 491 GXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP 670 G G P G PPP P G PPPPP P P P Sbjct: 884 GLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAG---------PPPPPPPPPLPNSP 934 Query: 671 XPPXXGGXXXPXAPXXXAXPPPP 739 PP GG P A PPPP Sbjct: 935 APPNPGGPPPAPPPPGLAPPPPP 957 Score = 44.4 bits (100), Expect = 0.004 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-- 427 PP P G P PPP G P P P PP P P PPP Sbjct: 892 PPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGL 951 Query: 426 -PPPP 415 PPPP Sbjct: 952 APPPP 956 Score = 42.3 bits (95), Expect = 0.015 Identities = 28/90 (31%), Positives = 29/90 (32%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P G PPPP + PPPPP Sbjct: 879 PPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLP--------PPSSAGPPPPPPPP-P 929 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P P PPP PP P PPPPP Sbjct: 930 LPNSPAPPNPGGPPPAPPPPG--LAPPPPP 957 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G G + P PP P PPP PP PP P Sbjct: 872 PASIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPP 927 Score = 38.3 bits (85), Expect = 0.25 Identities = 22/72 (30%), Positives = 23/72 (31%), Gaps = 3/72 (4%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G + PP P G P PPP G P P PP P Sbjct: 886 GSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPA 945 Query: 439 XTPP---PPPPP 413 PP PPPPP Sbjct: 946 PPPPGLAPPPPP 957 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP-PXXPPXXGGXXXXXXPP 716 P PPPP A P PPPPP P PP P PP PP Sbjct: 902 PLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPP 955 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PPP PPPP G P A P P Sbjct: 924 PPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPGLFFGLGSSSSQCPRKPAIEPSCPMK 983 Query: 749 P 751 P Sbjct: 984 P 984 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP A P PPPPPP P P PP GG PPG Sbjct: 905 PPPPPPPPLPPPSS---AGPP--PPPPPP---PLPNSPAPPNPGGPPPAPPPPG 950 Score = 35.9 bits (79), Expect = 1.3 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G G PP PP G P P PPP P Sbjct: 873 ASIPPPPPLPSG----LGSLSPAPPMPPVSAGPPLPPPPPPPPPL--PPPSSAGPPPPPP 926 Query: 430 PPPPP 416 PPP P Sbjct: 927 PPPLP 931 Score = 35.5 bits (78), Expect = 1.7 Identities = 26/94 (27%), Positives = 26/94 (27%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP P P P PP P PP PPPP G PP Sbjct: 869 PPPPA--SIPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPP 926 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPP 256 P P G PPPP Sbjct: 927 P----PPLPNSPAPPNPGGPPPAPPPPGLAPPPP 956 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P PPPP P PPPP P PPP Sbjct: 921 PPPPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPP 957 >UniRef50_Q20IN6 Cluster: HrpW; n=1; Pseudomonas cichorii|Rep: HrpW - Pseudomonas cichorii Length = 561 Score = 62.5 bits (145), Expect = 1e-08 Identities = 32/73 (43%), Positives = 32/73 (43%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G GG A GG GGGGG G G P GG GGG P GGGGG Sbjct: 249 GGGGGGGGAPSIGG-GGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGG 307 Query: 606 KXPPPPXXGGGGG 568 P GGGGG Sbjct: 308 GGGGAPSVGGGGG 320 Score = 59.7 bits (138), Expect = 9e-08 Identities = 32/84 (38%), Positives = 33/84 (39%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 AP GG + G GG GGGGG A G G P GG GGGG Sbjct: 257 APSIGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVG 316 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGG 571 GGGGGG P G GG Sbjct: 317 GGGGGGSTPSIGGTAPTTTPGTGG 340 Score = 58.0 bits (134), Expect = 3e-07 Identities = 37/98 (37%), Positives = 38/98 (38%), Gaps = 7/98 (7%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGG-------GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G G G P+ G GG GG GGG A G G P GG GGGG GGGGG Sbjct: 251 GGGGGGAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGG 310 Query: 627 GXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXG 514 G P GGGGG P P G Sbjct: 311 G--------APSVGGGGGGGSTPSIGGTAPTTTPGTGG 340 Score = 49.2 bits (112), Expect = 1e-04 Identities = 27/62 (43%), Positives = 27/62 (43%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG G GGGGGG G G P GGGGG P GG Sbjct: 249 GGGGGGG--GAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGG 306 Query: 596 GG 601 GG Sbjct: 307 GG 308 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGG G GGGGGG G G P GGGGG P GG Sbjct: 261 GGGGGG---GAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGG 317 Query: 596 GG 601 GG Sbjct: 318 GG 319 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGGGGG G GGGGGG G G GGGGG V P GGG Sbjct: 261 GGGGGGGAPSVG-GGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGG 319 Query: 599 G 601 G Sbjct: 320 G 320 Score = 42.3 bits (95), Expect = 0.015 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGGGGG G GGGGGG G G P GGGGG P GG Sbjct: 283 GGGGGG--GAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGSTPSIGGTAPTTTPGTGG 340 Score = 41.9 bits (94), Expect = 0.020 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXX 590 S GGGGGG GGGGG G G S GGGG P Sbjct: 247 SKGGGGGGGGAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGG 306 Query: 591 GGGG 602 GGGG Sbjct: 307 GGGG 310 Score = 41.9 bits (94), Expect = 0.020 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG GGGGGG G G GGGGG P P GG Sbjct: 283 GGGGGGGAPSV--GGGGGGGAPSVGGGGGGGAPSVGGGGGGGSTPSIGGTAPTTTPGTGG 340 Score = 40.3 bits (90), Expect = 0.061 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG GGGGG G G S GGGG P G Sbjct: 261 GGGGGGGAPSVGG--GGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGG 318 Query: 594 GGG 602 GGG Sbjct: 319 GGG 321 Score = 40.3 bits (90), Expect = 0.061 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGG G GGGGGG G G GGGGG V P GG Sbjct: 272 GGGGGGGAPSVG-GGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGSTPSIGG 329 Score = 39.9 bits (89), Expect = 0.081 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG GGGGG G G GGGGG P G Sbjct: 250 GGGGGGGAPSIG---GGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGGGGGGGAPSVGG 306 Query: 594 GGGXXA 611 GGG A Sbjct: 307 GGGGGA 312 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +1 Query: 406 SXXGGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 S GGGGGGG GGGGG G P GGGGG Sbjct: 246 SSKGGGGGGG--GAPSIGGGGGGGAPSVGGGGGGGAPSVGGGGGG 288 Score = 35.9 bits (79), Expect = 1.3 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG GGGGG G G S GGGGG P G Sbjct: 283 GGGGGGGAPSVGG--GGGGGAPSVGGGGGGGAPS---VGGGGGGGSTPSIGGTAPTTTPG 337 Query: 594 GGG 602 GG Sbjct: 338 TGG 340 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 GGG G G GGGGG G G G GGG V Sbjct: 140 GGGTGSGSGSPVSGAGGGGGTKGLEGLGSGQGLGGTQGAGGGSGSV 185 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 62.5 bits (145), Expect = 1e-08 Identities = 32/77 (41%), Positives = 32/77 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPPPPP P PPP PP P AP A PPPPP P Sbjct: 441 PPAPP-----SPPAPSPPAPPPPPPVPSPSGPPPPPP-------PPAPSPPAPPPPPPAP 488 Query: 749 PXPXAGPPXPAAPXXXP 799 P PP P P P Sbjct: 489 SPPAPPPPPPPCPPAPP 505 Score = 57.2 bits (132), Expect = 5e-07 Identities = 25/59 (42%), Positives = 26/59 (44%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P P P PP PP P P PPP P PP P PP P+ P PP Sbjct: 439 PSPPAPPSPPAPSPPAPPPPPPVPSPSGP-PPPPPPPAPSPPAPPPPPPAPSPPAPPPP 496 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PP PPP P P P PPPPP Sbjct: 456 PPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPP 497 Score = 50.8 bits (116), Expect = 4e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P G P P PPPPP P PPPPPPP Sbjct: 458 PPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPP 499 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPPP P P P PPPPP Sbjct: 444 PPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPP 485 Score = 46.4 bits (105), Expect = 0.001 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP P P P PPPPPP P PPPPPP Sbjct: 447 PPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPP 486 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P PPPPPP P P PPPPP Sbjct: 456 PPPPPVPSPSG---------PPPPP--------PPPAPSPPAPPPPPPAPSPPAPPPPPP 498 Query: 420 P 418 P Sbjct: 499 P 499 Score = 44.4 bits (100), Expect = 0.004 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP-PXPXXPXXPPPP 424 PP P + PPPPP P P PPPPP P P P PPPP Sbjct: 447 PPAPSPPAPPPPPPVPSPSGPPPPPPP-------PAPSPPAPPPPPPAPSPPAPPPPPPP 499 Query: 423 PPP 415 PP Sbjct: 500 CPP 502 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PP PP P PPPPP Sbjct: 455 PPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPP 497 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXX-----AXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP G A P PPPPPP P PP PP Sbjct: 453 PAPPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPP 498 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P P PP P P P PP PP Sbjct: 441 PPAPPSPPAPSPPAPPPPPPVPSPSGPPPPPPPPAPSPPAPP 482 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PP P P P PPP P PP P Sbjct: 452 PPAPPPPPPVPSPSGPPPPPP--PPAPSPPAPPPPPPAPSPPAPPPPPPPCPPAPP 505 Score = 37.9 bits (84), Expect = 0.33 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P P PPPPP P Sbjct: 454 APPPPPPVPSPSG----------PPPPP--------PPPAPSPPAPPPPPP--APSPPAP 493 Query: 430 PPPPPP 413 PPPPPP Sbjct: 494 PPPPPP 499 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 R +PP PP P P PPPP + PPPPPPP Sbjct: 437 RAPSPPAPP---------SPPAPSPPAPPPPPPVPSPSGPPPPPPP 473 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP A P P P PP P PPP PP PP Sbjct: 467 PPPPPPPPAPSPPAPPPPPPAPSPPAP-PPPPPPCPPAPPKTRSRHAPP 514 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +2 Query: 707 APXXXAXP-PPPPXPPXPXAGPPXPAAPXXXPP 802 AP A P PP P PP P PP P+ PP Sbjct: 438 APSPPAPPSPPAPSPPAPPPPPPVPSPSGPPPP 470 >UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structural protein; n=3; Oryza sativa|Rep: Putative glycine-rich cell wall structural protein - Oryza sativa subsp. japonica (Rice) Length = 321 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 62.5 bits (145), Expect = 1e-08 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 60.1 bits (139), Expect = 7e-08 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGG GG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 59.3 bits (137), Expect = 1e-07 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G GG GGGG G GGGGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 58.8 bits (136), Expect = 2e-07 Identities = 33/77 (42%), Positives = 33/77 (42%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 78 GVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGG-------GGGGGGGGGGRGGGGGGGGG 130 Query: 618 XXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 131 GGGGGGGGGGGGGGGGG 147 Score = 49.2 bits (112), Expect = 1e-04 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 GG G G GG G GG G GGG G G GG GGGG G G G Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNG 156 Score = 47.6 bits (108), Expect = 4e-04 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG G G GGGGGG G G GGGGG GG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Query: 596 GG 601 GG Sbjct: 145 GG 146 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G G GG G G GGGGG G G GG GGGG G GG G Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG-------GGGGGGGGGGGNGGDDG 153 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGG G Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 44.4 bits (100), Expect = 0.004 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG G G GGGGGG G G GG GG GG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Query: 596 GG 601 GG Sbjct: 142 GG 143 Score = 44.4 bits (100), Expect = 0.004 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 1/60 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGG-PGXXXGGGGGG 625 GG G G GG G GG GGGGG G G G G G G GG GG Sbjct: 112 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGG 171 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G G GGGG G G GGGGG Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G GGGGGG G G GG GG Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXG 493 GGGGGGG G G GGGGGG G Sbjct: 128 GGGGGGGGGGGGGGGGGGGGNGGDDG 153 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G+ G G G GGGG G GGGG G G GGGG Sbjct: 204 GKIKGSNGGSRNVIGGGNKGGGGDGGSDNAQSGDGGGGWESSGGGGGRGDVSGAGGGG 261 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/55 (38%), Positives = 22/55 (40%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 GG G G GG G GGGG + G G GG GGGG G G Sbjct: 218 GGGNKGGGGDGGSDNAQSGDGGGGWESSGGGG-GRGDVSGAGGGGGGGGGDDANG 271 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GGGGG G G GGGGG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 37.1 bits (82), Expect = 0.57 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXX 590 SGGGGGGG GGGGG G G GGGGG Sbjct: 81 SGGGGGGGGGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGRGGGGGGGGGGGGGGG 136 Query: 591 GGGG 602 GGGG Sbjct: 137 GGGG 140 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 406 SXXGGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 S GGGGGGG GGGGG G G GGGG Sbjct: 81 SGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGG G GG G Sbjct: 129 GGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRG 170 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 703 WXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 W GG GGG G GGGGGG G GGG G Sbjct: 77 WGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGG G GGGG G Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGG G G GGGG G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G GGGG G Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GG GGG G GGGG G Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGG G GGGG G Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -2 Query: 771 GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G GG GG G G GG G GGGGGG Sbjct: 218 GGGNKGGGGDGGSDNAQSGDGGGGWESSGGGGGRGDVSGAGGGGGGGGG 266 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG G G GGGG G G GGGGG Sbjct: 223 GGGGDGGSDNAQSGDGGGGWESSGGGGGRGDVSGAGGGGGG 263 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 GGGGGGG GGGGG G G G G A R Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGR 169 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXF 505 GGGGG G G GGGGGG G F Sbjct: 246 GGGGGRGDVSGAGGGGGGGGGDDANGVRQF 275 Score = 33.5 bits (73), Expect = 7.0 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +2 Query: 425 GGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGG 601 G G G G GGGGGG G G GGGGG GGGG Sbjct: 76 GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 62.5 bits (145), Expect = 1e-08 Identities = 33/77 (42%), Positives = 33/77 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P GGG PPPPPP GPPPP PP G PPPPP P Sbjct: 551 PPPAPPVSGGGPP----PPPPPPPPSSGGGPPPPPPPPSSGG-----------PPPPPPP 595 Query: 749 PXPXAGPPXPAAPXXXP 799 P P PA P P Sbjct: 596 PGGMKKPGAPAVPNLPP 612 Score = 54.0 bits (124), Expect = 5e-06 Identities = 26/56 (46%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGG---XXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPP PPPP PP GG P P PPPP PP GPP P P Sbjct: 545 PPPPP-----PPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPP 595 Score = 50.8 bits (116), Expect = 4e-05 Identities = 27/62 (43%), Positives = 27/62 (43%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P GGG PPPPP P P PPPPPP P PPPPP Sbjct: 552 PPAPPVSGGG----------PPPPPPP-------PPPSSGGGPPPPPPPPSSGGPPPPPP 594 Query: 420 PP 415 PP Sbjct: 595 PP 596 Score = 49.6 bits (113), Expect = 1e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP GG P PPPPP PPP PP GG PPG Sbjct: 546 PPPPPPPPAPPVSGG--GPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPG 597 Score = 48.0 bits (109), Expect = 3e-04 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 4/68 (5%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP----XXX 796 P P P PPPP PP P PPPPP PP GPP P P Sbjct: 537 PSSPSLGAPPPPPPPPP------APPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPP 590 Query: 797 PPXXGXGG 820 PP GG Sbjct: 591 PPPPPPGG 598 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P PPPPPP P PPPPPPP Sbjct: 546 PPPPPPPPAPPVSGGGPP----PPPPPPPPSSGGGPPPPPPP 583 Score = 45.2 bits (102), Expect = 0.002 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP PPPPPPP GG P Sbjct: 548 PPPPPPAPPVSGGGPPP-----PPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPGGMKKP 602 Score = 43.6 bits (98), Expect = 0.007 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP P PPPPP PPPP Sbjct: 545 PPPPPPPPPAPPVSGGGPPPPPPPP-----------PPSSGGGPPPPPPPPSSGGPPPPP 593 Query: 421 PPP 413 PPP Sbjct: 594 PPP 596 Score = 43.6 bits (98), Expect = 0.007 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP G P P PPPPP P P Sbjct: 546 PPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPPPPPGGMKKPGAP 605 Query: 421 PPP 413 P Sbjct: 606 AVP 608 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXP---XXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PPPPPP P P PPPPPPP GGG PP Sbjct: 540 PSLGAPPPPPPPPPAPPVSGGGPPPPPPPPPP------SSGGGPPPPP 581 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXXXPP 716 PP A P PPPP P P PPP PP GG PP Sbjct: 532 PPIEAPSSPSLGAPPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPP 583 Score = 36.7 bits (81), Expect = 0.75 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 5/65 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP-----XPXXPXX 436 PPPP GGG PPPPP P P PPPPPP P P Sbjct: 566 PPPPPPSSGGG---------PPPPP---------PPPSSGGPPPPPPPPGGMKKPGAPAV 607 Query: 435 PPPPP 421 P PP Sbjct: 608 PNLPP 612 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 530 PPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PP P P PPP P PPPPPPP Sbjct: 532 PPIEAPSSPSLGAPPPPPPPPPAPPVSGGGPPPPPPPPP 570 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXX-TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP 451 PPPP GGG + PPPPP G K P PP P Sbjct: 568 PPPPSSGGGPPPPPPPPSSGGPPPPPPPPGGMKKPGAPAVPNLPPKKSSVP 618 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 62.1 bits (144), Expect = 2e-08 Identities = 33/83 (39%), Positives = 33/83 (39%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP-----XXXAXPP 733 PPP P G PPPP P PPPP PP P P A PP Sbjct: 896 PPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALPP 955 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P GPP P PP Sbjct: 956 PPPAPPPP--GPPLPFDVAGPPP 976 Score = 57.2 bits (132), Expect = 5e-07 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP--XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPPPPP P PPPP PP P P A PPP P Sbjct: 914 PPPPPLLSEA------PLPPPPPPPPQAALPPPPPPGPPPAPDAALP--PPPPAPPPPGP 965 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P AGPP P A P Sbjct: 966 PLPFDVAGPPPPPARSNVDP 985 Score = 55.2 bits (127), Expect = 2e-06 Identities = 25/59 (42%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-PPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP P PPP G P P + P PPP PP P A P P P P Sbjct: 889 PPPPPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPP 947 Score = 50.0 bits (114), Expect = 8e-05 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 6/76 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG------PPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP PPPPPP P PPPP PP G P P A P Sbjct: 928 PPPPPPQAA---------LPPPPPPGPPPAPDAALPPPPPAPPPPG----PPLPFDVAGP 974 Query: 731 PPPPXPPXPXAGPPXP 778 PPPP PP P Sbjct: 975 PPPPARSNVDPKPPPP 990 Score = 48.0 bits (109), Expect = 3e-04 Identities = 25/74 (33%), Positives = 27/74 (36%), Gaps = 4/74 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP----PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP PPP P P P PPPP PP P P + P Sbjct: 926 PPPPPPPPQAALPPPPPPGPPPAPDAALPPPPPAPPPPGPPLPFDVAGPPPPPARSNVDP 985 Query: 737 PPXPPXPXAGPPXP 778 P PP + P P Sbjct: 986 KPPPPPRKSIPEDP 999 Score = 47.6 bits (108), Expect = 4e-04 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = +2 Query: 641 PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP---XPPXPXAGPPXPAAPXXXPPXXG 811 P P PPPP PP AP PPPPP P P PP P A PP G Sbjct: 885 PDRSPPPPPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPG 944 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP PPPPPPP Sbjct: 892 PPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPP 933 Score = 46.0 bits (104), Expect = 0.001 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP---PXXXXXXXTP 431 PPPP G G PPPP P P PPPP P P Sbjct: 895 PPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALP 954 Query: 430 PPPPPP 413 PPPP P Sbjct: 955 PPPPAP 960 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPPPP P PPPPP PPPPPPP+ Sbjct: 891 PPPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQ 934 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPPP PP PP PPG P Sbjct: 891 PPPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPP 946 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P P PPPPP P Sbjct: 935 AALPPPPPP----GPPPAPDAALPPPPP---APPPPGPPLPFDVAGPPPPPARSNVDPKP 987 Query: 430 PPPP 419 PPPP Sbjct: 988 PPPP 991 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P PPP PP P PPPPP Sbjct: 939 PPPPPGPPPAPDAALPPPPPAPPPPGPPLPFDVAGPPPPP 978 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G P PPP P P PPPPP PPPPP Sbjct: 938 PPPPPPGPPPAPDAALPPPPPAPPPPGP------PLPFDVAGPPPPPARSNVDPKPPPPP 991 Score = 39.9 bits (89), Expect = 0.081 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 9/51 (17%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP----PPPPPXPXXPXXPPP-----PPPP 415 PPPPP P P P PPPPP P P P P PPPP Sbjct: 927 PPPPPPPQAALPPPPPPGPPPAPDAALPPPPPAPPPPGPPLPFDVAGPPPP 977 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 PPPPP P P PPPP L PPPPP Sbjct: 938 PPPPPPGPPPAPDAALPPPPPAPPPPGPPLPFDVAGPPPPP 978 Score = 38.7 bits (86), Expect = 0.19 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXP--PPPPXXXGE---XXKXPXXPXXXXXPPPPPXXXXXXX 437 PPPP G P PPPP E P P PPPPP Sbjct: 891 PPPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPD 950 Query: 436 TPPPPPPP 413 PPPPP Sbjct: 951 AALPPPPP 958 Score = 34.7 bits (76), Expect = 3.0 Identities = 24/93 (25%), Positives = 24/93 (25%), Gaps = 6/93 (6%) Frame = -2 Query: 453 PXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXG 274 P PPPPPPP G PP P G Sbjct: 885 PDRSPPPPPPPPPPQPPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPG 944 Query: 273 XXP------PPPXXXXPPRXPXTPXXPGGPGXP 193 P PPP PP P P GP P Sbjct: 945 PPPAPDAALPPPPPAPPPPGPPLPFDVAGPPPP 977 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P PPP P PP PPPP Sbjct: 890 PPPPPPPPPQPPPSSGSAPGAPPAPPPP 917 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 609 AXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPPPP P PPP PP G P P Sbjct: 882 ASMPDRSPPPPP---PPPPPQPPPSSGSAPGAPPAPPPP 917 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 PPPPP P P PPP P P PPPP Sbjct: 926 PPPPPPPPQAALPPPPPP----GPPPAPDAALPPPPPAPPPP 963 >UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12; Magnoliophyta|Rep: H0211F06-OSIGBa0153M17.6 protein - Oryza sativa (Rice) Length = 1510 Score = 62.1 bits (144), Expect = 2e-08 Identities = 38/95 (40%), Positives = 38/95 (40%), Gaps = 11/95 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXX--------PPPPPPXXXPGPPPPXPPXX--GGXXXPXAPXX 718 PPPPP G GG PPPPP GPP P PP GG P A Sbjct: 1122 PPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGG 1181 Query: 719 XAXPPPPPXPPXPXAGPP-XPAAPXXXPPXXGXGG 820 A PPPPP GPP P AP P GG Sbjct: 1182 VAPPPPPPRGHGGVGGPPTPPGAPTPPMPPGVPGG 1216 Score = 59.3 bits (137), Expect = 1e-07 Identities = 51/164 (31%), Positives = 51/164 (31%), Gaps = 10/164 (6%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG--GGPGXX 646 PP P G G P G G G G PP GG GG P Sbjct: 1082 PPLPPPLPPTLGDYGVAPPPPSIGA-GAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPP 1140 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP 466 G GG PPPP GG GG PPPP P PPP Sbjct: 1141 LPEGIGGV-------PPPPPVGGLGGPPA-------PPPPAGFRGGTPPPNAHGGVAPPP 1186 Query: 465 PPP--------XPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPP P P P PP PP GG G PP Sbjct: 1187 PPPRGHGGVGGPPTPPGAPTPPMPPGVPGGPPPPPGGRGLPAPP 1230 Score = 59.3 bits (137), Expect = 1e-07 Identities = 44/134 (32%), Positives = 44/134 (32%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 APP P G GA P G G G PP G GG P Sbjct: 1098 APPPPSIGA---GAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPV 1154 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 GG GG PPPP GG PPPP G P P PP Sbjct: 1155 GGLGG------PPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPTPP 1208 Query: 462 PPXPXXPXXPPPPP 421 P P P PPPPP Sbjct: 1209 MP-PGVPGGPPPPP 1221 Score = 56.4 bits (130), Expect = 9e-07 Identities = 36/93 (38%), Positives = 36/93 (38%), Gaps = 9/93 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP-------PPPXXXPG--PPPPXPPXXGGXXXPXAPXXX 721 PPPPP G GG PPP PPP G PPPP P GG P P Sbjct: 1149 PPPPPVGGLGGPPAP----PPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTP--- 1201 Query: 722 AXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP PP GPP P P G G Sbjct: 1202 PGAPTPPMPPGVPGGPPPPPGGRGLPAPPGGRG 1234 Score = 55.2 bits (127), Expect = 2e-06 Identities = 35/90 (38%), Positives = 35/90 (38%), Gaps = 7/90 (7%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-PXXGGXXXPXAP--XXXAXPPPPP 742 PPPP G G PPPPPP G PPP P GG P AP PPP Sbjct: 1099 PPPPSIGAGAP-------PPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPP 1151 Query: 743 XPPXPXAGPPXPAAP----XXXPPXXGXGG 820 P GPP P P PP GG Sbjct: 1152 PPVGGLGGPPAPPPPAGFRGGTPPPNAHGG 1181 Score = 53.6 bits (123), Expect = 6e-06 Identities = 43/140 (30%), Positives = 43/140 (30%), Gaps = 4/140 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX----PPPPPPXPXXPXXP 433 PPPP G G PPPPP G P P PP PP P Sbjct: 1099 PPPPSIGAGA----------PPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGV 1148 Query: 432 PPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPX 253 PPPPP G GG PP F P P G PP Sbjct: 1149 PPPPP--------VGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPT 1200 Query: 252 XXXPPRXPXTPXXPGGPGXP 193 P P P PGGP P Sbjct: 1201 PPGAPTPPMPPGVPGGPPPP 1220 Score = 48.8 bits (111), Expect = 2e-04 Identities = 40/150 (26%), Positives = 40/150 (26%), Gaps = 14/150 (9%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPP P G P P PPPP P PPP Sbjct: 1065 PPPPQRENTSVGIQGGIPPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPP 1124 Query: 420 PPXXXXXXXXG-------XGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPP 262 PP G GG PP L P G P Sbjct: 1125 PPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAP 1184 Query: 261 PP-------XXXXPPRXPXTPXXPGGPGXP 193 PP PP P P P PG P Sbjct: 1185 PPPPPRGHGGVGGPPTPPGAPTPPMPPGVP 1214 Score = 42.7 bits (96), Expect = 0.011 Identities = 41/129 (31%), Positives = 41/129 (31%), Gaps = 12/129 (9%) Frame = +2 Query: 362 GXXXPPPPXPXXXXXXFX-----GGGGGGGXXGXXGXGGGGGGXXXXX---GXGXFXXFP 517 G PPPP P GG GG G GG G G P Sbjct: 1105 GAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPP 1164 Query: 518 XXXG--GGGGXXXVXXXXXPPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGPPPPXPPXX 685 G GG PPPPP G G G P PP P PG PPP P Sbjct: 1165 PPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPTPPMPPGVPGGPPPPP--- 1221 Query: 686 GGXXXPXAP 712 GG P P Sbjct: 1222 GGRGLPAPP 1230 Score = 41.9 bits (94), Expect = 0.020 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGG-GXXCXXXXXPPPPPPXXXP-GPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP G PPP PP G PP P G P P PPP Sbjct: 1065 PPPPQRENTSVGIQGGIPPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPP 1124 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P G P AP P G GG Sbjct: 1125 PPIGGLGGHQAPPAP---PLPEGIGG 1147 Score = 39.5 bits (88), Expect = 0.11 Identities = 32/99 (32%), Positives = 33/99 (33%) Frame = +3 Query: 423 GGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGG 602 G GGV GG GG GF +P GG PPPP G GG Sbjct: 1144 GIGGVPPPPPV-GGLGGPPAPPPPAGFRGGTPPPNAHGG--------VAPPPPPPRGHGG 1194 Query: 603 XXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PP P P P PP G PPG Sbjct: 1195 VGG--PPTPPGAPTPPMPPGVPGGPPPPPGGRGLPAPPG 1231 Score = 35.9 bits (79), Expect = 1.3 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 4/71 (5%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXP----XXXXXPPPPPXX 452 G PPPP G PPPPP G P P PP PP Sbjct: 1093 GDYGVAPPPPSIGAGA----------PPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLP 1142 Query: 451 XXXXXTPPPPP 419 PPPPP Sbjct: 1143 EGIGGVPPPPP 1153 >UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG21491; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG21491 - Caenorhabditis briggsae Length = 429 Score = 62.1 bits (144), Expect = 2e-08 Identities = 34/85 (40%), Positives = 36/85 (42%), Gaps = 2/85 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP--GPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPP P G PPPPPP P G PPP PP GG P AP + PP P Sbjct: 304 PPPRPSGAPGS--------PPPPPPSGAPPTGSPPPPPPQSGGSPPPGAPPSGSPPPRPS 355 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXG 817 P P G P +P P G G Sbjct: 356 GAP-PAGGSPPTGSPPPPSPQGGAG 379 Score = 58.0 bits (134), Expect = 3e-07 Identities = 43/165 (26%), Positives = 45/165 (27%), Gaps = 11/165 (6%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGX---------GGXGGGGGXAXXXGAXGXXXPPXXGGXG 667 P P G G+ G P G G G GA G PP G Sbjct: 265 PEGPGGRGPRTGSPPTGSPPTGRPMREKRQAPGAPPTGSPPPRPSGAPGSPPPPPPSGAP 324 Query: 666 --GGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPX 493 G P GG PPP G PPPP G + Sbjct: 325 PTGSPPPPPPQSGGSPPPGAPPSGSPPPRPSGAPPAGGSPPTGSPPPPSPQGGAGPRGKR 384 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPPP P PP PPP G PP Sbjct: 385 QVSGVQPPPPPPGGAPPTGSPPSPPPSGAPVRGKRQAGSPPPPPP 429 Score = 53.2 bits (122), Expect = 8e-06 Identities = 34/90 (37%), Positives = 34/90 (37%), Gaps = 5/90 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPX-APXXXAXPP---P 736 PPPPP G PPPPPP PPP PP P AP PP P Sbjct: 315 PPPPPPSGA-----PPTGSPPPPPPQSGGSPPPGAPPSGSPPPRPSGAPPAGGSPPTGSP 369 Query: 737 PPXPPXPXAGPPXP-AAPXXXPPXXGXGGA 823 PP P AGP PP GGA Sbjct: 370 PPPSPQGGAGPRGKRQVSGVQPPPPPPGGA 399 Score = 50.8 bits (116), Expect = 4e-05 Identities = 30/90 (33%), Positives = 30/90 (33%), Gaps = 9/90 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP---------GPPPPXPPXXGGXXXPXAPXXX 721 PPPPP GG PPP P P PPPP P G Sbjct: 330 PPPPPQSGGSPPPGAPPSGSPPPRPSGAPPAGGSPPTGSPPPPSPQGGAGPRGKRQVSGV 389 Query: 722 AXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPPPP P PP P P P G Sbjct: 390 QPPPPPPGGAPPTGSPPSP--PPSGAPVRG 417 Score = 45.6 bits (103), Expect = 0.002 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = +2 Query: 569 PPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP P G G G PPPPPP P PP PP G P A PPP Sbjct: 370 PPPSPQGGAGPRGKRQVSGVQPPPPPPGGAPPTGSPPSPPPSGA---PVRGKRQAGSPPP 426 Query: 740 PXP 748 P P Sbjct: 427 PPP 429 Score = 43.6 bits (98), Expect = 0.007 Identities = 26/83 (31%), Positives = 26/83 (31%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPX 754 PP G P PP G PPP P G P P PP PP Sbjct: 278 PPTGSPPTGRPMREKRQAPGAPPT---GSPPPRPSGAPGSPPPPPPSGAPPTGSPPPPPP 334 Query: 755 PXAGPPXPAAPXXXPPXXGXGGA 823 G P P AP P GA Sbjct: 335 QSGGSPPPGAPPSGSPPPRPSGA 357 Score = 40.3 bits (90), Expect = 0.061 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 3/80 (3%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG---GGG 628 G GA G GG G G G G PP GG G GG G GG GG Sbjct: 40 GGVSGAPGFGGQTGSPPPFGFSGAPGGFGGQNGGSPPPNFGGNGQGGFGGNQGGNQNGGF 99 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G P G GG Sbjct: 100 GGQQNGGFSGAPQQGGNQGG 119 Score = 39.9 bits (89), Expect = 0.081 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 9/79 (11%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXX---PPPPPP------XXXPXPPP 668 P G P PPPP GG G PPPPPP P PPP Sbjct: 351 PPRPSGAPPAGGSPPTGSPPPPSPQGGAGPRGKRQVSGVQPPPPPPGGAPPTGSPPSPPP 410 Query: 669 XXPPXXGGXXXXXXPPGXP 725 P G PP P Sbjct: 411 SGAPVRGKRQAGSPPPPPP 429 Score = 39.5 bits (88), Expect = 0.11 Identities = 25/86 (29%), Positives = 25/86 (29%) Frame = -2 Query: 675 GXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXP 496 G GGP G G PP G GG PP K Sbjct: 235 GRRHGGPPHGNHKGPRGTGSPPTGSPPTGRPEGPGGRGPRTGSPPTGSPPTGRPMREKRQ 294 Query: 495 XPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPP P PPPPPP Sbjct: 295 APGAPPTGSPPPRPSGAPGSPPPPPP 320 Score = 39.1 bits (87), Expect = 0.14 Identities = 33/125 (26%), Positives = 36/125 (28%), Gaps = 3/125 (2%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGG---PG 652 +PP P G + P G G + PP G G P Sbjct: 314 SPPPPPPSGAPPTGSPPPPPPQSGGSPPPGAPPSGSPPPRPSGAPPAGGSPPTGSPPPPS 373 Query: 651 XXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP 472 G G G PPPP GG T P PPP K P Sbjct: 374 PQGGAGPRGKRQVSGVQPPPPPPGGA-----PPTGSPPSPPPSGAPVRGK----RQAGSP 424 Query: 471 PPPPP 457 PPPPP Sbjct: 425 PPPPP 429 Score = 38.3 bits (85), Expect = 0.25 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP--XPPPXXPPXXGGXXXXXXPP-GXP 725 P PPP G P PPPPPP P PP PP GG PP G P Sbjct: 299 PPTGSPPPRPSGA-------PGSPPPPPPSGAPPTGSPPPPPPQSGGSPPPGAPPSGSP 350 Score = 36.3 bits (80), Expect = 1.00 Identities = 23/82 (28%), Positives = 24/82 (29%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PP G GG P PP P P PP P PPP Sbjct: 260 PPTGRPEGPGGRGPRTGSPPTGSPPTGRPMREKRQAPGAPPTGSPPPRPSGAPGSPPPPP 319 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 P P + PP P PP Sbjct: 320 PSGAPPTGSPPPPPPQSGGSPP 341 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPX 754 PPP G PPPP G P G P P A P P P Sbjct: 350 PPPRPSGAPPAGGSPPTGSPPPPSPQGGAGPRGKRQVSGVQPPPPPPGGAPPTGSPPSPP 409 Query: 755 PXAGPPXPAAPXXXPP 802 P P PP Sbjct: 410 PSGAPVRGKRQAGSPP 425 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP GG PP PP P P P P GG PP Sbjct: 325 PTGSPPPPPPQSGGS-------PPPGAPPSGSPPPRPSGAPPAGGSPPTGSPP 370 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 62.1 bits (144), Expect = 2e-08 Identities = 36/89 (40%), Positives = 36/89 (40%) Frame = +2 Query: 536 GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPX 715 GG PPPPP G PPPPPP PG PP PP GG P AP Sbjct: 659 GGAPAAPGLVPPPPPPPGG----------VPPPPPP---PGGVPPPPPPPGGVPPPPAPP 705 Query: 716 XXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP P PP A PP P P P Sbjct: 706 GVPAPPGVPAPPGAPA-PPAPGLPKKPSP 733 Score = 58.4 bits (135), Expect = 2e-07 Identities = 30/72 (41%), Positives = 30/72 (41%) Frame = +2 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPX 775 GG PPPPPP G PPP PP G P P PP PP P P P Sbjct: 659 GGAPAAPGLVPPPPPPPG--GVPPPPPPPGGVPPPPPPPGGVPPPPAPPGVPAPPGVPAP 716 Query: 776 PAAPXXXPPXXG 811 P AP PP G Sbjct: 717 PGAP--APPAPG 726 Score = 57.6 bits (133), Expect = 4e-07 Identities = 27/68 (39%), Positives = 27/68 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPPP PPPP PP AP PP P P Sbjct: 669 PPPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPPPAPPGVPAPPGVPAPPGAPAPPAPGLP 728 Query: 749 PXPXAGPP 772 P PP Sbjct: 729 KKPSPAPP 736 Score = 49.6 bits (113), Expect = 1e-04 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPPP GG P PPPPP PPP PP PPG Sbjct: 659 GGAPAAPGLVPPPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPPPAPPGVPAPPGVPAPPG 718 Query: 720 XP 725 P Sbjct: 719 AP 720 Score = 47.6 bits (108), Expect = 4e-04 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -2 Query: 630 GGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP 451 GG PPPP GG PPPPP G P P PP PP P Sbjct: 659 GGAPAAPGLVPPPPPPPGG----------VPPPPPPPGGVPPPPPPPGGVPPPPAPPGVP 708 Query: 450 XXPXXPPPPPPP 415 P P PP P Sbjct: 709 APPGVPAPPGAP 720 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP G P P PPPPP PPPP PP Sbjct: 669 PPPPPPPGGVPPPPPPPGGVPPPPPPP-----GGVPPPPAPP 705 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +2 Query: 701 PXAPXXXAXPPPPPX-----PPXPXAGPPXPAAPXXXPPXXGXGG 820 P AP PPPPP PP P PP P P PP G Sbjct: 662 PAAPGLVPPPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPPPAPPG 706 Score = 35.5 bits (78), Expect = 1.7 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = -1 Query: 640 GGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP 461 GG G PPPP GG PPPP G P P PP P Sbjct: 659 GGAPAAPGLVPPPPPPP-----GGV---------PPPPPPPGGVPPPPPPPGGVPPPPAP 704 Query: 460 PXXXXXXXTPPPPPPP 413 P P PP P Sbjct: 705 PGVPAPPGVPAPPGAP 720 Score = 34.3 bits (75), Expect(2) = 7e-04 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGG 379 PPPPP P PPPPPPP GG Sbjct: 669 PPPPPPPGG--VPPPPPPPGGVPPPPPPPGG 697 Score = 31.9 bits (69), Expect(2) = 7e-04 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 294 PGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P G PPPP P P P PG P P Sbjct: 690 PPPPPPGGVPPPPAPPGVPAPPGVPAPPGAPAPP 723 >UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 664 Score = 62.1 bits (144), Expect = 2e-08 Identities = 34/79 (43%), Positives = 35/79 (44%), Gaps = 6/79 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-----PPPXPPXXGGXXXPXAP-XXXAXP 730 PPPPP PPPPPP PGP PPP PP G AP A P Sbjct: 487 PPPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPPG----AAPSFGSAAP 542 Query: 731 PPPPXPPXPXAGPPXPAAP 787 PPPP PP +G P P P Sbjct: 543 PPPPGPPPAMSGGPPPPPP 561 Score = 58.0 bits (134), Expect = 3e-07 Identities = 34/92 (36%), Positives = 34/92 (36%), Gaps = 9/92 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX-------PG--PPPPXPPXXGGXXXPXAPXXX 721 PPPPP PPPPPP PG PPPP PP G P A Sbjct: 466 PPPPPAAASPAAAQSSYTPPPPPPPPASSRPVPGVPGGVPPPPPPPPPG--PGPAAAGGP 523 Query: 722 AXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPPPP P G P P PP G Sbjct: 524 PPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGG 555 Score = 57.6 bits (133), Expect = 4e-07 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 6/79 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG------PPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP G G PPPPPP P PPPP PP P P Sbjct: 507 PPPPPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPP----------PAMSGGP 556 Query: 731 PPPPXPPXPXAGPPXPAAP 787 PPPP PP P P P Sbjct: 557 PPPPPPPGDFGVTPGPPPP 575 Score = 57.2 bits (132), Expect = 5e-07 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 12/85 (14%) Frame = +2 Query: 569 PPPPPXXGG--GGXXCXXXXXPPPPPPXXXPG-------PPPPXPPXXGGXXXPXAPXXX 721 PPPPP PPPPP P PPPP PP P P Sbjct: 445 PPPPPSRSAIPPPAAAPTAYTPPPPPAAASPAAAQSSYTPPPPPPPPASSRPVPGVPGGV 504 Query: 722 AXPPPPPXP-PXPXA--GPPXPAAP 787 PPPPP P P P A GPP P P Sbjct: 505 PPPPPPPPPGPGPAAAGGPPPPPPP 529 Score = 54.0 bits (124), Expect = 5e-06 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 8/92 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP--PPPXPPXXGGXXXPXAPXXXAXPPPPP 742 P PPP G PPPPPP P PP PP P A PPPPP Sbjct: 411 PAPPPSLPARGGTPAAGGPPPPPPPRDGATPLSRPPPPPSRSAIPPPAAAPTAYTPPPPP 470 Query: 743 XPPXPXAG------PPXPAAPXXXPPXXGXGG 820 P A PP P P P G G Sbjct: 471 AAASPAAAQSSYTPPPPPPPPASSRPVPGVPG 502 Score = 53.6 bits (123), Expect = 6e-06 Identities = 46/168 (27%), Positives = 46/168 (27%), Gaps = 5/168 (2%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G P GG PPPP G PPPPP Sbjct: 402 PPELPGRAVPAPPPSLPARGGTPAAGGPPPPPPPRDGA-------TPLSRPPPPPSRSAI 454 Query: 510 XXKXPXPXXXXXPPPP----PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFL 343 P PPPP P PPPPPPP G GG PP Sbjct: 455 PPPAAAPTAYTPPPPPAAASPAAAQSSYTPPPPPPPPASSRPVPGVPGGVPPPPPPPPPG 514 Query: 342 XXXXXXXXXXXXXXPXPG-XXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 P PG G PPP PP P P P Sbjct: 515 PGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPPP 562 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/90 (32%), Positives = 30/90 (33%), Gaps = 5/90 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP-----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G PP PPP PP PP + PP Sbjct: 429 PPPPPPPRDGATPLSRPPPPPSRSAIPPPAAAPTAYTPPPPPAAASPAAAQSSYTPPPPP 488 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PPP P G P P PP G G A Sbjct: 489 PPPASSRPVPGVPGGVPPPPPPPPPGPGPA 518 Score = 48.8 bits (111), Expect = 2e-04 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP-PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP G PPP PPP GPPPP PP P P PP Sbjct: 525 PPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPPP----------PGDFGVTPGPPP 574 Query: 746 PPXPXAG 766 PP AG Sbjct: 575 PPTGDAG 581 Score = 48.0 bits (109), Expect = 3e-04 Identities = 31/91 (34%), Positives = 31/91 (34%) Frame = -2 Query: 687 PXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXX 508 P G GG P G G PPPP G PPPPP Sbjct: 496 PVPGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAA---PPPPPG----- 547 Query: 507 XKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P PPPPPP P P PPPP Sbjct: 548 ---PPPAMSGGPPPPPPPPGDFGVTPGPPPP 575 Score = 46.4 bits (105), Expect = 0.001 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT- 434 A PPPP PPPPP P P PPPPP Sbjct: 463 AYTPPPPP--AAASPAAAQSSYTPPPPPPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAA 520 Query: 433 --PPPPPPP 413 PPPPPPP Sbjct: 521 GGPPPPPPP 529 Score = 46.0 bits (104), Expect = 0.001 Identities = 25/73 (34%), Positives = 26/73 (35%), Gaps = 2/73 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG--XXXPXAPXXXAXPPPPPX 745 PPPP G P GPPPP PP G P P + PPP Sbjct: 400 PPPPELPGRAVPAPPPSLPARGGTPAAGGPPPPPPPRDGATPLSRPPPPPSRSAIPPPAA 459 Query: 746 PPXPXAGPPXPAA 784 P PP PAA Sbjct: 460 APTAYTPPPPPAA 472 Score = 43.6 bits (98), Expect = 0.007 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 8/62 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP------XPPPXXPP--XXGGXXXXXXP 713 P PPPP G G A P PPPPPP P PPP PP GG P Sbjct: 506 PPPPPPPP---GPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPPP 562 Query: 714 PG 719 PG Sbjct: 563 PG 564 Score = 42.7 bits (96), Expect = 0.011 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGX 695 P G G P PPPP G A P PP PPP PPP PP G Sbjct: 510 PPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPP--PPGPPPAMSGGPPP-PPPPPGDF 566 Query: 696 XXXXXPPGXP 725 PP P Sbjct: 567 GVTPGPPPPP 576 Score = 42.3 bits (95), Expect = 0.015 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 8/85 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP-----GPPPPXPPXXGGXXXP---XAPXXXA 724 PPPPP PPPPP P P P P P AP Sbjct: 281 PPPPPAAAAESTQNNDRRAAPPPPPASAPPSYSSTPEPDLPATPAAPSDPPAAVAPPRRF 340 Query: 725 XPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPP AG P PAA P Sbjct: 341 NVPPPPSFMGKNAGAPPPAATPASP 365 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGX 695 P G G P PPPP A P P PPP PPP PP G Sbjct: 509 PPPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPPPPGDFGV 568 Query: 696 XXXXXPP 716 PP Sbjct: 569 TPGPPPP 575 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP G P PPPPP + PP Sbjct: 488 PPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPPP----PPPPPPGAAPSFGSAAPP 543 Query: 421 PPP 413 PPP Sbjct: 544 PPP 546 Score = 41.9 bits (94), Expect = 0.020 Identities = 29/93 (31%), Positives = 29/93 (31%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGE 512 P GG G G G PPPP G PPPPP Sbjct: 498 PGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPP------GAAPSFGSAAPPPPP----- 546 Query: 511 XXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPPPP TP PPPPP Sbjct: 547 ---GPPPAMSGGPPPPPPPPGDFGVTPGPPPPP 576 Score = 41.5 bits (93), Expect = 0.026 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 9/65 (13%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP----XPPPXXPPXXG-----GXXXXXX 710 P PPP G P PPPPPP P PPP PP G G Sbjct: 485 PPPPPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPPGAAPSFGSAAPPP 544 Query: 711 PPGXP 725 PPG P Sbjct: 545 PPGPP 549 Score = 39.9 bits (89), Expect = 0.081 Identities = 23/67 (34%), Positives = 23/67 (34%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPP GG G PPPPP P P PPP Sbjct: 407 GRAVPAPPPSLPARGGTPAAGGPP--PPPPPRDGATPLSRP-PPPPSRSAIPPPAAAPTA 463 Query: 439 XTPPPPP 419 TPPPPP Sbjct: 464 YTPPPPP 470 Score = 39.5 bits (88), Expect = 0.11 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP--PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP P G PPPP P PPP P GG P PPPP Sbjct: 380 PPSLPSRGSPAPPALPGRSVPPPPELPGRAVPAPPPSLPARGGTPAAGGPPP---PPPPR 436 Query: 743 XPPXPXAGPPXPAA-PXXXPP 802 P + PP P + PP Sbjct: 437 DGATPLSRPPPPPSRSAIPPP 457 Score = 35.5 bits (78), Expect = 1.7 Identities = 30/97 (30%), Positives = 30/97 (30%), Gaps = 13/97 (13%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPP-----PXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPP 733 PPPP G P P P PG PP P G P P PP Sbjct: 343 PPPPSFMGKNAGAPPPAATPASPTAAAAPPALPGRSLPPSLPSRGSPAPPALPGRSVPPP 402 Query: 734 P-------PPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P P PP A PAA PP GA Sbjct: 403 PELPGRAVPAPPPSLPARGGTPAAGGPPPPPPPRDGA 439 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPP PP A PPPP P + P P P Sbjct: 279 PPPPPPPAAAAESTQNNDRRAAPPPPPASAPPSYSSTPEPDLP 321 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 12/68 (17%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP------------PXXXPXPPPXXPPXXGGXXX 701 P PPP A PPPPP P P PPP PP G Sbjct: 461 PTAYTPPPPPAAASPAAAQSSYTPPPPPPPPASSRPVPGVPGGVPPPPPPPPPGPGPAAA 520 Query: 702 XXXPPGXP 725 PP P Sbjct: 521 GGPPPPPP 528 >UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, inverted; n=1; Gallus gallus|Rep: PREDICTED: similar to formin, inverted - Gallus gallus Length = 1208 Score = 61.7 bits (143), Expect = 2e-08 Identities = 36/90 (40%), Positives = 37/90 (41%), Gaps = 6/90 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA-PXXXAXPPPPPX 745 PPPPP G GG PPPP P PPPP P GG P P PPPPP Sbjct: 394 PPPPPLPGMGGIP------PPPPLPGMGGIPPPPPLPGLGGIPPPPPLPGLAGIPPPPPL 447 Query: 746 PPXPXAGPPXPAA-----PXXXPPXXGXGG 820 P PP P + P PP G G Sbjct: 448 PGMGGIPPPPPLSGMGGIPPPPPPLPGMAG 477 Score = 57.6 bits (133), Expect = 4e-07 Identities = 35/90 (38%), Positives = 35/90 (38%), Gaps = 6/90 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX--PGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G PPPP P P PPPP P G P P PPPPP Sbjct: 369 PPPPPLPG------MAVIPPPPPLPGMAVIPPPPPPLPGMGGIPPPPPLPGMGGIPPPPP 422 Query: 743 XPPXPXAGPPXP----AAPXXXPPXXGXGG 820 P PP P A PP G GG Sbjct: 423 LPGLGGIPPPPPLPGLAGIPPPPPLPGMGG 452 Score = 50.8 bits (116), Expect = 4e-05 Identities = 38/118 (32%), Positives = 39/118 (33%), Gaps = 4/118 (3%) Frame = -2 Query: 540 PPPPPXXXGXXX---KXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGX 370 PPPPP G P P PPPPPP P PPPPP P G GG Sbjct: 368 PPPPPPLPGMAVIPPPPPLPGMAVIPPPPPPLPGMGGIPPPPPLP--------GMGGIPP 419 Query: 369 XXP-PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPG 199 P P + P P G PPPP P P PG G Sbjct: 420 PPPLPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIPPPPPLSGMGGIPPPPPPLPGMAG 477 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 5/68 (7%) Frame = -1 Query: 601 PPPPXXXGGGGXXX-----GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXX 437 PPPP G GG G PPPP P P PPPPP Sbjct: 406 PPPPPLPGMGGIPPPPPLPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIPPPPPLSGMGGI 465 Query: 436 TPPPPPPP 413 PPPPP P Sbjct: 466 PPPPPPLP 473 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G GG PPPP G P P PPPPP Sbjct: 388 GMAVIPPPPPPLPGMGGIP-------PPPPLPGMGGIPPPPPLPGLGGIPPPPPLPGLAG 440 Query: 439 XTPPPPPP 416 PPPP P Sbjct: 441 IPPPPPLP 448 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 5/67 (7%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP-----XXXP 799 PP P PPPP P P P PPPPP P PP P P P Sbjct: 362 PPLPGIPPPPPPLPGMAVIPPPPPLPGMAVIPPPPPPLPGMGGIPPPPPLPGMGGIPPPP 421 Query: 800 PXXGXGG 820 P G GG Sbjct: 422 PLPGLGG 428 Score = 43.2 bits (97), Expect = 0.009 Identities = 32/103 (31%), Positives = 32/103 (31%), Gaps = 3/103 (2%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXG---XGGGGXXXPPXFFFLXXXXXXX 322 P PPPPPP P PPPPP P G GG PP Sbjct: 362 PPLPGIPPPPPPLPGMAVIPPPPPLPGMAVIPPPPPPLPGMGGIPPPPPL---------- 411 Query: 321 XXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P G PPPP P P PG G P Sbjct: 412 PGMGGIPPPPPLPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIP 454 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 529 PXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P G P P PPPPP PPPPP P Sbjct: 362 PPLPGIPPPPPPLPGMAVIPPPPPLPGMAVIPPPPPPLP 400 >UniRef50_A5H447 Cluster: Zyxin; n=5; Euteleostomi|Rep: Zyxin - Xenopus laevis (African clawed frog) Length = 663 Score = 61.7 bits (143), Expect = 2e-08 Identities = 35/86 (40%), Positives = 36/86 (41%), Gaps = 9/86 (10%) Frame = +2 Query: 569 PPPPPXXG--GGGXXCXXXXXPPPPPPXXXPGPPP-----PXPPXXGGXXXPXA--PXXX 721 PPPPP G G G PPPPP P PPP P PP P Sbjct: 103 PPPPPSFGDEGLGSPSGGSFPPPPPPEFSEPFPPPIEEFFPSPPPLEECVSDTQDLPVPV 162 Query: 722 AXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP P P A PP P+AP P Sbjct: 163 PPPPPPPLPSPPAAPPPKPSAPCEAP 188 Score = 42.3 bits (95), Expect = 0.015 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 7/70 (10%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT---- 434 PPPP G G PPPPP E P P PPP T Sbjct: 103 PPPPPSFGDEGLGSPSGGSFPPPPPPEFSEPF---PPPIEEFFPSPPPLEECVSDTQDLP 159 Query: 433 ---PPPPPPP 413 PPPPPPP Sbjct: 160 VPVPPPPPPP 169 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP P PPPPPP P P PPP P Sbjct: 123 PPPPPPEFSEPFPPPIEEFFPSPPPLEECVSDTQDLPVPVP-PPPPPPLPSPPAAPPPKP 181 Score = 41.1 bits (92), Expect = 0.035 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 1/78 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP PPPPPP P PP P AP PPP P Sbjct: 145 PPPLEECVSDTQDLPVPVPPPPPPPLPSPPAAPPPKPSAPCEAPKPAPVFPKSSPPPAFP 204 Query: 749 -PXPXAGPPXPAAPXXXP 799 P P + P A+ P Sbjct: 205 KPEPPSVAPKAASSIFIP 222 Score = 37.5 bits (83), Expect = 0.43 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPPP---PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 PPPPP PP P PP G +P + PPPPP P PP Sbjct: 86 PPPPPSEESISPPSSSFPPPPPSFGDEGLGSPSGGSFPPPPP-PEFSEPFPPPIEEFFPS 144 Query: 797 PP 802 PP Sbjct: 145 PP 146 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 P PPP P P PPPPP PP P P Sbjct: 143 PSPPPLEECVSDTQDLPVPVPPPPPPPLPSPPAAPPPKPSAP 184 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P P P P PPP P Sbjct: 163 PPPPPPPLPSPPAAPPPKPSAPCEAPKPAPVFPKSSPPPAFP 204 >UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; Leishmania|Rep: Putative uncharacterized protein - Leishmania braziliensis Length = 814 Score = 61.7 bits (143), Expect = 2e-08 Identities = 35/90 (38%), Positives = 36/90 (40%), Gaps = 8/90 (8%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPPP- 742 PPPP PPPPP P PPP PP P P + PPPPP Sbjct: 353 PPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASVPPPPPA 412 Query: 743 --XPPXPXAG---PPXPAAPXXXPPXXGXG 817 PP P A PP PAA PP G G Sbjct: 413 ASVPPPPPAASVPPPPPAASLPPPPPAGAG 442 Score = 57.6 bits (133), Expect = 4e-07 Identities = 33/85 (38%), Positives = 34/85 (40%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPPP- 742 PPPP PPPPP P PPP PP P P + PPPPP Sbjct: 344 PPPPPAASLPPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASLPPPPPAASVPPPPPA 403 Query: 743 --XPPXPXAG---PPXPAAPXXXPP 802 PP P A PP PAA PP Sbjct: 404 ASVPPPPPAASVPPPPPAASVPPPP 428 Score = 50.8 bits (116), Expect = 4e-05 Identities = 31/87 (35%), Positives = 32/87 (36%), Gaps = 9/87 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX---PPXXGGXXXPXAPXXXAXPPPP 739 P P G P PPP PPPP PP P P + PPPP Sbjct: 315 PAPATAPGPAKYTAAVASPPSTPPPAASVPPPPPAASLPPPPPAASVPPPPPAASLPPPP 374 Query: 740 P---XPPXPXAG---PPXPAAPXXXPP 802 P PP P A PP PAA PP Sbjct: 375 PAASVPPPPPAASLPPPPPAASVPPPP 401 Score = 47.6 bits (108), Expect = 4e-04 Identities = 24/69 (34%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPPPX 745 PPPP PPPPP P PPP PP P P + PPPPP Sbjct: 380 PPPPPAASLPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASLPPPPPA 439 Query: 746 PPXPXAGPP 772 P P Sbjct: 440 GAGPLVRSP 448 Score = 45.2 bits (102), Expect = 0.002 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPPPX 745 PPPP PPPPP P PPP PP P P A PPPP Sbjct: 371 PPPPPAASVPPPPPAASLPPPPPAASVPPPPPAASVPPPPPAASVPPPPPA-ASVPPPPP 429 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP A P P Sbjct: 430 AASLPPPPPAGAGPLVRSP 448 Score = 41.1 bits (92), Expect = 0.035 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 4/85 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP--- 430 PPPP PPPPP P P PPPPP P PP Sbjct: 371 PPPPP--AASVPPPPPAASLPPPPPAA-----SVPPPPPAASVPPPPPAASVPPPPPAAS 423 Query: 429 -PPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPP G G P Sbjct: 424 VPPPPPAASLPPPPPAGAGPLVRSP 448 Score = 40.7 bits (91), Expect = 0.046 Identities = 30/92 (32%), Positives = 32/92 (34%), Gaps = 15/92 (16%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-----PPXXX---PGPPP----PXPPXXGGXXXPXAP 712 PPPPP PPPP PP P PPP P PP G +P Sbjct: 389 PPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASVPPPPPAASLPPPPPAGAGPLVRSP 448 Query: 713 XXXAXPPPP---PXPPXPXAGPPXPAAPXXXP 799 PPP P P AGPP + P Sbjct: 449 LLVVAPPPSASVPATPPVAAGPPLTSGSTTAP 480 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP--- 430 PPPP PPPPP P P PPPPP P PP Sbjct: 344 PPPPP--AASLPPPPPAASVPPPPPAA-----SLPPPPPAASVPPPPPAASLPPPPPAAS 396 Query: 429 -PPPPP 415 PPPPP Sbjct: 397 VPPPPP 402 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = -2 Query: 531 PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP----PPPPP 415 PP P P PPPPP P PP PPPPP Sbjct: 333 PPSTPPPAASVPPPPPAASLPPPPPAASVPPPPPAASLPPPPP 375 Score = 34.3 bits (75), Expect = 4.0 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PPPPP P P PPPPP P Sbjct: 341 ASVPPPPP--AASLPPPPPAASVPPPPPAA-----SLPPPPPAASVPPPPPAASLPPPPP 393 Query: 430 P---PPPPP 413 PPPPP Sbjct: 394 AASVPPPPP 402 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 61.7 bits (143), Expect = 2e-08 Identities = 31/77 (40%), Positives = 31/77 (40%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP P PPPP P P P PPPPP P Sbjct: 83 PPPPQSPPA--PTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPP----PPPPPPAPT 136 Query: 752 XPXAGPPXPAAPXXXPP 802 A PP P P PP Sbjct: 137 TSKAAPPPPPPPPPPPP 153 Score = 58.4 bits (135), Expect = 2e-07 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 11/89 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-----------PPPXPPXXGGXXXPXAPX 715 PPPP PPPPPP P P PPP PP A Sbjct: 83 PPPPQSPPAPTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAP 142 Query: 716 XXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP PP P A P AP PP Sbjct: 143 PPPPPPPPPPPPAPPAPKPSKPAPPPQPP 171 Score = 50.4 bits (115), Expect = 6e-05 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP K P PPPPPP P P P P Sbjct: 107 PPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAP 166 Query: 420 PP 415 PP Sbjct: 167 PP 168 Score = 50.0 bits (114), Expect = 8e-05 Identities = 27/71 (38%), Positives = 28/71 (39%), Gaps = 4/71 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP----XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP PPPPPP PPPP PP P AP + P P Sbjct: 108 PPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAP-KPSKPAP 166 Query: 737 PPXPPXPXAGP 769 PP PP P Sbjct: 167 PPQPPTELPDP 177 Score = 49.2 bits (112), Expect = 1e-04 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA--GPPXPAAPXXXP 799 PPP P PPPP P P PPPPP PP P P P P P Sbjct: 72 PPPVPTTMYKAPPPPQSPPAPTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPP 131 Query: 800 P 802 P Sbjct: 132 P 132 Score = 47.6 bits (108), Expect = 4e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPP P P P PPP Sbjct: 109 PPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPP 168 Query: 420 PP 415 P Sbjct: 169 QP 170 Score = 46.4 bits (105), Expect = 0.001 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = -2 Query: 540 PPP--PPXXXGXXXKXPXPXXXXXPPPPPPXPXX---PXXPPPPPPP 415 PPP PP P P PPPPPP P P PPPPPPP Sbjct: 84 PPPQSPPAPTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPP 130 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PPP PP P PPP Sbjct: 110 PPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPPPQ 169 Query: 420 PP 415 PP Sbjct: 170 PP 171 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP + P P PPPP PPPPPPP Sbjct: 107 PPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPP 149 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXN--PPPPPPP 414 PPPPP P P PPPPP PPPPPPP Sbjct: 105 PPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPP 148 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX--PPPPPXXXXXXXTPP 428 PPP PPPPP P PPPPP PP Sbjct: 84 PPPQSPPAPTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPP 143 Query: 427 PPPPP 413 PPPPP Sbjct: 144 PPPPP 148 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP P PPPPPP P P P P Sbjct: 125 PPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKP 164 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP A P PPPPPP P P P Sbjct: 124 PPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKP 164 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP------PPXXPP 680 P PPPP P PPPPPP P P PP PP Sbjct: 101 PPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPP 147 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 6/66 (9%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP------PXPXXPX 439 PPPP PPPPP P P PPPPP P P Sbjct: 108 PPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKP--SKPA 165 Query: 438 XPPPPP 421 PP PP Sbjct: 166 PPPQPP 171 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P P P PPPPPPP Sbjct: 72 PPPVPTTMYKAPPPPQSPPAPTTTAQAPPPPPPPPPPPPP 111 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 T PPPP P P PPPPP P PPPPPP Sbjct: 78 TMYKAPPPPQ------SPPAPTTTAQAPPPPPPPPP---PPPPPP 113 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + PPPPPP P PP P Sbjct: 121 PQYPPPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKP 161 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-------XXXPXPPPXXPPXXGGXXXXXXPP 716 P PP P P PPPPPP P PPP PP PP Sbjct: 85 PPQSPPAPTTTAQAPPPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPP 144 Query: 717 GXP 725 P Sbjct: 145 PPP 147 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPP P PPPPP P P PP Sbjct: 127 PPPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAPKPSKPAPP 167 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 61.7 bits (143), Expect = 2e-08 Identities = 32/73 (43%), Positives = 32/73 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P G PPPPPP P PPPP PP P P PPPPP P Sbjct: 37 PPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPP------PPPP-----PPPPPPP 85 Query: 749 PXPXAGPPXPAAP 787 P P PP AP Sbjct: 86 PPPSLLPPHSDAP 98 Score = 60.5 bits (140), Expect = 5e-08 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP PPPP P G P PPPPP PP P PP P P PP Sbjct: 29 PPPPPP-----PPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPPP 82 Score = 56.8 bits (131), Expect = 7e-07 Identities = 27/62 (43%), Positives = 27/62 (43%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G T PPPP P P PPPPPP P P PPPPP Sbjct: 35 PPPPPAPRVAGFSYPQTFMASPPPPP--------PPPPPPPPPPPPPPPPPPPPPPPPPP 86 Query: 420 PP 415 PP Sbjct: 87 PP 88 Score = 50.8 bits (116), Expect = 4e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P PPPPP P P PPPPPPP Sbjct: 33 PPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPP 74 Score = 48.0 bits (109), Expect = 3e-04 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP G PPPPP P P PPPPPP P P PP Sbjct: 36 PPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPP 93 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP G PPPPP P P PPPPPP P PP Sbjct: 37 PPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPPHSD 96 Query: 420 PP 415 P Sbjct: 97 AP 98 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP G PPPPPP P PPP PP PP P Sbjct: 33 PPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 42.3 bits (95), Expect = 0.015 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPPP G PPPPP P PPP PP PP Sbjct: 26 GFSPPPPPPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 85 Query: 720 XP 725 P Sbjct: 86 PP 87 Score = 41.1 bits (92), Expect = 0.035 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPPP P PPPP PPPPPPP Sbjct: 26 GFSPPPPPPPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPPPPPPPP 74 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXP 703 PPPPP PPPPPP P PP PP P Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPPHSDAPFQP 101 >UniRef50_A4R5L4 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 737 Score = 61.7 bits (143), Expect = 2e-08 Identities = 49/156 (31%), Positives = 50/156 (32%), Gaps = 13/156 (8%) Frame = +2 Query: 374 PPPPX--PXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXG--GGGG 541 PPPP P G GG G G GG F P GG Sbjct: 458 PPPPDEPPPPGEPPALEGPPAGGKPPAFGRPPGFGGPPAPGRPPGFGGPPPLGRPPAFGG 517 Query: 542 XXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPP------PXXXPGPP-PPXPPXXGGXXX 700 + P PP GG P PPP P P PP PP PP Sbjct: 518 PPDLGGPPRPGNPPALGGPPRRGEPPAPPKPPPFGEPPAPPRPPAPPRPPAPPKPPPFGK 577 Query: 701 PXAPXXXAXPPPPPXP--PXPXAGPPXPAAPXXXPP 802 P AP PP PP P P P PP P P PP Sbjct: 578 PPAPPKPPAPPKPPAPPKPPPFGKPPGPPEPGKPPP 613 Score = 60.9 bits (141), Expect = 4e-08 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 3/84 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP PPP PPP PPP PP P AP PPPP Sbjct: 385 PPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPPD 444 Query: 743 XPPXPXAGPPXPA-APXXXPPXXG 811 PP P A PP A P PP G Sbjct: 445 APPPPDAPPPPDAPPPPDEPPPPG 468 Score = 58.4 bits (135), Expect = 2e-07 Identities = 47/172 (27%), Positives = 47/172 (27%), Gaps = 2/172 (1%) Frame = -2 Query: 702 GXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPX 523 G PP G G P GG PPPP G PP P Sbjct: 306 GSGKPPPSKLAGSGKPPPNKPPPGG---RPPPSNPPPPVRPPPPGEPPLPDNPPPPDEPP 362 Query: 522 XXGXXXKXPXPXXXXXPPPP--PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFF 349 G P PPPP PP P P P PPPP PP Sbjct: 363 VSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPD-- 420 Query: 348 FLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPPP PP P P P PG P Sbjct: 421 --EPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAPPPPDEPPPPGEP 470 Score = 58.4 bits (135), Expect = 2e-07 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP PPPP PP PPP PP P AP PPPP Sbjct: 397 PPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPD 456 Query: 743 XPPXPXAGPPXPAAPXXXPPXXG 811 PP P PP P P G Sbjct: 457 APPPPDEPPPPGEPPALEGPPAG 479 Score = 57.6 bits (133), Expect = 4e-07 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP--PPPPXXXP---GPPPPXPPXXGGXXXPX-APXXXAXPP 733 PPP GG PP PPPP P PPPP P G P P A PP Sbjct: 321 PPPNKPPPGGRPPPSNPPPPVRPPPPGEPPLPDNPPPPDEPPVSGKPPPGDEPPASARPP 380 Query: 734 PPPXPPXPXAGPP--XPAAPXXXPP 802 PP PP P PP P P PP Sbjct: 381 PPDRPPPPDRPPPPDEPPPPDEPPP 405 Score = 55.6 bits (128), Expect = 2e-06 Identities = 29/80 (36%), Positives = 29/80 (36%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPP G G PPP G PPP P GG P P PPPP PP Sbjct: 299 PPPSRLAGSGK--------PPPSKLAGSGKPPPNKPPPGGRPPPSNPPPPVRPPPPGEPP 350 Query: 752 XPXAGPPXPAAPXXXPPXXG 811 P PP P P G Sbjct: 351 LPDNPPPPDEPPVSGKPPPG 370 Score = 52.4 bits (120), Expect = 1e-05 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP---PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPP PPPP PP P PPP PP P AP PPPP Sbjct: 403 PPPPSEPPPPPNEPPPPDEPPPPNESPPPDAP-PPPNEPPPPDAPPPPDAPPPPDAPPPP 461 Query: 740 PXPPXPXAGPPXPAAP-XXXPPXXG 811 PP P P P PP G Sbjct: 462 DEPPPPGEPPALEGPPAGGKPPAFG 486 Score = 51.6 bits (118), Expect = 2e-05 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPP--PPXXGG---GGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX 727 PPP PP G G PPP PPP P PP PP P Sbjct: 356 PPPDEPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPPPNE 415 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PP P PP A P P Sbjct: 416 PPPPDEPPPPNESPPPDAPPPPNEP 440 Score = 51.6 bits (118), Expect = 2e-05 Identities = 30/86 (34%), Positives = 30/86 (34%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPP PP PPP PP P AP PPPP Sbjct: 409 PPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAPPPP-DEPPPP 467 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P GPP P G GG Sbjct: 468 GEPPALEGPPAGGKPPAFGRPPGFGG 493 Score = 51.2 bits (117), Expect = 3e-05 Identities = 37/121 (30%), Positives = 37/121 (30%) Frame = -2 Query: 777 GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXP 598 G GGP G G GG PP GG PG GG P Sbjct: 490 GFGGPP-APGRPPGFGGPPPLGRPPAFGGPPDLGGPPR--PGNPPALGGPPRRGEPPAPP 546 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP G PP PP K P P PP PP P P PP P Sbjct: 547 KPPPFGEPPAPPRPPAPPRPPAPPKPP-PFGKPPAPPKPPAPPKPPAPPKPPPFGKPPGP 605 Query: 417 P 415 P Sbjct: 606 P 606 Score = 50.8 bits (116), Expect = 4e-05 Identities = 28/81 (34%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP-XPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPP G P P PPPP PP P P + PPPPP Sbjct: 355 PPPPDEPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPPPN 414 Query: 746 PPXPXAGPPXP--AAPXXXPP 802 P P PP P + P PP Sbjct: 415 EPPPPDEPPPPNESPPPDAPP 435 Score = 50.4 bits (115), Expect = 6e-05 Identities = 46/164 (28%), Positives = 47/164 (28%), Gaps = 7/164 (4%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXX--GAXGXXXPPXXGGXGGGGP-G 652 APP P G P G GG A G G P G GG P G Sbjct: 451 APPPPDAPPPPDEPPPPGEPPALEGPPAGGKPPAFGRPPGFGGPPAPGRPPGFGGPPPLG 510 Query: 651 XXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPP--PPXXXGXXXKXPXPXXXX 478 GG + PP GG PPP P P P Sbjct: 511 RPPAFGGPPDLGGPPRPGNPPALGGPPRRGEPPAPPKPPPFGEPPAPPRPPAPPRPPAPP 570 Query: 477 XPPP--PPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXF 352 PPP PP P P PP PP P G PP F Sbjct: 571 KPPPFGKPPAPPKPPAPPKPPAPPKPPPFGKPPGPPEPGKPPPF 614 Score = 49.2 bits (112), Expect = 1e-04 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP G PPP P PPP P P PPPP Sbjct: 337 PPPPVRPPPPGEPPLPDNPPPPDEPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDE 396 Query: 749 PXPXAGPPXPAAPXXXP 799 P P PP P+ P P Sbjct: 397 PPPPDEPPPPSEPPPPP 413 Score = 46.8 bits (106), Expect = 7e-04 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP G G P PPP G PP P P P P PPP Sbjct: 94 PPPNKLEGFGKPPAPASPPPGKPPPNKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPG 153 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 PP G P AP PP Sbjct: 154 KPPPNKLEGFGRPPAPDSPPP 174 Score = 46.8 bits (106), Expect = 7e-04 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP G PP P P PPPP P G P P PP P Sbjct: 149 PPPP--GKPPPNKLEGFGRPPAPDSPPPNRPPPPVRPPGLGRPPPNKPPPPVEPPAPERA 206 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 207 PAPGKPPPSKPPPPARPP 224 Score = 46.4 bits (105), Expect = 0.001 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 4/81 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP--PPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP G G PP P PP P PPPP P P A PPP Sbjct: 55 PPPNKLEGFGKPPAPDSPPPNRPLPPVRPPADNPPPPGKPPPNKLEGFGKPPAPASPPPG 114 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 PP G P AP PP Sbjct: 115 KPPPNKLEGFGKPPAPASPPP 135 Score = 46.4 bits (105), Expect = 0.001 Identities = 42/144 (29%), Positives = 42/144 (29%), Gaps = 11/144 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP- 433 PPPP PPP PP P P PP PP P P P Sbjct: 397 PPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPD 456 Query: 432 -PPP---PPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXP 265 PPP PPP G GG P F G G P Sbjct: 457 APPPPDEPPPPGEPPALEGPPAGG---KPPAFGRPPGFGGPPAPGRPPGFGGPPPLGRPP 513 Query: 264 P---PPXXXXPPRXPXTPXXPGGP 202 PP PPR P P GGP Sbjct: 514 AFGGPPDLGGPPR-PGNPPALGGP 536 Score = 45.6 bits (103), Expect = 0.002 Identities = 48/191 (25%), Positives = 48/191 (25%), Gaps = 8/191 (4%) Frame = -2 Query: 741 GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG---GXXXXXXKXPP---PPXXG 580 G G G P G G P G G G PP PP Sbjct: 245 GSGRPPPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGRPPPNKPPPPDRPPPSRL 304 Query: 579 GGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPPPPPPPXXX 406 G G PP P P P PPPP P P PPPP P Sbjct: 305 AGSGKPPPSKLAGSGKPPPNKPPPGGRPPPSNPPPPVRPPPPGEPPLPDNPPPPDEPPVS 364 Query: 405 XXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPX 226 G PP P P PPPP PP P Sbjct: 365 GKPPPGDEPPASARPP--------PPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPP--PN 414 Query: 225 TPXXPGGPGXP 193 P P P P Sbjct: 415 EPPPPDEPPPP 425 Score = 45.2 bits (102), Expect = 0.002 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 7/79 (8%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP--PPPPXXXPG--PPPPXPPXXG---GXXXPXAPXXXAXP 730 PPP G G PP PPPP P PPPP P G P AP Sbjct: 116 PPPNKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLEGFGRPPAPDSPPPN 175 Query: 731 PPPPXPPXPXAGPPXPAAP 787 PPP P G P P P Sbjct: 176 RPPPPVRPPGLGRPPPNKP 194 Score = 44.8 bits (101), Expect = 0.003 Identities = 43/177 (24%), Positives = 43/177 (24%), Gaps = 7/177 (3%) Frame = -2 Query: 702 GXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGG-----XXXXXTXXXP 538 G P G G P G G PPP G G P Sbjct: 236 GRPPPSRLAGSGRPPPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGRPPPNKPPP 295 Query: 537 P--PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 P PPP K P PPP P PPP PP G Sbjct: 296 PDRPPPSRLAGSGKPPPSKLAGSGKPPPNKPPPGGRPPPSNPPPPVRPPPPGEPPLPDNP 355 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP P PPPP PP P P P P P Sbjct: 356 PPPD---EPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEP 409 Score = 44.8 bits (101), Expect = 0.003 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 9/81 (11%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP--PPPPXXXP-------GPPPPXPPXXGGXXXPXAPXXXA 724 PPP G G PP PPPP P G PPP G P P Sbjct: 271 PPPSKLAGSGKAPAPGRPPPNKPPPPDRPPPSRLAGSGKPPPSKLAGSGKPPPNKPPPGG 330 Query: 725 XPPPPPXPPXPXAGPPXPAAP 787 PPP PP PP P P Sbjct: 331 RPPPSNPPPP--VRPPPPGEP 349 Score = 44.8 bits (101), Expect = 0.003 Identities = 28/81 (34%), Positives = 29/81 (35%), Gaps = 4/81 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP----PP 739 PPP G G P PP P PPP PP G P P PP PP Sbjct: 310 PPPSKLAGSGKPPPNKPPPGGRPPPSNP-PPPVRPPPPGEPPLPDNPPPPDEPPVSGKPP 368 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P + P P P PP Sbjct: 369 PGDEPPASARPPP--PDRPPP 387 Score = 44.4 bits (100), Expect = 0.004 Identities = 31/90 (34%), Positives = 31/90 (34%), Gaps = 9/90 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP----PPX---PPXXGGXXXPXAPXXXAX 727 PPPP PPP P GPP PP PP GG P P Sbjct: 446 PPPPDAPPPPDAPPPPDEPPPPGEPPALEGPPAGGKPPAFGRPPGFGGPPAPGRPPGFGG 505 Query: 728 PPPPPXPPXPXAGPPXPAAP--XXXPPXXG 811 PPP PP GPP P PP G Sbjct: 506 PPPLGRPPA-FGGPPDLGGPPRPGNPPALG 534 Score = 43.2 bits (97), Expect = 0.009 Identities = 36/136 (26%), Positives = 37/136 (27%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP G G + PPP K P P PPPP PPPP Sbjct: 94 PPPNKLEGFGKPPAPASPPPGKPPPNKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPG 153 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P G PP P P G PPP P Sbjct: 154 KPPPNKLEGFGRPPAPDSPPPN-----------------RPPPPVRPPGLGRPPPNKPPP 196 Query: 240 PRXPXTPXXPGGPGXP 193 P P P PG P Sbjct: 197 PVEPPAPERAPAPGKP 212 Score = 43.2 bits (97), Expect = 0.009 Identities = 30/102 (29%), Positives = 31/102 (30%) Frame = -1 Query: 715 GGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPP 536 GG PP GG G GG G PP GG G P Sbjct: 492 GGPPAPGRPPGFGGPPP--LGRPPAFGGPPDLGGPPRPGNPPAL--GGPPRRGEPPAPPK 547 Query: 535 PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPP P P PP PP P PP PP+ Sbjct: 548 PPPFGEPPAPPRPPAPPRPPAPPKPPPFGKPPAPPKPPAPPK 589 Score = 42.7 bits (96), Expect = 0.011 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP--PPXPPXPXA-GPPXPAAP 787 P PPP P P P P G P AP A PPP PP P P A PP P P Sbjct: 2 PGRPPPNRPPPPGKPPPSKLEGFGKPPAP---ASPPPNRPPPPVRPPADNPPPPGKP 55 Score = 42.7 bits (96), Expect = 0.011 Identities = 28/87 (32%), Positives = 29/87 (33%), Gaps = 2/87 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP G G PP PPPP P P P P P PP Sbjct: 177 PPPPVRPPGLGRP------PPNKPPPPVEPPAPERAPAPGKPPPSKPPPPARPPGRPPAS 230 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PP P PP A PP G+ Sbjct: 231 KPPPPGRPPPSRLAGSGRPPPNKLAGS 257 Score = 42.3 bits (95), Expect = 0.015 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 2/82 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPPPX 745 PPPP PPPP PG PP PP G P PP P Sbjct: 440 PPPPDAPPPPDAPPPPDAPPPPDEPPPPGEPPALEGPPAGGKPPAFGRPPGFGGPPAPGR 499 Query: 746 PPXPXAGPPXPAAPXXXPPXXG 811 PP GPP P PP G Sbjct: 500 PPG-FGGPP----PLGRPPAFG 516 Score = 41.9 bits (94), Expect = 0.020 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 5/64 (7%) Frame = +2 Query: 626 PPP--PPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPX 790 PPP PPP G PP P P P P PPP PP G P AP Sbjct: 11 PPPGKPPPSKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLEGFGKPPAPD 70 Query: 791 XXPP 802 PP Sbjct: 71 SPPP 74 Score = 41.9 bits (94), Expect = 0.020 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 3/80 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPP G G PP PPPP P PP P G P PP P Sbjct: 16 PPPSKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPP----GKPPPNKLEGFGKPPAPDS 71 Query: 746 PPXPXAGPP-XPAAPXXXPP 802 PP PP P A PP Sbjct: 72 PPPNRPLPPVRPPADNPPPP 91 Score = 41.5 bits (93), Expect = 0.026 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 3/75 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP--PPX 745 PPPP G PP P PG PPP G P AP A PPP PP Sbjct: 88 PPPP--GKPPPNKLEGFGKPPAPASPPPGKPPPN--KLEGFGKPPAP---ASPPPNRPPP 140 Query: 746 PPXPXA-GPPXPAAP 787 P P A PP P P Sbjct: 141 PVRPPADNPPPPGKP 155 Score = 40.7 bits (91), Expect = 0.046 Identities = 35/132 (26%), Positives = 36/132 (27%), Gaps = 2/132 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXPPP 427 PPPP G G PPPP + P P PPP PPP P PP Sbjct: 177 PPPPVRPPGLG----RPPPNKPPPPVEPPAPERAPAP---GKPPPSKPPPPARPPGRPPA 229 Query: 426 PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 PP G G PP P G P Sbjct: 230 SKPPPPGRPPPSRLAGSG--RPPPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGR 287 Query: 246 XPPRXPXTPXXP 211 PP P P P Sbjct: 288 PPPNKPPPPDRP 299 Score = 40.7 bits (91), Expect = 0.046 Identities = 30/89 (33%), Positives = 30/89 (33%), Gaps = 9/89 (10%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXP-GPPPP-XPPXXGGXXXPXAPXXXAXPP---P 736 PPPP PPPP P PPPP PP P P PP Sbjct: 422 PPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAPPPPDEPPPPGEPPALEGPPAGGK 481 Query: 737 PP--XPPXPXAGPPXPAAP--XXXPPXXG 811 PP P GPP P P PP G Sbjct: 482 PPAFGRPPGFGGPPAPGRPPGFGGPPPLG 510 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PG PPP P G P PP P PP P PP P PP G Sbjct: 2 PGRPPPNRPPPPGKPPPSKLEGFGKPPAPASPP-PNRPPPPVRPPADNPPPPG 53 Score = 39.1 bits (87), Expect = 0.14 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 3/80 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP---PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP PP PPPP PG PP P G P PPP Sbjct: 194 PPPPVEPPAPERAPAPGKPPPSKPPPPARPPGRPPASKPPPPGRPPPSRLAGSGRPPPNK 253 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P A PP Sbjct: 254 LAGSGSPSPNKLAGSGSPPP 273 Score = 38.3 bits (85), Expect = 0.25 Identities = 25/85 (29%), Positives = 26/85 (30%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP G G P P G P P G AP PPP P Sbjct: 238 PPPSRLAGSGRPPPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGR----PPPNKP 293 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGGA 823 P P PP A PP G+ Sbjct: 294 PPPDRPPPSRLAGSGKPPPSKLAGS 318 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP- 422 PPP PPP + P P PPPPP PPPP Sbjct: 367 PPPGDEPPASARPPPPDRPPPPDRPPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPN 426 Query: 421 --PPPE 410 PPP+ Sbjct: 427 ESPPPD 432 Score = 37.9 bits (84), Expect = 0.33 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 5/67 (7%) Frame = +2 Query: 626 PPP--PPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPX 790 PPP PPP G PP P P G P PP P P P PP P Sbjct: 89 PPPGKPPPNKLEGFGKPPAPASPPPG--KPPPNKLEGFGKPPAPASPPPNRPPPPVRPPA 146 Query: 791 XXPPXXG 811 PP G Sbjct: 147 DNPPPPG 153 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPP PP PPP PP PP Sbjct: 393 PPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPPDAPP 447 Score = 37.5 bits (83), Expect = 0.43 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G P PPP G P P G P +P A P PP Sbjct: 217 PPPPARPPGRPPASKPPPPGRPPPSRLAGSGRPPPNKLAGSGSP-SPNKLAGSGSP--PP 273 Query: 752 XPXAGPPXPAAPXXXPP 802 AG AP PP Sbjct: 274 SKLAGSGKAPAPGRPPP 290 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP- 422 PPP G G P PP E P P PPP PPPP Sbjct: 94 PPPNKLEGFGKPPAPASPPPGKPPPNKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPG 153 Query: 421 -PPP 413 PPP Sbjct: 154 KPPP 157 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXT--XXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPP G G + PPPP G P PP P P PPP Sbjct: 155 PPPNKLEGFGRPPAPDSPPPNRPPPPVRPPGLGRPPPNKPPPPVEPPAPERAPAPGKPPP 214 Query: 426 --PPPP 415 PPPP Sbjct: 215 SKPPPP 220 Score = 36.3 bits (80), Expect = 1.00 Identities = 34/119 (28%), Positives = 34/119 (28%), Gaps = 3/119 (2%) Frame = -2 Query: 540 PP--PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXG-GGGX 370 PP PPP K P P PP PP P P PPPP G G Sbjct: 12 PPGKPPPSKLEGFGKPPAPASP--PPNRPPPPVRPPADNPPPPGKPPPNKLEGFGKPPAP 69 Query: 369 XXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PP L P G PP PP P P G G P Sbjct: 70 DSPPPNRPLPPVRPPADNPPPPGKPPPNKLEGFGKPPAPASPPPGKP-PPNKLEGFGKP 127 Score = 35.5 bits (78), Expect = 1.7 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G G P PPPP PP P P PP PPG P Sbjct: 173 PPNRPPPPVRPPGLG--RPPPNKPPPPVEPPAPERAPAPGKPP-PSKPPPPARPPGRP 227 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -1 Query: 541 PPPP--PXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP--PPPP 413 PPPP P E P PPPP +PPP PPPP Sbjct: 391 PPPPDEPPPPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPP 437 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP P PPPP PP PPP PP PP Sbjct: 417 PPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAPPPPDEPPPPGEPP 471 Score = 34.3 bits (75), Expect = 4.0 Identities = 29/109 (26%), Positives = 29/109 (26%), Gaps = 8/109 (7%) Frame = -1 Query: 715 GGXXWXXXPPXXGGXXGGGXGXXXGG----GGGGXXGXXAXXPPPPXXXGGGGXXXGXXX 548 GG PP GG G G GG G P PP Sbjct: 504 GGPPPLGRPPAFGGPPDLGGPPRPGNPPALGGPPRRGEPPAPPKPPPFGEPPAPPRPPAP 563 Query: 547 XXPP----PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PPP P P PP PP P P PP Sbjct: 564 PRPPAPPKPPPFGKPPAPPKPPAPPKPPAPPKPPPFGKPPGPPEPGKPP 612 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PP P G+ P PPP PP Sbjct: 337 PPPPVRPPPPGEPPLPDNPPPPDEPPVSGKPPPGDEPPASARPPPPDRPPPPDRPPPPDE 396 Query: 421 PPP 413 PPP Sbjct: 397 PPP 399 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP----PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP PP P P PP PP P Sbjct: 399 PPDEPPPPSEPPPPPNEPPPPDEPPPPNESPPPDAPPPPNEPPPPDAPPPPDAPPPPDAP 458 >UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - Mus musculus (Mouse) Length = 1567 Score = 61.7 bits (143), Expect = 2e-08 Identities = 35/88 (39%), Positives = 35/88 (39%), Gaps = 4/88 (4%) Frame = +2 Query: 569 PPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G G PPPPP G PPP P G P A A PPPPP Sbjct: 999 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPPP 1058 Query: 743 XP--PXPXAGPPXPAAPXXXPPXXGXGG 820 P P PP P A PP G Sbjct: 1059 LPGMGVPPPAPPPPGAGIPPPPLLPGSG 1086 Score = 56.8 bits (131), Expect = 7e-07 Identities = 35/88 (39%), Positives = 36/88 (40%), Gaps = 3/88 (3%) Frame = +2 Query: 569 PPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G G PPPPP G PPP P G P P PPP Sbjct: 1010 PPPPPLPGVGIPPPPPLPGMGIPPPPPLPGSGIPPP-PALPGVAIPPPPPLPGMGVPPPA 1068 Query: 743 XPPXPXAG-PPXPAAPXXXPPXXGXGGA 823 PP P AG PP P P PP G+ Sbjct: 1069 PPP-PGAGIPPPPLLPGSGPPHSSQVGS 1095 Score = 55.2 bits (127), Expect = 2e-06 Identities = 43/137 (31%), Positives = 43/137 (31%), Gaps = 4/137 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPP G P P PPPPP P PPPPP Sbjct: 956 PPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGV-GIPPPPP 1014 Query: 420 PPXXXXXXXXGXGGGGXXXPPXF---FFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXX 250 P G G PP P PG PPPP Sbjct: 1015 LPGVGIPPPPPLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPPPLPGMGVPPPAPPPPGA 1074 Query: 249 XXPPRXPXTPXXPG-GP 202 PP P PG GP Sbjct: 1075 GIPP----PPLLPGSGP 1087 Score = 54.8 bits (126), Expect = 3e-06 Identities = 32/86 (37%), Positives = 32/86 (37%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G G PPPPP G PPP PP G P P PPPP Sbjct: 966 PPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPP-PPLPGVGIPPPPPLPGVGIPPPP 1024 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P PP G Sbjct: 1025 PLPGMGIPPPPPLPGSGIPPPPALPG 1050 Score = 52.8 bits (121), Expect = 1e-05 Identities = 37/95 (38%), Positives = 37/95 (38%), Gaps = 12/95 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP---- 736 PPPPP G G PPPP P PPPP P G P P PPP Sbjct: 933 PPPPPLPGMG-------IPPPPPLPGVGIPPPPPL-PGVGIPPPPPLPGVGIPPPPPLPG 984 Query: 737 ---PPXPPXPXAG-PPXPAAP----XXXPPXXGXG 817 PP PP P G PP P P PP G G Sbjct: 985 VGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVG 1019 Score = 52.0 bits (119), Expect = 2e-05 Identities = 40/135 (29%), Positives = 41/135 (30%), Gaps = 4/135 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXP----PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP 433 P PP G G P PPPP G P P PPPPP P P Sbjct: 897 PQPPPLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPPPLPGV-GIP 955 Query: 432 PPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPX 253 PPPP P G G PP + P P G PPPP Sbjct: 956 PPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPL 1015 Query: 252 XXXPPRXPXTPXXPG 208 P P PG Sbjct: 1016 PGV--GIPPPPPLPG 1028 Score = 51.6 bits (118), Expect = 2e-05 Identities = 32/84 (38%), Positives = 32/84 (38%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G G PPPPP G PPP P G P PPPPP Sbjct: 922 PPPPPLPGMGIPPPPPLPGMGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPP 981 Query: 743 XP----PXPXAGPPXPAAPXXXPP 802 P P P PP P PP Sbjct: 982 LPGVGIPPP---PPLPGVGIPPPP 1002 Score = 50.4 bits (115), Expect = 6e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PP PPP G PPPP PP G P P PPPP P PP P P Sbjct: 896 PPQPPPLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPPPLPGVGIP 955 Query: 800 P 802 P Sbjct: 956 P 956 Score = 50.0 bits (114), Expect = 8e-05 Identities = 36/95 (37%), Positives = 36/95 (37%), Gaps = 12/95 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP---- 736 PPPPP G PPPP P PPPP P G P P PPP Sbjct: 908 PPPPPAPPLPGMGIP----PPPPLPGMGIPPPPPL-PGMGIPPPPPLPGVGIPPPPPLPG 962 Query: 737 ---PPXPPXPXAG-PPXPAAP----XXXPPXXGXG 817 PP PP P G PP P P PP G G Sbjct: 963 VGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVG 997 Score = 38.7 bits (86), Expect = 0.19 Identities = 42/164 (25%), Positives = 43/164 (26%), Gaps = 4/164 (2%) Frame = +2 Query: 260 GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPPPXPXXXXXXFXGGGGGGGX 439 G G P PG G PPPP P G G Sbjct: 951 GVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIP 1010 Query: 440 XGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXX 619 G G G G P G + PPPPP G G Sbjct: 1011 PPPPLPGVGIPPPPPLPGMGIPPPPPLPGSGIPPPPALPGVAIPPPPPLPGMG---VPPP 1067 Query: 620 XXPPP----PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP PPP PG PP G P AP PP Sbjct: 1068 APPPPGAGIPPPPLLPGSGPPHSSQVGSSTLPAAPQGCGFLFPP 1111 Score = 38.3 bits (85), Expect = 0.25 Identities = 28/97 (28%), Positives = 29/97 (29%), Gaps = 2/97 (2%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPP--PXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXX 319 P PP PPP P PPPP P P G G PP + Sbjct: 890 PEMLPAPPQPPPLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPPPL 949 Query: 318 XXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG 208 P P G PPPP P P PG Sbjct: 950 PGVGIPPPPPLPGVGIPPPPPLPGV--GIPPPPPLPG 984 Score = 37.9 bits (84), Expect = 0.33 Identities = 31/113 (27%), Positives = 32/113 (28%), Gaps = 2/113 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP--PXXXXXXXXGXGGGGXX 367 PP PP G P P PP P P PPPP P G G Sbjct: 896 PPQPPPLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPPPPPLPGVGIP 955 Query: 366 XPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG 208 PP + P P G PPPP P P PG Sbjct: 956 PPPPLPGVGIPPPPPLPGVGIPPPPPLPGVGIPPPPPLPGV--GIPPPPPLPG 1006 Score = 37.5 bits (83), Expect = 0.43 Identities = 24/81 (29%), Positives = 24/81 (29%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPP G P P PPPP P PP Sbjct: 1033 PPPPLPGSGIPPPPALPGVAIPPPPPLPGMGVPPPAPPPPGAGIPPPPL--LPGSGPPHS 1090 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 G G PP Sbjct: 1091 SQVGSSTLPAAPQGCGFLFPP 1111 Score = 35.5 bits (78), Expect = 1.7 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 7/66 (10%) Frame = +2 Query: 641 PXXXPGP--PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG-PPXPAAP----XXXP 799 P P P PPP P G P AP PPP PP P G PP P P P Sbjct: 890 PEMLPAPPQPPPL-PGLGVPPPPPAPPLPGMGIPPP-PPLPGMGIPPPPPLPGMGIPPPP 947 Query: 800 PXXGXG 817 P G G Sbjct: 948 PLPGVG 953 >UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 430 Score = 61.3 bits (142), Expect = 3e-08 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPP PP P PPP PP P P PPP P Sbjct: 134 PPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPS-PP 192 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 193 PHPPNQPPPPYPPSQPPP 210 Score = 54.4 bits (125), Expect = 4e-06 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP P PPP PPP PP +P PPP P Sbjct: 83 PSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFA 142 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 143 PEPSPPPPMPPPPTPPPP 160 Score = 54.0 bits (124), Expect = 5e-06 Identities = 27/77 (35%), Positives = 28/77 (36%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PP PPP P P PP PP P PPPP P Sbjct: 147 PPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPS 206 Query: 752 XPXAGPPXPAAPXXXPP 802 P P P+ P PP Sbjct: 207 QPPPFSPPPSPPPFSPP 223 Score = 51.2 bits (117), Expect = 3e-05 Identities = 26/78 (33%), Positives = 28/78 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP P PPPP PPP PP P P P PP Sbjct: 157 PPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPS 216 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P + PP P + PP Sbjct: 217 PPPFSPPPSPPSQPPQPP 234 Score = 51.2 bits (117), Expect = 3e-05 Identities = 27/79 (34%), Positives = 29/79 (36%), Gaps = 2/79 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP--XPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPP P PPP P PPP PP P +P PPP Sbjct: 178 PPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVL 237 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P P+AP PP Sbjct: 238 PPSSPPPSPVPSAPPSAPP 256 Score = 50.8 bits (116), Expect = 4e-05 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PP P P P PP PP P P PPP Sbjct: 102 PSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPS 161 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P +P PP Sbjct: 162 PSPPPLPPPPWSPDPSPP 179 Score = 50.4 bits (115), Expect = 6e-05 Identities = 26/77 (33%), Positives = 29/77 (37%), Gaps = 1/77 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP-XXXAXPPPPPXP 748 PPPP PPPP P PPPP PP P +P + PP P P Sbjct: 56 PPPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPP 115 Query: 749 PXPXAGPPXPAAPXXXP 799 P PP +P P Sbjct: 116 SNPPNVPPSIPSPSPVP 132 Score = 50.0 bits (114), Expect = 8e-05 Identities = 29/80 (36%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPPP PP P PP P P P + PPPP P Sbjct: 33 PPPPSNPPPPLSPPPSLPPPPPSPP--PPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMP 90 Query: 749 P--XPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 91 PRSPPSPSPPSPSPPPSFPP 110 Score = 49.6 bits (113), Expect = 1e-04 Identities = 30/80 (37%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP-PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPP 742 PPPP PPP PPP PPPP PP P +P P PPP Sbjct: 168 PPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPP---SQPPPFSPPPSPPPFSPPP 224 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP PP P P PP Sbjct: 225 SPPSQPPQPP-PVLPPSSPP 243 Score = 48.8 bits (111), Expect = 2e-04 Identities = 31/85 (36%), Positives = 32/85 (37%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PP--PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PPP PP PPP P PPP P P AP PPP P Sbjct: 209 PPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSA---PPSAPPP-TQPPPSP 264 Query: 743 XP-----PXPXAGPPXPAAPXXXPP 802 P P P + PP P P PP Sbjct: 265 VPSTPPSPQPVSPPPSPEPPLQPPP 289 Score = 48.0 bits (109), Expect = 3e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP P P PPPPP P P PPP Sbjct: 135 PPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPH 194 Query: 420 PP 415 PP Sbjct: 195 PP 196 Score = 48.0 bits (109), Expect = 3e-04 Identities = 27/81 (33%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPP-PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPP PPP PP P PP PP P +P A P PP Sbjct: 199 PPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPPPT 258 Query: 743 -XPPXPXAGPPXPAAPXXXPP 802 PP P P P PP Sbjct: 259 QPPPSPVPSTPPSPQPVSPPP 279 Score = 47.6 bits (108), Expect = 4e-04 Identities = 30/87 (34%), Positives = 31/87 (35%), Gaps = 9/87 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP------PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX- 727 PPPP PPP PPP P PP P P P A Sbjct: 85 PPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFAPE 144 Query: 728 --PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P PP P PP P+ P PP Sbjct: 145 PSPPP-PMPPPPTPPPPSPSPPPLPPP 170 Score = 47.6 bits (108), Expect = 4e-04 Identities = 26/80 (32%), Positives = 28/80 (35%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP--GPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP PPP P P PPP PP P +P + PP P Sbjct: 223 PPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPPPTQPPPSPVPSTPPSPQPVSPPPSPE 282 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P P P P AP P Sbjct: 283 PPLQPPPNVPYPYAPPPGSP 302 Score = 46.8 bits (106), Expect = 7e-04 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP-PPXPXXPXXPPPP 424 PPPP + PPPP P P PPPP PP P PPP Sbjct: 157 PPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPS 216 Query: 423 PPP 415 PPP Sbjct: 217 PPP 219 Score = 46.4 bits (105), Expect = 0.001 Identities = 34/136 (25%), Positives = 37/136 (27%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + P PP P P P P PP P P PP P Sbjct: 39 PPPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRSPPSPS 98 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP PP + P P PPPP P Sbjct: 99 PPSPSPPPSFPPSVPPPSNPPN---VPPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPP 155 Query: 240 PRXPXTPXXPGGPGXP 193 P +P P P P Sbjct: 156 TPPPPSPSPPPLPPPP 171 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP PPPP P P P P PP P P PPP P Sbjct: 132 PSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSP 191 Query: 420 PP 415 PP Sbjct: 192 PP 193 Score = 43.6 bits (98), Expect = 0.007 Identities = 26/82 (31%), Positives = 27/82 (32%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PP--PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP--P 736 PP PPP P PPP P PP PP P + P P Sbjct: 218 PPFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPPPTQPPPSPVPSTPPSPQPVSP 277 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 PP P P PP P PP Sbjct: 278 PPSPEPPLQPPPNVPYPYAPPP 299 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPP PP P PPP PP PP Sbjct: 130 PVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPP 182 Score = 41.1 bits (92), Expect = 0.035 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-PXPPXPXAGPP-XPAAPXXXPP 802 P PP P P PP P +P PPPP P PP P + PP P PP Sbjct: 18 PSSPPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPPSLPPWWPNVSPSPPP 77 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PP PP + P P PPP P P P PPP Sbjct: 168 PPPPWSPDPSPPPPPSPYMPPPSPPPHP--PNQPPPPYPPSQPPPFSPPPSPPPFSPPPS 225 Query: 420 PP 415 PP Sbjct: 226 PP 227 Score = 40.3 bits (90), Expect = 0.061 Identities = 33/132 (25%), Positives = 35/132 (26%), Gaps = 2/132 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP-PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP + PPP P P PP P P P P PPP Sbjct: 56 PPPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPP 115 Query: 423 PPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXX 244 P PP F P P PPPP Sbjct: 116 SNPPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPD 175 Query: 243 P-PRXPXTPXXP 211 P P P +P P Sbjct: 176 PSPPPPPSPYMP 187 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/75 (30%), Positives = 26/75 (34%), Gaps = 5/75 (6%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-- 739 PPP PP PPP P P P PP P +P PPP Sbjct: 233 PPPVLPPSSPPPSPVPSAPPSAPPPTQPPPSPVPSTPPSPQPVSPPPSPEPPLQPPPNVP 292 Query: 740 -PXPPXPXAGPPXPA 781 P P P + P P+ Sbjct: 293 YPYAPPPGSPPTSPS 307 Score = 38.7 bits (86), Expect = 0.19 Identities = 29/90 (32%), Positives = 32/90 (35%), Gaps = 12/90 (13%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP------PPXXXP--GPPPPXPPXXG-GXXXPXAPXXX 721 PPPP PPPP PP P PP P PP P + Sbjct: 56 PPPPSPPSLPPWWPNVSPSPPPPTTPSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPP 115 Query: 722 AXPP--PPPXP-PXPXAGPPXPAAPXXXPP 802 + PP PP P P P PP P +P P Sbjct: 116 SNPPNVPPSIPSPSPVPSPPPPPSPFAPEP 145 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP- 424 PPPP P PP P P PPP P P P PPP Sbjct: 199 PPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSPPPSPVPSAPPSAPPPT 258 Query: 423 -PPP 415 PPP Sbjct: 259 QPPP 262 Score = 38.3 bits (85), Expect = 0.25 Identities = 28/112 (25%), Positives = 29/112 (25%), Gaps = 2/112 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PP P P P P PPP P PPPP P P Sbjct: 122 PPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPP 181 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPP--PPXXXXPPRXPXTPXXP 211 P + P P PP PP PP P P P Sbjct: 182 PSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQP 233 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP P PPP P P P PP PPPP Sbjct: 18 PSSPPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPP 59 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP-XPPPXXPP 680 P PPPP P PPP PP P PPP PP Sbjct: 164 PPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPP 205 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPP--PPPPXPXXPXXPPPPPPP 415 PP + P P PP PPP P P PPPP PP Sbjct: 21 PPSHPPIWPHQSPPPPSNPPPPLSPPPSLPPPPPSPPPPSPP 62 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PPP P P P PPP Sbjct: 179 PPPPSPYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSP-PSQPPQPPPVL 237 Query: 420 PP 415 PP Sbjct: 238 PP 239 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 6/69 (8%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPP------PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 PPPP PP PPP P PPPPP Sbjct: 85 PPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPPSPFAPE 144 Query: 439 XTPPPPPPP 413 +PPPP PP Sbjct: 145 PSPPPPMPP 153 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGG----GGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + P PPP PP P PPP PP Sbjct: 195 PPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPP 239 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPP-PPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP PP P PPP PPP P PP PP PP P Sbjct: 184 PYMPPPSPPPHPPNQPPPPYPPSQPPPFSPPPSPPPFSPPPSPPSQPPQPPPVLPPSSP 242 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP----PPPPPXXXP-XPPPXXPPXXGGXXXXXXPPGX 722 P PPPP P P P PPP P PPP PP PP Sbjct: 148 PPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSPYMPPPSPPPHPPNQPPPPYPPSQ 207 Query: 723 P 725 P Sbjct: 208 P 208 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPPP +PPPP PP Sbjct: 52 PPPSPPPPSPPSLPPWWPNVSPSPPPP---TTPSPSPPPPMPP 91 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP-PPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPPP P P PP PP PP P Sbjct: 128 PSPVPSPPPPPSPFAPEPSPPPPMPPPPTPPPPSPSPPPLPPPPWSPDPSPPPPPSP 184 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + PPP PP P PP PP PP P Sbjct: 81 PSPSPPPPMPPRSPPSPSPPSPSPPPSFPPSVPPPSNPPNVPPSIPSPSPVPSPPPPP 138 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP T P P P P P PPP P PPP Sbjct: 242 PPPSPVPSAPPSAPPPTQPPPSPVPSTPPSPQPVSPPPSPEPPLQPPPNVPYPYAPPPGS 301 Query: 420 PP 415 PP Sbjct: 302 PP 303 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PP P P P PPP P PP PPPP Sbjct: 114 PPSNPPNVPPSIPSPSPVPSPPPPPSPFAPEPSPPPPMPPPP 155 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 61.3 bits (142), Expect = 3e-08 Identities = 31/77 (40%), Positives = 31/77 (40%), Gaps = 4/77 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP-PXXXPGPPPPXPPXXGG---XXXPXAPXXXAXPPP 736 PPPP PPPPP P PPPP PP P P A PPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Query: 737 PPXPPXPXAGPPXPAAP 787 PP PP A PP P P Sbjct: 552 PPPPPGTQAAPPPPPPP 568 Score = 59.3 bits (137), Expect = 1e-07 Identities = 36/94 (38%), Positives = 36/94 (38%), Gaps = 9/94 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP--GPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPP PP P G PP PP P P A PPPPP Sbjct: 474 PPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPP------PPPLPTTIAAPPPPP 527 Query: 743 XPPXPXAGPPXP-------AAPXXXPPXXGXGGA 823 PP PP P AAP PP G A Sbjct: 528 PPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAA 561 Score = 56.8 bits (131), Expect = 7e-07 Identities = 28/74 (37%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG--XXXPXAPXXXAXPPPPPX 745 PPPP PPPPP PPPP PP P P A PPPPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Query: 746 PPXPXAGPPXPAAP 787 PP P P P Sbjct: 568 PPMQNRAPSPPPMP 581 Score = 55.6 bits (128), Expect = 2e-06 Identities = 34/89 (38%), Positives = 35/89 (39%), Gaps = 4/89 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX--PGPPPPXPPXXGGXXXPXAPXXXAXP--PP 736 PPPPP G PPPPPP P PPPP P P P + PP Sbjct: 537 PPPPPPPGTAAAP-----PPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPP 591 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PP PP P A P P PP GA Sbjct: 592 PPPPPMPLANGATP--PPPPPPMAMANGA 618 Score = 55.2 bits (127), Expect = 2e-06 Identities = 32/85 (37%), Positives = 32/85 (37%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXX----GGXXXPXAPXXXAXPPP 736 PPPPP G PPPPPP P PP P GG P P A Sbjct: 550 PPPPPPPG-----TQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGAT 604 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXG 811 PP PP P A A P PP G Sbjct: 605 PPPPPPPMAMANGAAGPPPPPPRMG 629 Score = 52.4 bits (120), Expect = 1e-05 Identities = 35/118 (29%), Positives = 35/118 (29%), Gaps = 7/118 (5%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP-------PXXXXXXXXGXG 382 PPPP P P PPPPPP P PPPPPP P G Sbjct: 527 PPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSG 586 Query: 381 GGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG 208 GG PP L G G PPPP P PG Sbjct: 587 SGGPPPPPPPMPLANGATPPPPPPPMAMANG--AAGPPPPPPRMGMANGAAGPPPPPG 642 Score = 51.6 bits (118), Expect = 2e-05 Identities = 34/95 (35%), Positives = 34/95 (35%), Gaps = 10/95 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP PPP PP P PPPP PP P PPP Sbjct: 458 PPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAF----KPLKGSAPPPPPP 513 Query: 737 PPXPPXPXAGPPXP------AAPXXXPPXXGXGGA 823 PP P A PP P AP PP G A Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAA 548 Score = 51.6 bits (118), Expect = 2e-05 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 5/78 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXX---GGXXXPXAPXXXAXPPPP 739 PPPPP PPPPPP PPPP PP P P P PP Sbjct: 523 PPPPPPP----PRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPP 578 Query: 740 PXP--PXPXAGPPXPAAP 787 P P GPP P P Sbjct: 579 PMPMGNSGSGGPPPPPPP 596 Score = 50.0 bits (114), Expect = 8e-05 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXX---GXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPP PPPPP P P PPPPPP P PPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Query: 426 PPPP 415 PPPP Sbjct: 552 PPPP 555 Score = 48.4 bits (110), Expect = 2e-04 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPP-PXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP 425 PPPP PPPP P P P PPPPP PPP Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Query: 424 PPPP 413 PPPP Sbjct: 552 PPPP 555 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 44.0 bits (99), Expect = 0.005 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 2/68 (2%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT- 434 A PPPP G PPPPP P P P PPP + Sbjct: 533 AVAPPPPPPPPG----TAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSG 588 Query: 433 -PPPPPPP 413 PPPPPPP Sbjct: 589 GPPPPPPP 596 Score = 43.6 bits (98), Expect = 0.007 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX-----PGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP PPP PP P PPPP PP P PP Sbjct: 421 PPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPA-----VMPLKHFAPP 475 Query: 734 PPPXPPXPXAGPPXP--AAPXXXPP 802 PP PP P A P A P PP Sbjct: 476 PP--PPLPPAVMPLKHFAPPPPTPP 498 Score = 42.3 bits (95), Expect = 0.015 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P P PP + PPPPPPP Sbjct: 420 PPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPP 461 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPP PPPPPP Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 41.5 bits (93), Expect = 0.026 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 6/76 (7%) Frame = +2 Query: 569 PPPPPX--XGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPP P G GG PPPP P PPP PP P A A PPPP Sbjct: 577 PPPMPMGNSGSGG-----PPPPPPPMPLANGATPPPPPP-------PMAMANGAAGPPPP 624 Query: 743 XP----PXPXAGPPXP 778 P AGPP P Sbjct: 625 PPRMGMANGAAGPPPP 640 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 P PPP P P PPPPP + PPPPPP Sbjct: 438 PSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPP 479 Score = 39.5 bits (88), Expect = 0.11 Identities = 34/145 (23%), Positives = 35/145 (24%), Gaps = 9/145 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + P PPP P PPPPP PPPP Sbjct: 418 PPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPP 477 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX---------PGXXXXGXX 268 PP PP F L P Sbjct: 478 PPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPP 537 Query: 267 PPPPXXXXPPRXPXTPXXPGGPGXP 193 PPPP P P PG P Sbjct: 538 PPPPPPGTAAAPPPPPPPPGTQAAP 562 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP K P P PP PPPPPPP Sbjct: 419 PPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPP 461 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 APPPP K P P PPP P + PPPPPPP Sbjct: 491 APPPPTPPAFKPLKGSAPPPPP-PPPLPTTIAAP--PPPPPPP 530 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPP P P P PPP L PPPPP P Sbjct: 439 SPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLP 481 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A P PPPP P PPP G PP P Sbjct: 549 PPPPPPPP------GTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMP 598 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP A P PPPPP PPP PP PP Sbjct: 523 PPPPPPPP-------RAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP PP P P PPP PP P P PP Sbjct: 417 PPPPPPPPPPLSFIKTASLP----LPSPPPTPPIADIAISMPPPPPPPPP 462 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 6/62 (9%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP------XXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPP P PPPPPP P PPP PP PP Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPP 495 Query: 720 XP 725 P Sbjct: 496 TP 497 Score = 35.5 bits (78), Expect = 1.7 Identities = 25/83 (30%), Positives = 27/83 (32%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 + P PP G + PPPPP P PPPPPP P Sbjct: 573 RAPSPPPMPMGNS----GSGGPPPPPP-------PMPLANGATPPPPPPPMAMANGAAGP 621 Query: 426 PPPPXXXXXXXXGXGGGGXXXPP 358 PPPP G G PP Sbjct: 622 PPPP---PRMGMANGAAGPPPPP 641 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP G A P PPPP P PPP P Sbjct: 536 PPPPPPPP------GTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P G GG P PPPP P PP PP PP P Sbjct: 575 PSPPPMPMGNSGSGG-----PPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPP 625 Score = 33.5 bits (73), Expect = 7.0 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 6/58 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPPPXP--PXXGGXXXPXAPXXXA 724 PPPPP G PPPPPP GPPPP P G P P A Sbjct: 592 PPPPPMPLANGAT-----PPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPPPGAA 644 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 61.3 bits (142), Expect = 3e-08 Identities = 27/57 (47%), Positives = 27/57 (47%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPPP PP P P PPPPP PP P PP P P PP Sbjct: 16 PPPPHCPPPPPPPPPPP------PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 60.5 bits (140), Expect = 5e-08 Identities = 26/51 (50%), Positives = 26/51 (50%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 PPPPPP P PPPP PP P P PPPPP PP P PP P Sbjct: 22 PPPPPPPPPPPPPPPPPPP------PPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 54.8 bits (126), Expect = 3e-06 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPPP P P PPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 54.0 bits (124), Expect = 5e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPPP P P PPPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 >UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 1065 Score = 61.3 bits (142), Expect = 3e-08 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPP PP P PPP PP P P PPP P Sbjct: 498 PPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 557 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 558 PSPPPSPP-PSPPPSPPP 574 Score = 60.9 bits (141), Expect = 4e-08 Identities = 26/59 (44%), Positives = 28/59 (47%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PPP PP P +P P PPP PP P PP P+ P PP Sbjct: 481 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPP-PSPPPSPPP 538 Score = 58.4 bits (135), Expect = 2e-07 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PP PPP P PPP PP P P PPP P Sbjct: 479 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPSPPPSPPPSPPPSPP 537 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 538 PSPPPSPP-PSPPPSPPP 554 Score = 58.0 bits (134), Expect = 3e-07 Identities = 26/70 (37%), Positives = 26/70 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PP PPP P PPP PP P P PPP P Sbjct: 506 PPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 565 Query: 749 PXPXAGPPXP 778 P P PP P Sbjct: 566 PSPPPSPPPP 575 Score = 56.8 bits (131), Expect = 7e-07 Identities = 28/78 (35%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPP PP P PPP PP P +P PPP P P Sbjct: 505 PPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPS--PPPSPPP 562 Query: 749 PXPXAGPPXPAAPXXXPP 802 P + PP P P P Sbjct: 563 SPPPSPPPSPPPPPHFAP 580 Score = 55.2 bits (127), Expect = 2e-06 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PP PPP P PPP PP P P PPP P Sbjct: 514 PPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 573 Query: 749 PXPXAGPPXPAA 784 P P P P A Sbjct: 574 PPPHFAPFVPLA 585 Score = 54.8 bits (126), Expect = 3e-06 Identities = 27/77 (35%), Positives = 29/77 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PP PPP P PPP PP P P + PP PP Sbjct: 502 PPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPS 559 Query: 749 PXPXAGPPXPAAPXXXP 799 P P P P +P P Sbjct: 560 PPPSPPPSPPPSPPPPP 576 Score = 54.4 bits (125), Expect = 4e-06 Identities = 24/59 (40%), Positives = 26/59 (44%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P PP P PPP PP P +P P PPP PP PP P+ P PP Sbjct: 477 PTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPP-PSPPPSPPP 534 Score = 52.4 bits (120), Expect = 1e-05 Identities = 25/61 (40%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +2 Query: 629 PPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPPXPP--XPXAGPPXPAAPXXXP 799 P P P P P PPP PP P +P P PPP PP P + PP P +P P Sbjct: 469 PTPTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSP 528 Query: 800 P 802 P Sbjct: 529 P 529 Score = 51.2 bits (117), Expect = 3e-05 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP-XPAAPXXXPP 802 P P P P PPP PP P P PPP PP P PP P +P PP Sbjct: 475 PTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPP 533 Score = 49.2 bits (112), Expect = 1e-04 Identities = 25/73 (34%), Positives = 27/73 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PP PPP P PPP PP P P + PP PP P Sbjct: 518 PPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP--SPPPSPPPP 575 Query: 749 PXPXAGPPXPAAP 787 P P + P Sbjct: 576 PHFAPFVPLASVP 588 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P P PPP P P PPP PP P PP PP Sbjct: 514 PPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 573 Query: 420 PP 415 PP Sbjct: 574 PP 575 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP PPP P P P PPP P P P PPP P Sbjct: 481 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSP 540 Query: 420 PP 415 PP Sbjct: 541 PP 542 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP PPP P P P PPP P P P PPP P Sbjct: 485 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSP 544 Query: 420 PP 415 PP Sbjct: 545 PP 546 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PP PP P P PPP PP P P PPP P Sbjct: 490 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPP-PSPPPSPPPSP 548 Query: 420 PP 415 PP Sbjct: 549 PP 550 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PP PP P P PPP PP P P PPP P Sbjct: 494 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSP 552 Query: 420 PP 415 PP Sbjct: 553 PP 554 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PPP PP P P PPP PPP Sbjct: 479 PSPPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPPP 519 Score = 43.2 bits (97), Expect = 0.009 Identities = 30/110 (27%), Positives = 31/110 (28%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 P P P P P PPP PP P P PPP PPP P Sbjct: 471 PTPTPTPTPSPPPSPPPSPPPSPPPSPP-PSPPPSPPPSPPPSPPPSPPPSPPSPPPSPP 529 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXP 211 P P P PP P PP P +P P Sbjct: 530 PS----PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPP 575 Score = 42.7 bits (96), Expect = 0.011 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP PPP P P P P PPP P P PPPPP Sbjct: 517 PPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPP 576 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P + P PP PPP P PPP PP PP P Sbjct: 506 PPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 561 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P + P PP PPP P PPP PP PP P Sbjct: 510 PPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 565 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P + P PP PPP P PPP PP PP P Sbjct: 514 PPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 569 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PP PPP P PPP PP PP P Sbjct: 518 PPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 573 Score = 41.9 bits (94), Expect = 0.020 Identities = 28/102 (27%), Positives = 29/102 (28%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXX 319 P P PPP PP P P PPP PPP PP Sbjct: 473 PTPTPTPSPPPSPP-PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPS 531 Query: 318 XXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PP P PP P +P P P Sbjct: 532 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 573 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PPP PP PP P Sbjct: 490 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPP 545 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PPP PP PP P Sbjct: 494 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 549 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PP PPP P PPP PP PP P Sbjct: 498 PPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 553 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PP PPP P PPP PP PP P Sbjct: 502 PPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 557 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P P PP + P PP PPP P PPP PP PP Sbjct: 522 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 574 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP + P PP PPP P PPP PP Sbjct: 475 PTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 515 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP + P PP PPP P PPP PP Sbjct: 479 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 519 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PP PP PP P Sbjct: 482 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPP 537 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PP PP PP P Sbjct: 486 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPP 541 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPP +PPP PPP Sbjct: 489 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPP 530 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPP +PPP PPP Sbjct: 493 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPP 534 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP P PPP P P P PPP PPP Sbjct: 495 PSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 554 Query: 421 PPP 413 PP Sbjct: 555 SPP 557 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP PPP P P P PPP +PPP P Sbjct: 505 PPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 564 Query: 418 PP 413 PP Sbjct: 565 PP 566 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP PPP P P P PPP +PPP P Sbjct: 509 PPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 568 Query: 418 PP 413 PP Sbjct: 569 PP 570 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP PPP P P P PPP +PPP P Sbjct: 513 PPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 572 Query: 418 PP 413 PP Sbjct: 573 PP 574 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P P + P PP PPP P PPP PP Sbjct: 471 PTPTPTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 511 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 1/64 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPP-PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP 425 PPP PP PPP P PP PP P P Sbjct: 513 PPPSPPPSPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 572 Query: 424 PPPP 413 PPPP Sbjct: 573 PPPP 576 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PPP P PPP PP PP P Sbjct: 475 PTPTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 510 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPP P P P P PP PP P Sbjct: 485 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPPPSPPPSP 540 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP-PPXXPPXXGGXXXXXXPPGXP 725 P PPP P PPP P P P PP PP PP P Sbjct: 477 PTPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPPSPPPSPP 533 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPP PPP PP Sbjct: 481 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 522 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPP PP PPP Sbjct: 485 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPSPPP 526 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP-PPPXPXXPXXPPPP 424 P PP P PPP P P PPP PPP P PPPP Sbjct: 522 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP-----PPPP 576 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 61.3 bits (142), Expect = 3e-08 Identities = 29/73 (39%), Positives = 30/73 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP PPPP PP P + PPPPP P Sbjct: 644 PPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPP-------PPSRNGAPPPPPPPPP 696 Query: 749 PXPXAGPPXPAAP 787 P PP P P Sbjct: 697 PSKTGAPPPPPPP 709 Score = 60.5 bits (140), Expect = 5e-08 Identities = 30/73 (41%), Positives = 30/73 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP G PPP PP P A PPPPP P Sbjct: 643 PPPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPP-------PPPSRNGAPPPPPPPP 695 Query: 749 PXPXAGPPXPAAP 787 P G P P P Sbjct: 696 PPSKTGAPPPPPP 708 Score = 57.2 bits (132), Expect = 5e-07 Identities = 28/65 (43%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = +2 Query: 626 PPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 PPPPPP P PPPP PP P P PPPPP PP G P P P Sbjct: 642 PPPPPPPPLPNTQVPPPPPPP-----PPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPP 696 Query: 797 PPXXG 811 P G Sbjct: 697 PSKTG 701 Score = 54.8 bits (126), Expect = 3e-06 Identities = 27/63 (42%), Positives = 27/63 (42%), Gaps = 3/63 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX---PGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G PPPPPP P PPPP PP G P P PPP Sbjct: 662 PPPPPPPSKNGAP----PPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPP 717 Query: 740 PXP 748 P P Sbjct: 718 PPP 720 Score = 53.2 bits (122), Expect = 8e-06 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 8/78 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP-----XXXPGPPPPXPPXXGG---XXXPXAPXXXA 724 PPPPP PPPPPP P PPPP PP G P P Sbjct: 645 PPPPPLPNTQ----VPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKT 700 Query: 725 XPPPPPXPPXPXAGPPXP 778 PPPP PP PP P Sbjct: 701 GAPPPPPPPRIGGAPPPP 718 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 T PPPPP + P P PPPPP P PPPPPP Sbjct: 638 TALLPPPPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPPP 682 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP T PPPPP P PPPPPP P PPPPP Sbjct: 642 PPPPPP-----PPLPNTQVPPPPPPPPP----PPPPSKNGAPPPPPPPPPSRNGAPPPPP 692 Query: 420 PP 415 PP Sbjct: 693 PP 694 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX-PPPPPXXXXXXXT--P 431 PPPP PPPPP G P P PPPPP T P Sbjct: 644 PPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAP 703 Query: 430 PPPPPP 413 PPPPPP Sbjct: 704 PPPPPP 709 Score = 46.8 bits (106), Expect = 7e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXG-EXXKXPXXPXXXXXPPPPPXXXXXXXTPPP 425 PPPP G PPPPP G P P PPPP PPP Sbjct: 658 PPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPPRIGGAPPP 717 Query: 424 PPP 416 PPP Sbjct: 718 PPP 720 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP G P PPPPPP PPP PP GG P G Sbjct: 674 PPPPPPPPPSRNGA-----PPPPPPPPPPSKTGAPPPPPPPRIGGAPPPPPPLG 722 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 3/56 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX---PXPPPXXPPXXGGXXXXXXPP 716 P PPPP G P PPPPPP P PPP PP G PP Sbjct: 658 PPPPPPPPPPPSKNGA----PPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPPP 709 Score = 40.7 bits (91), Expect = 0.046 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP A P PPPP P PPP PP PP Sbjct: 656 PPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPPPP 708 Score = 40.3 bits (90), Expect = 0.061 Identities = 28/88 (31%), Positives = 28/88 (31%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX 295 PPPPPP P PPPPPP G PP P Sbjct: 642 PPPPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPP-------PPSRNGAPPPPPPP 694 Query: 294 PGXXXXGXXPPPPXXXXPPRXPXTPXXP 211 P G PPPP PPR P P Sbjct: 695 PPPSKTGAPPPPP----PPRIGGAPPPP 718 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PPPPP PP P P P P PP GA Sbjct: 642 PPPPPPPPLPNTQVPPPPPPPPPPPPPSKNGA 673 Score = 37.1 bits (82), Expect = 0.57 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 662 PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PPP PP P P PPPPP PP P A P PP GA Sbjct: 642 PPPPPP-------PPLPNTQVPPPPPP-PPPPPPPSKNGAPPPPPPPPPSRNGA 687 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +3 Query: 609 AXXPXXPPPPP------PXXXPXPPPXXPPXXGGXXXXXXPP 716 A P PPPPP P P PPP PP G PP Sbjct: 639 ALLPPPPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPP 680 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 642 PPPPPP--------PPLPNTQVPPPPPP--------PPPPPPP 668 >UniRef50_UPI00015B5315 Cluster: PREDICTED: similar to Heterogeneous nuclear ribonucleoprotein K; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to Heterogeneous nuclear ribonucleoprotein K - Nasonia vitripennis Length = 445 Score = 60.9 bits (141), Expect = 4e-08 Identities = 34/78 (43%), Positives = 35/78 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G GP G GG GGGGG G G GG GGGPG GGGGG Sbjct: 241 GGGGGRGGGMSGPDRGFGGGGGGGGGNPRGGIGGGNFGGDRGG-NGGGPGMGGGGGGG-- 297 Query: 621 XXXXXKXPPPPXXGGGGG 568 + PP GGGGG Sbjct: 298 -FNGNRGGPPYSGGGGGG 314 Score = 55.2 bits (127), Expect = 2e-06 Identities = 35/90 (38%), Positives = 35/90 (38%), Gaps = 1/90 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG-GGGG 625 GG G GGP G G GGGGG G G GG GGGG G GG GGG Sbjct: 221 GGPDMNRGGFGGPGMGGGRGGGGGGRGG--GMSGPDR--GFGGGGGGGGGNPRGGIGGGN 276 Query: 624 XXXXXXKXPPPPXXGGGGGXXXXXTXXXPP 535 P GGGGG PP Sbjct: 277 FGGDRGGNGGGPGMGGGGGGGFNGNRGGPP 306 Score = 51.2 bits (117), Expect = 3e-05 Identities = 36/95 (37%), Positives = 36/95 (37%), Gaps = 14/95 (14%) Frame = -2 Query: 810 PXXGGXXXGAAGXGG-PAXGXGGXGGGGGXAXXXGAXGXXX-----PPXXGGXGG----- 664 P GG G G GG P G GG GG A G G P GG GG Sbjct: 168 PAGGGGGGGGGGPGGKPGGGFGGGRGGPPNAPPGGGPGGPMNRGGRPDNRGGGGGPDMNR 227 Query: 663 ---GGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGPG G GGGG P GGGGG Sbjct: 228 GGFGGPGMGGGRGGGGGGRGGGMSGPDRGFGGGGG 262 Score = 50.0 bits (114), Expect = 8e-05 Identities = 35/90 (38%), Positives = 35/90 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G G G GG GGGG G PP GG GGGG G GGGGGG Sbjct: 274 GGNFGGDRGGNGGGPGMGGGGGGGFNGNRGG------PPYSGG-GGGGAGGGGGGGGGGN 326 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPP 532 GGGGG T P Sbjct: 327 YNGNGW-----GSGGGGGAGGGNTGMGNAP 351 Score = 46.8 bits (106), Expect = 7e-04 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 9/90 (10%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGG------XGGGGGXAXXXGAXGXXXPPXXGG---XGGGG 658 P G G G G P G GG GG GG G G GG GGGG Sbjct: 253 PDRGFGGGGGGGGGNPRGGIGGGNFGGDRGGNGGGPGMGGGGGGGFNGNRGGPPYSGGGG 312 Query: 657 PGXXXGGGGGGXXXXXXKXPPPPXXGGGGG 568 G GGGGGG GG GG Sbjct: 313 GGAGGGGGGGGGGNYNGNGWGSGGGGGAGG 342 Score = 44.8 bits (101), Expect = 0.003 Identities = 28/73 (38%), Positives = 29/73 (39%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G G G GG GGGGG G GG GG P GGG GG Sbjct: 160 GGYGENGQPAGGGGGGGGGGPGGKPGGG-------FGGGRGGPPNAPPGGGPGGPMNRGG 212 Query: 606 KXPPPPXXGGGGG 568 + P GGGGG Sbjct: 213 R---PDNRGGGGG 222 Score = 44.0 bits (99), Expect = 0.005 Identities = 31/82 (37%), Positives = 31/82 (37%), Gaps = 9/82 (10%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGG-----GXAXXXGAXGXXXPPXXGGXGG----GGPGXXXGGG 634 G G PA G GG GGGG G G G P GG GG GG GGG Sbjct: 161 GYGENGQPAGGGGGGGGGGPGGKPGGGFGGGRGGPPNAPPGGGPGGPMNRGGRPDNRGGG 220 Query: 633 GGGXXXXXXKXPPPPXXGGGGG 568 GG P G GGG Sbjct: 221 GGPDMNRGGFGGPGMGGGRGGG 242 Score = 43.2 bits (97), Expect = 0.009 Identities = 44/139 (31%), Positives = 45/139 (32%), Gaps = 3/139 (2%) Frame = +2 Query: 194 GXPGPPGXXGVXGX--RGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGX 367 G P P G G RGG GGG P G + GG Sbjct: 194 GPPNAPPGGGPGGPMNRGGRPDNRGGGGGPDMNRGGFGGPGMGGGRGGGGGGR---GGGM 250 Query: 368 XXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGG-GGXXXXXGXGXFXXFPXXXGGGGGX 544 P F GGGGGGG G GGG GG G G P GGGGG Sbjct: 251 SGPD--------RGFGGGGGGGGGNPRGGIGGGNFGGDRGGNGGG-----PGMGGGGGG- 296 Query: 545 XXVXXXXXPPPPPXXGGGG 601 PP GGGG Sbjct: 297 -GFNGNRGGPPYSGGGGGG 314 Score = 42.3 bits (95), Expect = 0.015 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 4/84 (4%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXG----XGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 P GG GA G GG G G G GGG G G P GG G G Sbjct: 306 PYSGGGGGGAGGGGGGGGGGNYNGNGWGSGGGGGAGGGNTGMGNAPMSGGNNAGSQGGAA 365 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGG 571 GG K G GG Sbjct: 366 GGNATSTQVTIPKDLAGAIIGKGG 389 Score = 41.9 bits (94), Expect = 0.020 Identities = 43/150 (28%), Positives = 44/150 (29%), Gaps = 14/150 (9%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G G P G G GG GGG P + GG Sbjct: 163 GENGQPAGGGGGGGGGGPGGKPGGGFGGGRGGPPNAPPGGGPGGPMNRGGRPDNRGGGGG 222 Query: 374 PPPPXPXXXXXXFXGG--GGGGGXXGXX-------GXGGGGGG--XXXXXGXGXFXXFPX 520 P GG GGGGG G G GGGGGG G G F Sbjct: 223 PDMNRGGFGGPGMGGGRGGGGGGRGGGMSGPDRGFGGGGGGGGGNPRGGIGGGNFGGDRG 282 Query: 521 XXGGG---GGXXXVXXXXXPPPPPXXGGGG 601 GGG GG PP GGGG Sbjct: 283 GNGGGPGMGGGGGGGFNGNRGGPPYSGGGG 312 Score = 41.1 bits (92), Expect = 0.035 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 4/69 (5%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGG----PG 652 PP GG G GG GG GG G G GG G GG P Sbjct: 195 PPNAPPGGGPGGPMNRGGRPDNRGGGGGPDMNRGGFGGPGMGGGRGGGGGGRGGGMSGPD 254 Query: 651 XXXGGGGGG 625 GGGGGG Sbjct: 255 RGFGGGGGG 263 Score = 38.3 bits (85), Expect = 0.25 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = -2 Query: 723 AXXXGAXGXXXPPXXGG--XGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGG 577 A G G P GG GGGGPG GGG GG PP GG Sbjct: 156 AEEYGGYGENGQPAGGGGGGGGGGPGGKPGGGFGGGRGGPPNAPPGGGPGG 206 Score = 37.5 bits (83), Expect = 0.43 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = -2 Query: 810 PXXGGXXXGA--AGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P GG G GGP GG GGG G G G G GGGG G G Sbjct: 288 PGMGGGGGGGFNGNRGGPPYS-GGGGGGAGGGGGGGGGGNYNGNGWGSGGGGGAGGGNTG 346 Query: 636 GG 631 G Sbjct: 347 MG 348 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +2 Query: 416 GGGGGGGXXGXXGX----GGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G + G GG Sbjct: 291 GGGGGGGFNGNRGGPPYSGGGGGGAGGGGGGGGGGNYNGNGWGSGG 336 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/61 (31%), Positives = 21/61 (34%) Frame = +1 Query: 361 GXXXPPPPXXXXXXXSXXGGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 G PP + GGGGGGG G GGG G G P G G Sbjct: 300 GNRGGPPYSGGGGGGAGGGGGGGGGGNYNGNGWGSGGGGGAGGGNTGMGNAPMSGGNNAG 359 Query: 541 A 543 + Sbjct: 360 S 360 Score = 36.3 bits (80), Expect = 1.00 Identities = 33/116 (28%), Positives = 34/116 (29%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G G PG G G GG GGG P G G Sbjct: 228 GGFGGPGMGG--GRGGGGGGRGGGMSGPDRGFGGGGGGGGGNPRGGIGGGNFGGDRGGNG 285 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 P F G GG G G G GGGG G G + GGGGG Sbjct: 286 GGPGMGGGGGGGFNGNRGGPPYSGGGGGGAGGGG--GGGGGGNYNGNGWGSGGGGG 339 Score = 36.3 bits (80), Expect = 1.00 Identities = 24/63 (38%), Positives = 24/63 (38%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG GGG G G P GGGGG PP G Sbjct: 258 GGGGGGGGGNPRGGIGGGNFGGDRGGNGG----GPGMGGGGGGGFNGNRGG---PPYSGG 310 Query: 594 GGG 602 GGG Sbjct: 311 GGG 313 >UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 311 Score = 60.9 bits (141), Expect = 4e-08 Identities = 29/63 (46%), Positives = 29/63 (46%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P GG G G GG G GG GGGGG G G GG GGGG G GG Sbjct: 176 PGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGG 235 Query: 636 GGG 628 GGG Sbjct: 236 GGG 238 Score = 60.1 bits (139), Expect = 7e-08 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGGG Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGG 238 Score = 59.3 bits (137), Expect = 1e-07 Identities = 30/62 (48%), Positives = 30/62 (48%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 P GG G G GG G GG GGGGG G G GG GGGG G GGGG Sbjct: 176 PGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGGGGG 229 Query: 630 GG 625 GG Sbjct: 230 GG 231 Score = 59.3 bits (137), Expect = 1e-07 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG G GGGG G Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGRG 240 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 221 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 222 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 182 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 223 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 224 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 184 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 225 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 226 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 227 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 228 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 188 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 229 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 189 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 230 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 190 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 231 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 197 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGG 238 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGG Sbjct: 196 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGG 237 Score = 44.4 bits (100), Expect = 0.004 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GGGGG G G GGGGGG G G GGGGG GG Sbjct: 177 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGG 236 Query: 596 GG 601 GG Sbjct: 237 GG 238 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 688 PXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 P GG GGG G GGGGGG G GGGG G Sbjct: 176 PGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 219 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 P GG GGG G GGGGGG G GGGG G Sbjct: 176 PGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 220 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 179 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSG 234 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 180 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGG 235 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGGGGG G G GGGGG G G Sbjct: 213 GGGGGGGGGGGGGGGGGGGRSGGGGGRG 240 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGG 569 G GG GG GGG G GGGGGG G GGGG Sbjct: 177 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 228 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGG 569 G GG GG GGG G GGGGGG G GGGG Sbjct: 186 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGG 237 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGG 569 G GG GG GGG G GGGGGG G GGGG Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGG 238 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGG G Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGGGGRG 240 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 GGGGGGG GGGGG G G GGGGG R Sbjct: 194 GGGGGGGGGGGGGGGGGGGGGGGGGGG-------GGGGGGGGGGGR 232 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGG G Sbjct: 181 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRSGGG 236 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 G GGGGG GGGGG G G GGGGG Sbjct: 177 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 219 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXS 515 GGGGGGG GGGGG G G L S Sbjct: 212 GGGGGGGGGGGGGGGGGGGGRSGGGGGRGILLSS 245 >UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 9.t00033 - Entamoeba histolytica HM-1:IMSS Length = 540 Score = 60.9 bits (141), Expect = 4e-08 Identities = 35/82 (42%), Positives = 35/82 (42%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXG-GXXXPXAPXXXAXPPPPPX 745 PPPPP G G C PPPP G PPP PP G G P P PPPPP Sbjct: 385 PPPPPARGTG---CGAPPPPPPPAFDTGCGIPPPPPPARGTGCGAPPPPPPLNAPPPPP- 440 Query: 746 PPXPXAG---PPXPAAPXXXPP 802 PP G PP P PP Sbjct: 441 PPAHGTGCGVPPPPPPSLNNPP 462 Score = 58.0 bits (134), Expect = 3e-07 Identities = 34/87 (39%), Positives = 34/87 (39%), Gaps = 9/87 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXA----- 724 PPPPP GG PPPPPP G PPPP P G P P A Sbjct: 357 PPPPPSYGG------HHNVPPPPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPPAFDTGC 410 Query: 725 -XPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP G P P P PP Sbjct: 411 GIPPPPPPARGTGCGAPPPPPPLNAPP 437 Score = 50.8 bits (116), Expect = 4e-05 Identities = 32/92 (34%), Positives = 32/92 (34%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P G G PPPP G G PPPP G Sbjct: 373 PPPAFDTGCGVPPPPPPARGTGCGAPPP--PPPPAFDTGCGIPP------PPPPARGTGC 424 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P PPPPPP PPPPPP Sbjct: 425 GAPPPPPPLNAPPPPPPPAHGTGCGVPPPPPP 456 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPPP G PPPPP P P PPPPP Sbjct: 394 GCGAPPPPPPPAFDTG------CGIPPPPPPARGTGCGAPPPPPPLNAPPPPPPPAHGTG 447 Query: 439 XTPPPPPPP 413 PPPPPP Sbjct: 448 CGVPPPPPP 456 Score = 46.0 bits (104), Expect = 0.001 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G C PPPPPP G PPP PP P PPP Sbjct: 400 PPPPPAFDTG---CGI---PPPPPPARGTGCGAPPPPPPLNAPPPPPPPAHGTGCGVPPP 453 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P + P P Sbjct: 454 PPPSLNNPPSNISTPKASAP 473 Score = 44.4 bits (100), Expect = 0.004 Identities = 40/132 (30%), Positives = 40/132 (30%), Gaps = 5/132 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX-----PPPPPPXPXXPXX 436 PPPP GG PPPP G P P PPPPPP Sbjct: 356 PPPPPPSYGG----HHNVPPPPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPPAFDTGCG 411 Query: 435 PPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPP 256 PPPPPP G G G PP P G PPPP Sbjct: 412 IPPPPPPAR------GTGCGAPPPPPPL---------NAPPPPPPPAHGTGCGVPPPPPP 456 Query: 255 XXXXPPRXPXTP 220 PP TP Sbjct: 457 SLNNPPSNISTP 468 Score = 43.6 bits (98), Expect = 0.007 Identities = 36/116 (31%), Positives = 36/116 (31%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP G P PPPPP PPPPPP G G G P Sbjct: 356 PPPPPPSYGGHHNVP-------PPPPPAFDTGCGVPPPPPPAR-------GTGCGAPPPP 401 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P F P P PPPP P P P G G P Sbjct: 402 PPPAF------DTGCGIPPPPPPARGTGCGAPPPPPPLNAPPPPPPPAHGTGCGVP 451 Score = 43.6 bits (98), Expect = 0.007 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXX-----PPPPPXXXXXXXTPPPPPPP 413 PPPPP G P P PPPPP PPPPPPP Sbjct: 357 PPPPPSYGGHHNVPPPPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPP 404 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 7/50 (14%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXP-------XPPPPPXXLXXXXNPPPPPPP 414 APPPPP G P PPPPP PPPPPPP Sbjct: 355 APPPPPPSYGGHHNVPPPPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPP 404 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 60.9 bits (141), Expect = 4e-08 Identities = 37/94 (39%), Positives = 38/94 (40%), Gaps = 11/94 (11%) Frame = +2 Query: 569 PPPPPXXG------GGGXXCXXXXXPPPPPPXXXPGPP----PPXPPXXGGXXXPXAPXX 718 PPPPP G GG PPPPPP P PP PP PP GG P P Sbjct: 29 PPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPPP--GGYPPPPPPQG 86 Query: 719 XAXPPPPPXPPXPXAGPPXPAAP-XXXPPXXGXG 817 + PPPPP P P P PP G G Sbjct: 87 GSYPPPPPPGAAGYPPPGYPGGPGAGYPPAGGFG 120 Score = 56.8 bits (131), Expect = 7e-07 Identities = 35/88 (39%), Positives = 36/88 (40%), Gaps = 5/88 (5%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP---XPPXXGGXXXPXAPXXXAXPPPPP- 742 PPP GG PPPPP P PPPP PP G P P PPPPP Sbjct: 10 PPPPDGG--------YPPPPPPDGGYPPPPPPDGGYPPAQPGGFGP-PPQGGYPPPPPPG 60 Query: 743 -XPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PP P G P P PP GG+ Sbjct: 61 GYPPPPQGGFPPPPPGGYPPPPPPQGGS 88 Score = 54.4 bits (125), Expect = 4e-06 Identities = 37/111 (33%), Positives = 37/111 (33%), Gaps = 8/111 (7%) Frame = -2 Query: 666 GGGPGXXXGGGGGGXXXXXXKXPPPPXXGG-----GGGXXXXXTXXXPPPPPXXXGXXXK 502 G P GG PPPP GG GG PPPPP G Sbjct: 7 GNNPPPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPP--GGYPP 64 Query: 501 XPXPXXXXXPP---PPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PP PPPP P PPPPPP GG G PP Sbjct: 65 PPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPPGYPGGPGAGYPP 115 Score = 52.0 bits (119), Expect = 2e-05 Identities = 38/108 (35%), Positives = 39/108 (36%), Gaps = 4/108 (3%) Frame = +2 Query: 512 FPXXXGGGGGXXXVXXXXXPPPP----PXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPP 679 +P GG G PPPP P GG PPPPPP PPPP PP Sbjct: 37 YPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPP-PP 95 Query: 680 XXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 G P P P PP G P AP P G GGA Sbjct: 96 GAAGYPPPGYPGG----PGAGYPPAGGFGQPGGYAPVGAP---GFGGA 136 Score = 46.8 bits (106), Expect = 7e-04 Identities = 35/110 (31%), Positives = 35/110 (31%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP GG P GG G PPPP GG PPPPP G Sbjct: 28 PPPPPPDGGYPPAQP---GGFGPPPQGGYPPPPPP----GGYPPPPQGGFPPPPP---GG 77 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 P P PPPPPP P P P G G G P Sbjct: 78 YPPPPPPQGGSYPPPPPPGAAGYPPPGYPGGPGAGYPPAGGFGQPGGYAP 127 Score = 45.6 bits (103), Expect = 0.002 Identities = 29/90 (32%), Positives = 31/90 (34%), Gaps = 7/90 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX---PXPXXXXXPPPP----PPXPXXP 442 PPPP GG PP P G + P P PPPP PP P P Sbjct: 18 PPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPP--P 75 Query: 441 XXPPPPPPPXXXXXXXXGXGGGGXXXPPXF 352 PPPPPP G PP + Sbjct: 76 GGYPPPPPPQGGSYPPPPPPGAAGYPPPGY 105 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +3 Query: 537 GGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 GG P PPPP GG PPPPPP PPP P GG P Sbjct: 68 GGFPPPPPGGYPPPPPPQGGS--------YPPPPPPGAAGYPPPGYP---GGPGAGYPPA 116 Query: 717 G 719 G Sbjct: 117 G 117 Score = 38.7 bits (86), Expect = 0.19 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 3/73 (4%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP---XXPPXX 686 P GG G PPPP GG PPPPP P PPP PP Sbjct: 38 PPAQPGGFGPPPQGGYPPPPPP----GGYPPPPQGGFPPPPPGGYPPPPPPQGGSYPPPP 93 Query: 687 GGXXXXXXPPGXP 725 PPG P Sbjct: 94 PPGAAGYPPPGYP 106 Score = 38.3 bits (85), Expect = 0.25 Identities = 31/106 (29%), Positives = 32/106 (30%), Gaps = 14/106 (13%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGG------GGXXXPPXFFFLXXXXXXXXXX 313 PP P P PPPPPP GG GG PP + Sbjct: 5 PPGNNPPPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPP 64 Query: 312 XXXXPXPGXXXXGXXPPPP---XXXXPPRXPXT-----PXXPGGPG 199 P G PPPP PP P P PGGPG Sbjct: 65 PPQGGFPPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPPPGYPGGPG 110 Score = 38.3 bits (85), Expect = 0.25 Identities = 26/78 (33%), Positives = 27/78 (34%), Gaps = 9/78 (11%) Frame = +3 Query: 513 SPXXXGGGGGXXXXXPXXXPPPPXXXGG-----GGXXAXXP--XXPPPPPPXXXPXPPP- 668 +P GG PPPP GG G P PPPPPP P PP Sbjct: 9 NPPPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQG 68 Query: 669 -XXPPXXGGXXXXXXPPG 719 PP GG P G Sbjct: 69 GFPPPPPGGYPPPPPPQG 86 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP----PXPAAPXXXPPXXG 811 PG PP P GG P P PPPPP P A P P P PP G Sbjct: 6 PGNNPP--PPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPG 60 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPP----XPPXPXAG---PPXPAAPXXXPP 802 PP PP G P P PPPPP PP G PP P PP Sbjct: 5 PPGNNPPPPDGGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPP 59 Score = 34.3 bits (75), Expect = 4.0 Identities = 30/101 (29%), Positives = 31/101 (30%) Frame = -1 Query: 718 PGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXP 539 P + PP GG GG G PPPP GG P Sbjct: 22 PPDGGYPPPPPPDGGYPPAQP------GGFGPPPQGGYPPPPPP----GGYPPPPQGGFP 71 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 PPPP P P PPPPP PPP P Sbjct: 72 PPPPG----GYPPPPPPQGGSYPPPPPPGAAGY--PPPGYP 106 >UniRef50_Q948Y7 Cluster: VMP3 protein; n=1; Volvox carteri f. nagariensis|Rep: VMP3 protein - Volvox carteri f. nagariensis Length = 687 Score = 60.9 bits (141), Expect = 4e-08 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P PPPP P PPP PP P P PPPP PP Sbjct: 579 PPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 639 PPSPPPPSPRPPTPPPP 655 Score = 60.9 bits (141), Expect = 4e-08 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXP 748 PP P PPPP P P PPPP PP P P PPPP P Sbjct: 584 PPSPDPPSAPPPSPPPPSPPPPNPPP-PSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSP 642 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 643 PPPSPRPPTPPPPSPPPP 660 Score = 59.7 bits (138), Expect = 9e-08 Identities = 30/78 (38%), Positives = 31/78 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPP P P PPPP PP P P + PPP P P Sbjct: 593 PPPSPPPPSPPPPNPPPPSPPPPNPPP-PSPPPPSPPPPS--PPPPNPPPPSPPPPSPRP 649 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P P PP Sbjct: 650 PTPPPPSPPPPRPPPRPP 667 Score = 58.8 bits (136), Expect = 2e-07 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP P PPPP PP P P PPP P PP P PP P P PP Sbjct: 479 PPSPPP---PSPPPPRPPPPS--PVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPP 532 Score = 56.8 bits (131), Expect = 7e-07 Identities = 25/60 (41%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPP-XXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP P PP P +P PP PP P P PP P++P PP Sbjct: 483 PPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPP 542 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPPP P PPPP PP P +P PPP P P Sbjct: 602 PPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPS--PPPPSPRPPTPPPPSPPP 659 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 660 PRP---PPRPPPTRRSPP 674 Score = 56.4 bits (130), Expect = 9e-07 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPP PP P PP P P P P PP P Sbjct: 528 PRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSP 587 Query: 749 PXPXAGPPXPAAPXXXPP 802 P A PP P P PP Sbjct: 588 DPPSAPPPSPPPPSPPPP 605 Score = 55.6 bits (128), Expect = 2e-06 Identities = 26/73 (35%), Positives = 28/73 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPP P P PPPP PP P P PPP P Sbjct: 608 PPPSPPPPNPPPPSPPPPSPPPPSPPP-PNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRP 666 Query: 749 PXPXAGPPXPAAP 787 P PP ++P Sbjct: 667 PPTRRSPPPTSSP 679 Score = 55.2 bits (127), Expect = 2e-06 Identities = 27/78 (34%), Positives = 27/78 (34%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-PPXXGGXXXPXAPXXXAXPPPPPXP 748 P PP P PP P P PP PP P P PPPP P Sbjct: 558 PSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNP 617 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 618 PPPSPPPPSPPPPSPPPP 635 Score = 54.0 bits (124), Expect = 5e-06 Identities = 28/78 (35%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPP P P P PP PP P P P PPP P Sbjct: 482 PPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPP-------PRPPSPRPPPRPPPRP 534 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P+ P PP Sbjct: 535 SSPRPPPPDPSPPPPSPP 552 Score = 51.6 bits (118), Expect = 2e-05 Identities = 27/81 (33%), Positives = 29/81 (35%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP---PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP P PPP PPP P PPP PP P PPPP Sbjct: 483 PPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPP 542 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P + P P +P P Sbjct: 543 DPSPPPPSPPSPPTSPSPPDP 563 Score = 51.2 bits (117), Expect = 3e-05 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP-PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP PPPP P P P P PPPP P P PPP Sbjct: 597 PPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPS 656 Query: 423 PPP 415 PPP Sbjct: 657 PPP 659 Score = 50.4 bits (115), Expect = 6e-05 Identities = 26/79 (32%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P P PP P P PP P P +P + PP P P Sbjct: 530 PPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDP 589 Query: 749 P-XPXAGPPXPAAPXXXPP 802 P P PP P+ P PP Sbjct: 590 PSAPPPSPPPPSPPPPNPP 608 Score = 50.0 bits (114), Expect = 8e-05 Identities = 28/73 (38%), Positives = 29/73 (39%), Gaps = 2/73 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPP P P PP PP P P PPP PP P P PP PP Sbjct: 493 PPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPP 552 Query: 743 XPPXPXAGPPXPA 781 PP + PP PA Sbjct: 553 SPPTSPS-PPDPA 564 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P P PPPP P P PPP PPP Sbjct: 593 PPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPP 634 Score = 48.0 bits (109), Expect = 3e-04 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP-PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP PPPP P P P P PPPP P P PP P Sbjct: 607 PPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRP 666 Query: 423 PP 418 PP Sbjct: 667 PP 668 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP-PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP PPPP P P P P P PP P P PPP Sbjct: 602 PPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPR 661 Query: 423 PPP 415 PPP Sbjct: 662 PPP 664 Score = 46.4 bits (105), Expect = 0.001 Identities = 36/141 (25%), Positives = 37/141 (26%), Gaps = 5/141 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPPP PPP PP P P PP PPP P P PP Sbjct: 482 PPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPP 541 Query: 429 PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPP--PP 256 P P P P + L P PP PP Sbjct: 542 PDPSPPPPSPPSPPTSPS--PPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPPP 599 Query: 255 XXXXPPRXPXTPXXPGGPGXP 193 PP P P P P Sbjct: 600 PSPPPPNPPPPSPPPPNPPPP 620 Score = 46.4 bits (105), Expect = 0.001 Identities = 29/88 (32%), Positives = 29/88 (32%), Gaps = 11/88 (12%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPP---------XXXPGPPPPXPPXXGGXXXPXAPXXXA 724 PPP PPP PP P PPPP PP P P Sbjct: 508 PPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWAN 567 Query: 725 XP--PPPPXPPXPXAGPPXPAAPXXXPP 802 P P PP P P PP P P PP Sbjct: 568 LPTSPDPPSPNPPSPDPPSPDPPSAPPP 595 Score = 46.0 bits (104), Expect = 0.001 Identities = 33/135 (24%), Positives = 34/135 (25%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP P PP P P P P PP P P PPP PP Sbjct: 539 PPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAPPPSPP 598 Query: 417 PXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP 238 P PP P PPPP P Sbjct: 599 PPSPPPPNPPPPSPPPPNPP-------PPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPT 651 Query: 237 RXPXTPXXPGGPGXP 193 P +P P P P Sbjct: 652 PPPPSPPPPRPPPRP 666 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP PP PP P Sbjct: 603 PPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPP 658 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP PP PP P Sbjct: 598 PPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPP 653 Score = 41.1 bits (92), Expect = 0.035 Identities = 30/115 (26%), Positives = 32/115 (27%), Gaps = 2/115 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP-XPXXPXXP-PPPPPPXXXXXXXXGXGGGGXX 367 PP PP + P P PPP P P P P PPP PP Sbjct: 479 PPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPR 538 Query: 366 XPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 PP P P P PP P P +P P P Sbjct: 539 PPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDPPSPDPPSAP 593 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P A P PPP PP P PPP PP PP P Sbjct: 575 PSPNPPSPDPPSPDPPSAPPPSPPPPSPP--PPNPPPPSPPPPNPPPPSPPPPSPP 628 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPP P PPP PP PP Sbjct: 593 PPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPP 645 Score = 39.1 bits (87), Expect = 0.14 Identities = 33/137 (24%), Positives = 34/137 (24%), Gaps = 2/137 (1%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP-PPXPXXPXX-P 433 + PP P PPP P P P P P PP P P P Sbjct: 525 RPPPRPPPRPSSPRPPPPDPSPPPPSPPSPPTSPSPPDPAWANLPTSPDPPSPNPPSPDP 584 Query: 432 PPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPX 253 P P PP PP P PPPP Sbjct: 585 PSPDPPSAPPPSPPPPSPPPPNPPPP---SPPPPNPPPPSPPPPSPPPPSPPPPNPPPPS 641 Query: 252 XXXPPRXPXTPXXPGGP 202 P P TP P P Sbjct: 642 PPPPSPRPPTPPPPSPP 658 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP PPPP P P PP PP PPP P Sbjct: 607 PPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRP 666 Query: 418 PP 413 PP Sbjct: 667 PP 668 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP PPPP P P PP PPP P PPP Sbjct: 622 PPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPPTRRSPPPTSSPPP 681 Query: 417 P 415 P Sbjct: 682 P 682 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P PPP PP P PPP PP PP P Sbjct: 590 PSAPPPSPPPPSPPPPNPPPPSPPPPNPP--PPSPPPPSPPPPSPPPPNPPPPSPP 643 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPP-PPPXXXXXXXTPPPPPPP 413 PPPP P P PP PPP PPP PPP Sbjct: 602 PPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPP 644 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP- 425 PPPP PPPP P P PPP +PPP Sbjct: 617 PPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPPTRRSPPPT 676 Query: 424 --PPPP 413 PPPP Sbjct: 677 SSPPPP 682 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPP P PPP P PP P Sbjct: 608 PPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPP 663 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPP + P PPPP P P PPP PP PP Sbjct: 629 PPSPPPPNPPPPSPPPPSPRPPTPPPPSP-PPPRPPPRPPPTRRSPPPTSSPP 680 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PP P P PPP PP P PP PP PP Sbjct: 615 PNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPP 667 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P P PP P PPP PP PP Sbjct: 623 PPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRPPPRPPPTRRSPPP 675 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP P PPPP P P P P PPP P Sbjct: 467 PPLSVLETLPSAPPSPPPPSPPPPRPPPPSPVPPTPPPSP 506 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP P P PPP P PPP P Sbjct: 483 PPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPP 522 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P P P PPPP P PPP PP PP P Sbjct: 577 PNPPSPDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPP 633 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +2 Query: 662 PPPXPPXXGGXXXPXAPXXXAXPPPPP-XPPXPXAGPPXPAAPXXXPP 802 P PP P AP P PPP PP P PP P PP Sbjct: 463 PDECPPLSVLETLPSAPPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPP 510 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P P P PPPP P PPP PP PP P Sbjct: 582 PDPPSPDPPSAPPPSPPPPSPPPPNPPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPP 638 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 APP PP + P P PPP PP PPP Sbjct: 478 APPSPPPPSPPPPRPPPPSPVPPTPPPSPRPPPSPRPPNPPP 519 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P P PPPP P PP P PP P Sbjct: 607 PPPPSPPPPNPPPPSPPPPSPPPPSPPPPNPPPPSPPPPSPRPPTPPPPSPPPPRP 662 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/59 (30%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPP---PXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P P P PPP P PPP PP P P Sbjct: 489 PPRPPPPSPVPPTPPPSPRPPPSPRPPNPPPRPPSPRPPPRPPPRPSSPRPPPPDPSPP 547 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP + P PPP P P PPP PP PP P Sbjct: 569 PTSPDPPSPNPPSPDPPSPDPPSAPPPSP-PPPSPPPPNPPPPSPPPPNPPPPSPP 623 >UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vulgaris|Rep: Chitinase - Beta vulgaris subsp. vulgaris Length = 439 Score = 60.9 bits (141), Expect = 4e-08 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPP PP P PPP P PP P PPPPP P Sbjct: 71 PPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTP 130 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 131 RPPPPSPPTPRPPPPPPP 148 Score = 58.4 bits (135), Expect = 2e-07 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 2/79 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPP PPPP PP P PPP P PP P PPPPP Sbjct: 88 PPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPP 147 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P P PP P +P P Sbjct: 148 PSPPTPSPPSPPSPEPPTP 166 Score = 58.0 bits (134), Expect = 3e-07 Identities = 31/82 (37%), Positives = 31/82 (37%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP----PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP PPPP PP P PPPP PP P PP Sbjct: 98 PPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPS 157 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 PP P P PP P P PP Sbjct: 158 PPSPEPPT--PPEPTPPTPTPP 177 Score = 55.2 bits (127), Expect = 2e-06 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPPP PP P P P PP PP P PP P P PP Sbjct: 61 PPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPP 119 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPP PP P PP P PP P P P P P P Sbjct: 53 PPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPP----RPPTPRPPPPPTPRPPP 108 Query: 749 PXPXA-GPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 109 PRPPTPRPPPPPTPRPPPP 127 Score = 50.4 bits (115), Expect = 6e-05 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PP PP P P P PPPP P P PPPPP Sbjct: 88 PPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPP 147 Query: 420 P 418 P Sbjct: 148 P 148 Score = 50.0 bits (114), Expect = 8e-05 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP---XPXAGPPXPAAPXXXP 799 P PP P PPPP PP P P PPP P PP P PP P P P Sbjct: 51 PTPPRPPTPRPPPPRPPTP--RPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPP 108 Query: 800 P 802 P Sbjct: 109 P 109 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPP P P P P PPPP P P P PP Sbjct: 98 PPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPS 157 Query: 420 PP 415 PP Sbjct: 158 PP 159 Score = 46.8 bits (106), Expect = 7e-04 Identities = 22/63 (34%), Positives = 23/63 (36%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 + PPP T PPP P P P P PPPP P P PPP Sbjct: 60 RPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPP 119 Query: 426 PPP 418 P P Sbjct: 120 PTP 122 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPP PP P P P P PP Sbjct: 124 PPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPP 164 Score = 44.4 bits (100), Expect = 0.004 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP----PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP 433 PPPP PPPP P + P P PPP PP P P P Sbjct: 61 PPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPP 120 Query: 432 PPPPPP 415 P PPP Sbjct: 121 TPRPPP 126 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPP P P P P PP P P P P PP Sbjct: 106 PPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPT 165 Query: 420 PP 415 PP Sbjct: 166 PP 167 Score = 43.2 bits (97), Expect = 0.009 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P P PP P PP P P PP P PP P PP P P PP Sbjct: 48 PSRPTP---PRPPTPRPP----PPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPP 99 Score = 42.3 bits (95), Expect = 0.015 Identities = 31/115 (26%), Positives = 32/115 (27%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PP P P PPP PP P P P PPPP PP Sbjct: 51 PTPPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPP--PTPRPPP 108 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P PP PP P +P P P P Sbjct: 109 P----RPPTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPP 159 Score = 39.9 bits (89), Expect = 0.081 Identities = 33/127 (25%), Positives = 34/127 (26%), Gaps = 1/127 (0%) Frame = -2 Query: 570 GXXXXXTXXXPPPP-PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXX 394 G T PP P P P P P PPPP P P PP P P Sbjct: 46 GRPSRPTPPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPR 105 Query: 393 XGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXX 214 PP P P PPPP P P +P Sbjct: 106 PPPPRPPTPRPP-----PPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPS 160 Query: 213 PGGPGXP 193 P P P Sbjct: 161 PEPPTPP 167 Score = 39.5 bits (88), Expect = 0.11 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPP-PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 + PPPP T PPP PP P P P PP P P P P Sbjct: 115 RPPPPPTPR----PPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPTPPEPT 170 Query: 429 PPPP 418 PP P Sbjct: 171 PPTP 174 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 686 GGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 G P P PPPP PP P PP P P PP Sbjct: 46 GRPSRPTPPRPPTPRPPPPRPPTPRPPPPRPPTPRPPPP 84 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXP-PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP P PP P P P P PPPP P PP P Sbjct: 71 PPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTP 130 Query: 423 PPP 415 PP Sbjct: 131 RPP 133 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP T PPPPP P P P P PP P P P P PP Sbjct: 124 PPPPPTPRPPPPSPPTPRPPPPPPP------SPPTPSPPSPPSPEPPTPPEPTPPTPTPP 177 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PP P P PPP P PP P Sbjct: 112 PTPRPPPPPTPRPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPTPP 167 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPP-XXXXXXXTPPPPPPP 413 P PPP P P PPP P TP PPPPP Sbjct: 59 PRPPPPRPPTPRPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPP 102 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P P P PP TPP P PP Sbjct: 130 PRPPPPSPPTPRPPPPPPPSPPTPSPPSPPSPEPPTPPEPTPP 172 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPP P P P P P PP PP Sbjct: 84 PTPRPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPPTPRPPPPPTPRPPPPSPP 138 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 60.9 bits (141), Expect = 4e-08 Identities = 32/72 (44%), Positives = 32/72 (44%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPPPP GPPPP PP G P PPPPP PP Sbjct: 366 PPPPSMGMAPPPVGGAAPPPPPPPPVG-GPPPPPPPIEG-----RPPSSLGNPPPPP-PP 418 Query: 752 XPXAGPPXPAAP 787 A PP P P Sbjct: 419 GRGAPPPGPMIP 430 Score = 56.0 bits (129), Expect = 1e-06 Identities = 35/104 (33%), Positives = 35/104 (33%), Gaps = 21/104 (20%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-------PPXXXPGPPPPXPPXXGGXXXPXAPXXXAX 727 PPPPP G PPPP PP G PP PP P P A Sbjct: 307 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 366 Query: 728 PP--------------PPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PP PPP PP P GPP P P P G Sbjct: 367 PPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLG 410 Score = 52.4 bits (120), Expect = 1e-05 Identities = 38/134 (28%), Positives = 39/134 (29%), Gaps = 3/134 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-- 427 PPPP G + PPPPP G P PPPPPP PPP Sbjct: 308 PPPPSRGAA---PPPPSRGAPPPPP-SRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 363 Query: 426 -PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXX 250 PPP GG PP P PPPP Sbjct: 364 GAPPPPSMGMAPPPVGGAAPPPPPP---PPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGR 420 Query: 249 XXPPRXPXTPXXPG 208 PP P P G Sbjct: 421 GAPPPGPMIPGRAG 434 Score = 51.6 bits (118), Expect = 2e-05 Identities = 34/97 (35%), Positives = 34/97 (35%), Gaps = 14/97 (14%) Frame = +2 Query: 569 PPPPPXXGGGGXX--CXXXXXPPPPPPXXXPGPPPPX------PPXXGGXXXPXAPXXXA 724 PPPPP G PPPPPP PPP PP G P Sbjct: 325 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPP 384 Query: 725 XPPPPPX-----PPXPXAG-PPXPAAPXXXPPXXGXG 817 PPPPP PP P G PP PP G G Sbjct: 385 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRG 421 Score = 51.6 bits (118), Expect = 2e-05 Identities = 32/90 (35%), Positives = 32/90 (35%), Gaps = 9/90 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP------PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP PPPP PP PPPP PP GG P Sbjct: 347 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP----------P 396 Query: 731 PPPPX---PPXPXAGPPXPAAPXXXPPXXG 811 PPPP PP PP P P P G Sbjct: 397 PPPPIEGRPPSSLGNPPPPPPPGRGAPPPG 426 Score = 46.8 bits (106), Expect = 7e-04 Identities = 35/119 (29%), Positives = 36/119 (30%), Gaps = 6/119 (5%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP------PPPPPXXXXXXXXGXGGG 376 PPPP G P P PPPPP P PP PPPPP Sbjct: 307 PPPPPSRGAA---PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 363 Query: 375 GXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPG 199 G PP + P P PPPP PP P P PG Sbjct: 364 GAPPPPS---MGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 419 Score = 38.3 bits (85), Expect = 0.25 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP-- 428 PPPP G PPPPP G P PPPPP PP Sbjct: 307 PPPPPSRGAAPPPPSRGA--PPPPP-SRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 363 Query: 427 -PPPPP 413 PPPP Sbjct: 364 GAPPPP 369 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG 691 PPPPP G PPPPPP PP P P G Sbjct: 394 PPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIPGRAG 434 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP G PPPPPP PPP PP G P P Sbjct: 366 PPPPSM--GMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP 415 Score = 35.9 bits (79), Expect = 1.3 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 3/97 (3%) Frame = -2 Query: 474 PPPPPPXPXXPXXPP---PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXX 304 PPPPP P P PPPPP G PP Sbjct: 307 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPP----PPSRSSQRPPPPS 362 Query: 303 XPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P G PPP PP P P GGP P Sbjct: 363 RGAPPPPSMGMAPPPVGGAAPP--PPPPPPVGGPPPP 397 Score = 35.9 bits (79), Expect = 1.3 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 4/54 (7%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPP----PPXXXPXPPPXXPPXXGGXXXXXXPPG 719 PPPP GG P PPPP PP PPP PP G PG Sbjct: 385 PPPPPPVGG-------PPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIPG 431 Score = 35.5 bits (78), Expect = 1.7 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 9/63 (14%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPP-----PXPPXPXAG----PPXPAAPXXXPPXX 808 G PP PP G P P A PPPP P PP G PP P+ PP Sbjct: 304 GIQPPPPPSRGA--APPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 361 Query: 809 GXG 817 G Sbjct: 362 SRG 364 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 513 SPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 +P GG P PPP G PPPPPP PPP Sbjct: 374 APPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 425 Score = 33.9 bits (74), Expect = 5.3 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPPP GG PPPPP G P PPPPP Sbjct: 379 GGAAPPPPPPPPVGG----------PPPPPPPIEGR------PPSSLGNPPPPP--PPGR 420 Query: 439 XTPPPPP 419 PPP P Sbjct: 421 GAPPPGP 427 >UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 60.9 bits (141), Expect = 4e-08 Identities = 33/74 (44%), Positives = 34/74 (45%), Gaps = 3/74 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G PPPPPP PG PPPP PP P A PPPP Sbjct: 281 PPPPPSDGS--------LPPPPPPPPGAPGGGAPPPPPPPP------PAAAGGAGVPPPP 326 Query: 740 PXPPXPXAGPPXPA 781 P PP P PP P+ Sbjct: 327 PPPPPPANLPPLPS 340 Score = 53.6 bits (123), Expect = 6e-06 Identities = 27/58 (46%), Positives = 27/58 (46%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP PPPP PP P AP A PPPPP PP G P P PP Sbjct: 281 PPPPPSDGSLPPPP-PP------PPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPPP 331 Score = 48.0 bits (109), Expect = 3e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPP PPPP PP G P P PPPPP PP P P Sbjct: 281 PPPPPSDGSLPPPPPPPPGAPGGGAPPPP-----PPPPPAAAGGAGVPPPPPPP 329 Score = 45.2 bits (102), Expect = 0.002 Identities = 29/80 (36%), Positives = 30/80 (37%), Gaps = 3/80 (3%) Frame = -1 Query: 643 GGGG---GGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXX 473 GG G GG + PPPP G PPPPP G P Sbjct: 265 GGSGFTAGGAPPDGSAPPPPPSD--------GSLPPPPPPPPGAPGGGAPPPP------- 309 Query: 472 PPPPPXXXXXXXTPPPPPPP 413 PPPPP PPPPPPP Sbjct: 310 PPPPPAAAGGAGVPPPPPPP 329 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXP--XXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P P PPPPPP P P PPPPPPP GG G PP Sbjct: 283 PPPSDGSLPPPPPPPPGAPGGGAPPPPPPP-----PPAAAGGAGVPPPP 326 Score = 42.3 bits (95), Expect = 0.015 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G GG PPPPP G PPPPPP P PP P Sbjct: 293 PPPPPPGAPGGGAPPPP---PPPPPAAAGGAG---------VPPPPPPPPPPANLPPLPS 340 Query: 420 P 418 P Sbjct: 341 P 341 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP G P P PP PPPPPPP Sbjct: 291 PPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPPPPPPP 332 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P G GG P PPPP GG G P PPPPP P P P Sbjct: 295 PPPPGAPGGGAPPPPP--PPPPAAAGGAG--VPPPPPPPPPPANLPPLPSP 341 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX------PXPPPXXPP 680 P PPPP GGG P PPPPPP P PPP PP Sbjct: 291 PPPPPPPPGAPGGGA-----PPPPPPPPPAAAGGAGVPPPPPPPPPP 332 Score = 39.9 bits (89), Expect = 0.081 Identities = 25/84 (29%), Positives = 25/84 (29%) Frame = -2 Query: 678 GGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX 499 GG G G G PPPP G PPPP G Sbjct: 265 GGSGFTAGGAPPDGSAPPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPP 324 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPP 427 P PPPPPP P P P Sbjct: 325 P-------PPPPPPPANLPPLPSP 341 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 5/69 (7%) Frame = +3 Query: 489 GXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPP-----XXX 653 G GF G PPPP G G A P PPPPPP Sbjct: 265 GGSGFTAGGAPPDGSAPPPPPSDGSLPPPPPPPPGAPGGGA--PPPPPPPPPAAAGGAGV 322 Query: 654 PXPPPXXPP 680 P PPP PP Sbjct: 323 PPPPPPPPP 331 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +2 Query: 689 GXXXPXAPXXXAXPPPPPXPP-XPXAGPPXPAAPXXXPPXXGXGGA 823 G P P + PPPPP PP P G P P P PP GGA Sbjct: 278 GSAPPPPPSDGSLPPPPPPPPGAPGGGAPPPPPP---PPPAAAGGA 320 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 2/68 (2%) Frame = +3 Query: 528 GGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXPPXXGGXXX 701 G G P PPP G + P PPPP P P PPP PP G Sbjct: 266 GSGFTAGGAPPDGSAPPPPPSDG----SLPPPPPPPPGAPGGGAPPPPPPPPPAAAGGAG 321 Query: 702 XXXPPGXP 725 PP P Sbjct: 322 VPPPPPPP 329 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 528 GGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXX 707 GG G P PP G P P P P PPP P GG Sbjct: 265 GGSGFTAGGAPPDGSAPPPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPP 324 Query: 708 XPPGXP 725 PP P Sbjct: 325 PPPPPP 330 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP 670 PPPPP G PPPPPP P P P Sbjct: 308 PPPPPPPAAAGGAGVPPPPPPPPPPANLPPLPSP 341 Score = 36.3 bits (80), Expect = 1.00 Identities = 28/87 (32%), Positives = 29/87 (33%) Frame = -2 Query: 750 GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGG 571 GG G G A G+ PP G P G GGG PPPP GG Sbjct: 265 GGSGFTAGGAPPDGSA--PPPPPSDGSLPPPPPPPPGAPGGGAPPPPP--PPPPAAAGGA 320 Query: 570 GXXXXXTXXXPPPPPXXXGXXXKXPXP 490 G PPPPP P P Sbjct: 321 G------VPPPPPPPPPPANLPPLPSP 341 Score = 34.3 bits (75), Expect = 4.0 Identities = 29/91 (31%), Positives = 29/91 (31%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXX 313 P PPPPP P PPPPPPP G GGG PP Sbjct: 275 PPDGSAPPPPPSDGSLP--PPPPPPP--------GAPGGGAPPPPP-------------- 310 Query: 312 XXXXPXPGXXXXGXXPPPPXXXXPPRXPXTP 220 P G PPPP P P P Sbjct: 311 --PPPPAAAGGAGVPPPPPPPPPPANLPPLP 339 >UniRef50_Q9FPQ6 Cluster: Vegetative cell wall protein gp1 precursor; n=14; root|Rep: Vegetative cell wall protein gp1 precursor - Chlamydomonas reinhardtii Length = 555 Score = 60.9 bits (141), Expect = 4e-08 Identities = 29/80 (36%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX---PPPPP 742 P PP P PPPP P PPPP PP P +P PP PP Sbjct: 244 PVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPP 303 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P P P +P PP Sbjct: 304 TPPSPSPPSPVPPSPAPVPP 323 Score = 59.7 bits (138), Expect = 9e-08 Identities = 28/77 (36%), Positives = 29/77 (37%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P P PP P P PPPP PP P PPP P PP Sbjct: 241 PPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPP 300 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P+ P PP Sbjct: 301 TPPT-PPSPSPPSPVPP 316 Score = 59.3 bits (137), Expect = 1e-07 Identities = 27/77 (35%), Positives = 27/77 (35%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P PP P P P P PP PP P PP PP P Sbjct: 186 PPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPV 245 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP PA P PP Sbjct: 246 PPSPAPPSPAPPSPKPP 262 Score = 57.6 bits (133), Expect = 4e-07 Identities = 28/78 (35%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXP-XAPXXXAXPPPPPXP 748 PP P PP PP P PP P PP P P A P P P Sbjct: 199 PPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPS 258 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P A PP P+ P PP Sbjct: 259 PKPPAPPPPPSPPPPPPP 276 Score = 56.0 bits (129), Expect = 1e-06 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXX-PGPPPPXPPXXGGXXXPX-APXXXAXPPP-PP 742 PP P P PP P PGPP P PP P AP A P P PP Sbjct: 40 PPSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPP 99 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P P PP PA P PP Sbjct: 100 SPAPPSPAPPSPAPPSPAPP 119 Score = 56.0 bits (129), Expect = 1e-06 Identities = 27/77 (35%), Positives = 28/77 (36%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P PP PP P P PP P P PPPPP PP Sbjct: 220 PPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPP 279 Query: 752 XPXAGPPXPAAPXXXPP 802 P A P P +P PP Sbjct: 280 FP-ANTPMPPSPPSPPP 295 Score = 54.0 bits (124), Expect = 5e-06 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PPP P PP P P P P A PP P P Sbjct: 271 PPPPPPRPPFPANTPMPPSPPSPPP--SPAPPTPPTPPSPSPPSP-VPPSPAPVPPSPAP 327 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP AP P Sbjct: 328 PSPAPSPPPSPAPPTPSP 345 Score = 53.6 bits (123), Expect = 6e-06 Identities = 29/78 (37%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P G PP P P P PP P PP P +P + PP P PP Sbjct: 60 PPSPAPPSPGPPSPAPPSPPSPAPPS-PAPPSPAPPSPA----PPSPAPPSPAPPSPAPP 114 Query: 752 XP-XAGPPXPAAPXXXPP 802 P PP PA P PP Sbjct: 115 SPAPPSPPSPAPPSPSPP 132 Score = 53.6 bits (123), Expect = 6e-06 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 5/82 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXP-P 733 PP P PPPPPP P P PP PP P P P P Sbjct: 251 PPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSP 310 Query: 734 PPPXPPXPXAGPPXPAAPXXXP 799 P P PP P PP PA P P Sbjct: 311 PSPVPPSPAPVPPSPAPPSPAP 332 Score = 52.4 bits (120), Expect = 1e-05 Identities = 27/78 (34%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P PP PP P P PP PP P +P + PP P PP Sbjct: 126 PPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSP-SPPVPPSPAPPSPTPPSPSPP 184 Query: 752 XPXA-GPPXPAAPXXXPP 802 P + PP PA P P Sbjct: 185 VPPSPAPPSPAPPVPPSP 202 Score = 52.0 bits (119), Expect = 2e-05 Identities = 29/79 (36%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPXP 748 PP P PP PP P P PP PP P +P P P PP P Sbjct: 165 PPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPA----PPSPAPPVPPSPAPPSP 220 Query: 749 PXPXA-GPPXPAAPXXXPP 802 P P PP PA P PP Sbjct: 221 PSPAPPSPPSPAPPSPSPP 239 Score = 51.6 bits (118), Expect = 2e-05 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP P PP P P PP P PP P PP PP P Sbjct: 144 PPLPPSPAPPSPSPPVPPSPSPPVPPS-PAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSP 202 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP P +P P Sbjct: 203 APPSPAPPVPPSPAPPSP 220 Score = 51.2 bits (117), Expect = 3e-05 Identities = 26/81 (32%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP---GPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PP PP P P PP P PP P PP P PP P Sbjct: 75 PPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAP 134 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P P PP P +P P Sbjct: 135 PSPSPPSPAPPLPPSPAPPSP 155 Score = 50.8 bits (116), Expect = 4e-05 Identities = 27/72 (37%), Positives = 30/72 (41%), Gaps = 2/72 (2%) Frame = +2 Query: 593 GGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXX-PXAPXXXAXPPPPPXPPXPXA-G 766 GG C PP P P P PP P PP P +P + P P P P P + Sbjct: 34 GGIFNCPPSPAPPSPAPPS-PAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPA 92 Query: 767 PPXPAAPXXXPP 802 PP PA P PP Sbjct: 93 PPSPAPPSPAPP 104 Score = 50.8 bits (116), Expect = 4e-05 Identities = 28/81 (34%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXP-XAPXXXAXP-PPPP 742 P P P P PP P PP P PP P AP + P PP P Sbjct: 104 PSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSP 163 Query: 743 XPPXPXA-GPPXPAAPXXXPP 802 PP P + PP P P PP Sbjct: 164 SPPVPPSPAPPSPTPPSPSPP 184 Score = 50.4 bits (115), Expect = 6e-05 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPX 745 P P P G P PP P P PP P AP A P P PP Sbjct: 61 PSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPS 120 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P P P AP P Sbjct: 121 PPSPAPPSPSPPAPPSPSP 139 Score = 50.4 bits (115), Expect = 6e-05 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PP P P P PP P AP P PPP P Sbjct: 209 PPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPP 268 Query: 749 PXPXAGPPXPAAPXXXP 799 P PP P P P Sbjct: 269 SPPPPPPPRPPFPANTP 285 Score = 50.0 bits (114), Expect = 8e-05 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P P PP P P PP P PP P PP PP P Sbjct: 93 PPSPAPPSPAPPSPAPPSPAPPSPAP-PSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPA 151 Query: 752 XPXAGPPXPAAPXXXPP 802 P PP P +P P Sbjct: 152 PPSPSPPVPPSPSPPVP 168 Score = 50.0 bits (114), Expect = 8e-05 Identities = 27/78 (34%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PP P P P PP P PP P A P P P P Sbjct: 275 PPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSP 334 Query: 749 PXPXAGPPXPA-APXXXP 799 P P PP P+ +P P Sbjct: 335 P-PSPAPPTPSPSPSPSP 351 Score = 49.6 bits (113), Expect = 1e-04 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXA-XPPPPPXPPXPXAGPPXPAAPXXXP 799 PP PP P PP P PP AP A PPP P PP P P +P P Sbjct: 299 PPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSP 357 Score = 49.2 bits (112), Expect = 1e-04 Identities = 27/78 (34%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P PP P P P PP P PP P P PP P PP Sbjct: 70 PPSPAPPSPPSPAPPSPAPPSPAPPS-PAPPSPAPPSPA-PPSPAPPSPAPPSPPSPAPP 127 Query: 752 XP-XAGPPXPAAPXXXPP 802 P PP P+ P PP Sbjct: 128 SPSPPAPPSPSPPSPAPP 145 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/78 (33%), Positives = 28/78 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P P P PP P P P P PP P P +P + PP P P Sbjct: 51 PSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPS--PAPPSPAPPSPAPPSPAP 108 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP PA P P Sbjct: 109 PSP--APPSPAPPSPPSP 124 Score = 48.8 bits (111), Expect = 2e-04 Identities = 29/83 (34%), Positives = 30/83 (36%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPX 745 P P P PP PP P P PP PP AP P PP P Sbjct: 99 PSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPS--PPSPAPPLPPSPAPPSPS 156 Query: 746 PPXPXAG----PPXPAAPXXXPP 802 PP P + PP PA P PP Sbjct: 157 PPVPPSPSPPVPPSPAPPSPTPP 179 Score = 47.6 bits (108), Expect = 4e-04 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP P PP P P PP P PP P PP PP P Sbjct: 157 PPVPPSPSPPVPPSPAPPSPTPPSPSP-PVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSP 215 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP PA P P Sbjct: 216 APP--SPPSPAPPSPPSP 231 Score = 46.8 bits (106), Expect = 7e-04 Identities = 34/136 (25%), Positives = 34/136 (25%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP PP PP P P P P PP P P PP PP Sbjct: 163 PSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSP-APPSPP 221 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P PP P P PPPP P Sbjct: 222 SPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFP 281 Query: 240 PRXPXTPXXPGGPGXP 193 P P P P P Sbjct: 282 ANTPMPPSPPSPPPSP 297 Score = 46.8 bits (106), Expect = 7e-04 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 1/77 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXX-PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PP P PP P P PP P PP P P A P PP P Sbjct: 231 PAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSP 290 Query: 749 PXPXAGPPXPAAPXXXP 799 P P P P P P Sbjct: 291 PSPPPSPAPPT-PPTPP 306 Score = 45.6 bits (103), Expect = 0.002 Identities = 27/81 (33%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXX-PGPPPPXPPXXGGXXXPX-APXXXAXP-PPPP 742 PP P P PP P P PP P PP P +P P PP P Sbjct: 83 PPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSP 142 Query: 743 XPPXPXA-GPPXPAAPXXXPP 802 PP P + PP P+ P P Sbjct: 143 APPLPPSPAPPSPSPPVPPSP 163 Score = 45.6 bits (103), Expect = 0.002 Identities = 29/85 (34%), Positives = 30/85 (35%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP-PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-- 739 PP PP P PP P P PP P PP P P PP P Sbjct: 225 PPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPP----PPRPPF 280 Query: 740 ----PXPPXPXAGPPXPAAPXXXPP 802 P PP P + PP PA P P Sbjct: 281 PANTPMPPSPPSPPPSPAPPTPPTP 305 Score = 44.8 bits (101), Expect = 0.003 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 P PPP PP P PP P PP P PP P P A P P P Sbjct: 291 PSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPA----PSPPPSPAPPTPSPS 346 Query: 746 P-PXPXAGPPXPAAPXXXP 799 P P P P +P P Sbjct: 347 PSPSPSPSPSPSPSPSPSP 365 Score = 42.7 bits (96), Expect = 0.011 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PPPPP P P PPP P P P P P P Sbjct: 251 PPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSP 310 Query: 420 P 418 P Sbjct: 311 P 311 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP + P P PP PP P P P PP PP Sbjct: 265 PPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPP 306 Score = 42.3 bits (95), Expect = 0.015 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 1/78 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP P P PP P P P PP P +P P P P P Sbjct: 299 PPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTP-SPSPSPSPSPSPSP 357 Query: 749 -PXPXAGPPXPAAPXXXP 799 P P P P P Sbjct: 358 SPSPSPSPSPSPIPSPSP 375 Score = 41.9 bits (94), Expect = 0.020 Identities = 31/137 (22%), Positives = 31/137 (22%), Gaps = 1/137 (0%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PP PP P P P P PP P P P P P Sbjct: 98 PPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSP 157 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 P P P PP P P Sbjct: 158 PVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAP 217 Query: 240 PRXP-XTPXXPGGPGXP 193 P P P P P P Sbjct: 218 PSPPSPAPPSPPSPAPP 234 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P P P PPPP P PPP PP PP P Sbjct: 239 PAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPP 294 Score = 40.3 bits (90), Expect = 0.061 Identities = 24/75 (32%), Positives = 26/75 (34%), Gaps = 3/75 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXP-XAPXXXAXPPPPPX 745 PP P P P PP P PPP P PP P +P P P P Sbjct: 305 PPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSPSPS 364 Query: 746 P-PXPXAGPPXPAAP 787 P P P P +P Sbjct: 365 PSPSPIPSPSPKPSP 379 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/74 (28%), Positives = 23/74 (31%), Gaps = 1/74 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PP PP P P P P PP P +P P P P P Sbjct: 308 PSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSPSPSPSP 367 Query: 749 -PXPXAGPPXPAAP 787 P P P +P Sbjct: 368 SPIPSPSPKPSPSP 381 Score = 39.1 bits (87), Expect = 0.14 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PP P P P PP P +P P P P P Sbjct: 302 PPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSP 361 Query: 749 -PXPXAGPPXPAAPXXXP 799 P P P +P P Sbjct: 362 SPSPSPSPIPSPSPKPSP 379 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP PPPPP P P PP PP P PP Sbjct: 244 PVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPP 303 Query: 421 PPP 413 PP Sbjct: 304 TPP 306 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P P PP P P P PP PP Sbjct: 262 PAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPP 303 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P P G PP P P P P P PP P P PP PP Sbjct: 63 PAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPP 122 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP P P PP P P P PP P Sbjct: 271 PPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSP 330 Query: 420 PP 415 P Sbjct: 331 AP 332 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP P P P P P PP P P PP PP Sbjct: 40 PPSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPP 79 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP P P P P P PP P P P P PP Sbjct: 50 PPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPP 89 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP P P P P PP P P P P P PP Sbjct: 55 PPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPP 94 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP P P P P PP P P P P P PP Sbjct: 60 PPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPP 99 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P P PP P P PP PP P P PP P Sbjct: 75 PPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAP 134 Query: 420 P 418 P Sbjct: 135 P 135 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP P P P P P PP P P P P PP Sbjct: 45 PPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPP 84 Score = 36.3 bits (80), Expect = 1.00 Identities = 28/117 (23%), Positives = 28/117 (23%), Gaps = 2/117 (1%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP- 361 P PP P P PP PP P P PP P P P Sbjct: 53 PAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPA 112 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPP-PPXXXXPPRXPXTPXXPGGPGXP 193 P P PP PP P P P P P P Sbjct: 113 PPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPP 169 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP + P P PP P P PPP PP PP P Sbjct: 236 PSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPP 291 Score = 35.9 bits (79), Expect = 1.3 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 2/74 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP P P P P P PP P P +P P P P P Sbjct: 310 PPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSPSPSPSPSP 369 Query: 749 -PXPXAGP-PXPAA 784 P P P P P A Sbjct: 370 IPSPSPKPSPSPVA 383 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PP P P PPP P P Sbjct: 299 PPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAP 340 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P G P PP P P P PP P P P P P P Sbjct: 60 PPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPP-SPAPPSPAPPSPAPPSPAP 118 Query: 420 P 418 P Sbjct: 119 P 119 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 1/62 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP-PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 P PP T P PP P P P P PPP P P P P Sbjct: 288 PSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSP 347 Query: 423 PP 418 P Sbjct: 348 SP 349 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P PP P P PP PA P PP G Sbjct: 43 PAPPSPAPPSPAPPSPAPPSPAPPSPG 69 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP + P P P P P PPP P P P P P Sbjct: 291 PSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPS 350 Query: 420 P 418 P Sbjct: 351 P 351 Score = 33.5 bits (73), Expect = 7.0 Identities = 24/95 (25%), Positives = 24/95 (25%), Gaps = 1/95 (1%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX 295 P P PP P P PP P P G PP P Sbjct: 41 PSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPS 100 Query: 294 PGXXXXGXXPPPPXXXXPPRXP-XTPXXPGGPGXP 193 P P P PP P P P P P Sbjct: 101 PAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPP 135 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = -2 Query: 576 GGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 GG + P P P P P PP P P P P PP P Sbjct: 34 GGIFNCPPSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSP 86 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/63 (26%), Positives = 18/63 (28%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP PPP P P P P PP +PP P Sbjct: 254 PAPPSPKPPAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSP 313 Query: 421 PPP 413 PP Sbjct: 314 VPP 316 >UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1493 Score = 60.5 bits (140), Expect = 5e-08 Identities = 33/82 (40%), Positives = 33/82 (40%), Gaps = 5/82 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP--PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP P PPPPP P PPP P P P A PPPPP Sbjct: 828 PPPPPPFSPKTLQSLPQLPPGIPPPPPQAVPPPPPQAVPPPPLQAVPPPPPPQAVPPPPP 887 Query: 743 ---XPPXPXAGPPXPAAPXXXP 799 PP P A PP PA P Sbjct: 888 QAVPPPPPQAVPPPPAQAAPPP 909 Score = 42.7 bits (96), Expect = 0.011 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX--PXPXXXXXPPPPPPXPXXPXXPP- 430 PPPP PPPPP P P PPPPPP P P Sbjct: 830 PPPPFSPKTLQSLPQLPPGIPPPPPQAVPPPPPQAVPPPPLQAVPPPPPPQAVPPPPPQA 889 Query: 429 -PPPPP 415 PPPPP Sbjct: 890 VPPPPP 895 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P PP PP P PPPP P P P P PP Sbjct: 796 PPPPLFPPPAPPVPPVSTDAAAPFTVPNDKDFPPPPPPFSPKTLQSLPQLPPGIPP 851 Score = 41.5 bits (93), Expect = 0.026 Identities = 31/85 (36%), Positives = 32/85 (37%), Gaps = 8/85 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP---PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PPP PPP PPPP P P P PPPP Sbjct: 850 PPPPPQA---------VPPPPPQAVPPPPLQAVPPPPPP-----QAVPPPPPQAVPPPPP 895 Query: 740 ---PXPPXPXAGPP--XPAAPXXXP 799 P PP A PP P+ P P Sbjct: 896 QAVPPPPAQAAPPPLTLPSEPQKIP 920 Score = 41.5 bits (93), Expect = 0.026 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PP PP P P A PPP P Sbjct: 858 PPPPPQ--AVPPPPLQAVPPPPPPQAVPPPPPQAVPPPPPQAVPP--PPAQAAPPPLTLP 913 Query: 749 PXPXAGPPXP 778 P P P Sbjct: 914 SEPQKIPSPP 923 Score = 38.7 bits (86), Expect = 0.19 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPP--PXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP P P P PPPP PP PPPPP Sbjct: 796 PPPPLFPPPAPPVPPVSTDAAAPFTVPNDKDFPPPP-PPFSPKTLQSLPQLPPGIPPPPP 854 Query: 743 X---PPXPXAGPPXP--AAPXXXPP 802 PP P A PP P A P PP Sbjct: 855 QAVPPPPPQAVPPPPLQAVPPPPPP 879 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P PPPP P P PPPP Sbjct: 829 PPPPPFSPKTLQSLPQLPPGIPPPPPQAVPPPPPQAVPPPP 869 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP PPPP P PPPPP P P P Sbjct: 807 PVPPVSTDAAAPFTVPNDKDFPPPPPPFSPKTLQSLPQLPPGIPPPPPQAVPPPPPQAVP 866 Query: 420 PP 415 PP Sbjct: 867 PP 868 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXP----XXPPPPPPXXXPXPPPXXPP 680 P PPPP A P PPPPPP P PPP P Sbjct: 847 PGIPPPPPQAVPPPPPQAVPPPPLQAVPPPPPPQAVPPPPPQAVP 891 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXX--KXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P P PPP Sbjct: 858 PPPPPQAVPPPPLQAVPPPPPPQAVPPPPPQAVPPPPPQAVPPP 901 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP-----XPXXPXXPP--PPPPP 415 PP PP P PPPPPP P PP PPPPP Sbjct: 806 PPVPPVSTDAAAPFTVPNDKDFPPPPPPFSPKTLQSLPQLPPGIPPPPP 854 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -2 Query: 540 PPPP---PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPP P P P PPPP P P PPPP Sbjct: 859 PPPPQAVPPPPLQAVPPPPPPQAVPPPPPQAVPPPPPQAVPPPP 902 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P P PPPP P P PPP Sbjct: 875 PPPPPQAV-----PPPPPQAVPPPPPQAVPPPPAQAAPPP 909 Score = 33.5 bits (73), Expect = 7.0 Identities = 27/115 (23%), Positives = 27/115 (23%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP P P P P PPPPPP G PP Sbjct: 796 PPPPLFP--PPAPPVPPVSTDAAAPFTVPNDKDFPPPPPPFSPKTLQSLPQLPPGIPPPP 853 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P PPPP PP P P P Sbjct: 854 PQAVPPPPPQAVPPPPLQAVPPPPPPQAVPPPPPQAVPPPPPQAVPPPPAQAAPP 908 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPPPP P PPP Sbjct: 874 PPPPPPQA-----VPPPPPQAVPPPPPQAVPPPPAQAAPPP 909 >UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled homolog (Drosophila); n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Enabled homolog (Drosophila) - Strongylocentrotus purpuratus Length = 439 Score = 60.5 bits (140), Expect = 5e-08 Identities = 36/89 (40%), Positives = 36/89 (40%), Gaps = 6/89 (6%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPP--PXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP P G PP PP P P PP PP PP P AP A PP PP Sbjct: 181 PPEPPSGPPAMSRPPPAAPPAPPQPPAAPPAPPAPPAPPAPPAV--PAAPPAPAAPPAPP 238 Query: 743 XPPXPXAG---PPXPAAPXXXPPXXGXGG 820 PP P AG PP P P P GG Sbjct: 239 APPAPPAGGGPPPPPPPPAIGGPSASSGG 267 Score = 51.2 bits (117), Expect = 3e-05 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 PP PP P P PP PP P PPPPPPP GGGG Sbjct: 215 PPAPPAPPAVPAAPPAPAAPPAPPAPPAPPAGGGPPPPPPPPAIGGPSASSGGGGG 270 Score = 48.4 bits (110), Expect = 2e-04 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 6/69 (8%) Frame = +2 Query: 632 PPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPXPPXP---XAGPPXPAAP--XX 793 P PP GPP PP P P PP PP PP P A PP PAAP Sbjct: 179 PSPPEPPSGPPAMSRPPPAAPPAPPQPPAAPPAPPAPPAPPAPPAVPAAPPAPAAPPAPP 238 Query: 794 XPPXXGXGG 820 PP GG Sbjct: 239 APPAPPAGG 247 Score = 46.0 bits (104), Expect = 0.001 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP--XXPPPPPPPXXXXXXXXGXGGGG 373 PP PP P PP PP P P PPPPPPP GGGG Sbjct: 212 PPAPPAPPAPPAVPAAPPAPAAPPAPPAPPAPPAGGGPPPPPPPPAIGGPSASSGGGG 269 Score = 44.0 bits (99), Expect = 0.005 Identities = 23/55 (41%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = +2 Query: 641 PXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPP-PPXPPXPXAGPPXPAAPXXXP 799 P P PP PP P P AP PP PP PP P A P PA P P Sbjct: 175 PATRPSPPEPPSGPPAMSRPPPAAPPAPPQPPAAPPAPPAPPAPPAPPAVPAAPP 229 Score = 44.0 bits (99), Expect = 0.005 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP G PP PP P P PP P P P PP PP Sbjct: 179 PSPPEPPSGPPAMSRPPPAAPPAPPQPPAAPPAPPAPPAPPAPPAVPAAPPAPAAPPAPP 238 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 P GGG PP Sbjct: 239 APPAP------PAGGGPPPPP 253 Score = 43.6 bits (98), Expect = 0.007 Identities = 25/69 (36%), Positives = 27/69 (39%), Gaps = 3/69 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXX-AXPPPPPXPPXPXAGPPXPAAPXXX 796 P PP P P PP P PP P AP A PPP PP P G P ++ Sbjct: 210 PAPPAPPAPPAPPAVPAAPPAPAAPPAPPAPPAPPAGGGPPPPPPPPAIGGPSASSGGGG 269 Query: 797 PPXXGXGGA 823 G G A Sbjct: 270 GGGGGGGTA 278 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 PP PP P PP PP P PPPPPP G GGGG Sbjct: 218 PPAPPAVPAAPPAPAAPPAPPAPPAPPAGGGPP--PPPPPPAIGGPSASSGGGGGG 271 Score = 41.5 bits (93), Expect = 0.026 Identities = 29/88 (32%), Positives = 30/88 (34%), Gaps = 3/88 (3%) Frame = -2 Query: 822 APPXPXXGGXXXGAA---GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPG 652 APP P GG GGP+ GG GGGGG G Sbjct: 239 APPAPPAGGGPPPPPPPPAIGGPSASSGGGGGGGGGGGTAGGLAAALAGAKLKKVVRSEN 298 Query: 651 XXXGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGG PPP GGGGG Sbjct: 299 TDGSSGGGGSNR------PPPAGGGGGG 320 Score = 40.3 bits (90), Expect = 0.061 Identities = 27/81 (33%), Positives = 27/81 (33%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG PPPP P GGGGGG G G GG G G Sbjct: 246 GGGPPPPPPPPAIGGPSASSGGGGGG-GGGGGTAGGLAAALAGAKLKKVVRSENTDGSSG 304 Query: 539 GXXXVXXXXXPPPPPXXGGGG 601 G PPP GGGG Sbjct: 305 G-----GGSNRPPPAGGGGGG 320 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -2 Query: 582 GGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP-PPPPP 415 GG T PP PP + P P PP PP P P PP PP PP Sbjct: 167 GGLDNNSMPATRPSPPEPPSGPPAMSRPP-PAAPPAPPQPPAAPPAPPAPPAPPAPP 222 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPPXXGG 692 P P PP A P P PP PP PPP PP GG Sbjct: 215 PPAPPAPPAVPAAPPAPAAPPAPPAPPAPPAGGGPPPPPPPPAIGG 260 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = -1 Query: 637 GGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPP 458 GG A P PP G PP PP P P P P Sbjct: 167 GGLDNNSMPATRPSPPEPPSGPPAMSRPPPAAPPAPPQPPAAPPAPPAPPAPPAPPAVPA 226 Query: 457 XXXXXXXTPPPPPPP 413 P PP PP Sbjct: 227 APPAPAAPPAPPAPP 241 Score = 33.1 bits (72), Expect = 9.3 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 9/77 (11%) Frame = +3 Query: 513 SPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPP--------PPPPXXXPXPP- 665 SP G P PP P P PP PP P P PP Sbjct: 180 SPPEPPSGPPAMSRPPPAAPPAPPQPPAAPPAPPAPPAPPAPPAVPAAPPAPAAPPAPPA 239 Query: 666 PXXPPXXGGXXXXXXPP 716 P PP GG PP Sbjct: 240 PPAPPAGGGPPPPPPPP 256 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 60.5 bits (140), Expect = 5e-08 Identities = 34/85 (40%), Positives = 34/85 (40%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP-----PPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAX 727 PPPPP GG P PPPPP PP PP GG P P Sbjct: 675 PPPPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPPPPPLPGGTIPPPPPLFGGA 734 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P AGPP P P PP Sbjct: 735 VPPPPPLPGGGAGPPPP--PPGGPP 757 Score = 56.0 bits (129), Expect = 1e-06 Identities = 34/92 (36%), Positives = 34/92 (36%), Gaps = 7/92 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP G PPPPPP PP PP GG P AP PP P Sbjct: 558 PPSPPALSSG----VVPLPPPPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAP 613 Query: 749 PXPXAG---PPXPAAP----XXXPPXXGXGGA 823 P P PP P P PP GGA Sbjct: 614 PLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGA 645 Score = 52.8 bits (121), Expect = 1e-05 Identities = 33/87 (37%), Positives = 34/87 (39%), Gaps = 4/87 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX--AXPPPPP 742 PPPPP GG PPPP G PP PP GG P P A PPPPP Sbjct: 700 PPPPPLPGGAAAVL-------PPPPPLPGGTIPPPPPLFGGAVPPPPPLPGGGAGPPPPP 752 Query: 743 X--PPXPXAGPPXPAAPXXXPPXXGXG 817 PP + P AP P G Sbjct: 753 PGGPPMAPSLGSYPFAPVPVMPALPHG 779 Score = 52.4 bits (120), Expect = 1e-05 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG PPPP G P P PPPPP P PPPPP Sbjct: 701 PPPPLPGGAAAVL--------PPPPPLPGGTIPPPPPLFGGAVPPPPPLPGGGAGPPPPP 752 Query: 420 P 418 P Sbjct: 753 P 753 Score = 52.0 bits (119), Expect = 2e-05 Identities = 33/91 (36%), Positives = 33/91 (36%), Gaps = 6/91 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP GG PPPP P PPP P G P P PP P Sbjct: 649 PPPPPLPGGAAVI-----PPPPPLPGGAAVIPPPPPLPGGAAVIPPPPLLPGGTVIPPPP 703 Query: 749 PXPXAG----PPXPAAP--XXXPPXXGXGGA 823 P P PP P P PP GGA Sbjct: 704 PLPGGAAAVLPPPPPLPGGTIPPPPPLFGGA 734 Score = 50.4 bits (115), Expect = 6e-05 Identities = 34/93 (36%), Positives = 34/93 (36%), Gaps = 8/93 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXX--PXAPXXXAXPPPPP 742 PPPPP GG PPPPP PP PP GG P P PP Sbjct: 623 PPPPPLPGGAAVI------PPPPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPP 676 Query: 743 XPPXPXAG---PPXPAAP---XXXPPXXGXGGA 823 PP P PP P P PP GGA Sbjct: 677 PPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGA 709 Score = 50.0 bits (114), Expect = 8e-05 Identities = 42/143 (29%), Positives = 43/143 (30%), Gaps = 7/143 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP---PPPPPXPXXPXXPP 430 PPPP GG PPPPP G P P PPPPP P P Sbjct: 624 PPPPLPGGAA--------VIPPPPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIP 675 Query: 429 PPPPPXXXXXXXXGXGGGGXXXPPXFF----FLXXXXXXXXXXXXXXPXPGXXXXGXXPP 262 PPPP GG PP + P P G PP Sbjct: 676 PPPPLP---------GGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPPPPPLPGGTIPP 726 Query: 261 PPXXXXPPRXPXTPXXPGGPGXP 193 PP P P GG G P Sbjct: 727 PPPLFGGAVPPPPPLPGGGAGPP 749 Score = 50.0 bits (114), Expect = 8e-05 Identities = 42/135 (31%), Positives = 42/135 (31%), Gaps = 2/135 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPPP 427 PPPP GG PPPPP G P P PPPPP P P Sbjct: 663 PPPPLPGGAA--------VIPPPPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLP 714 Query: 426 PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 PPPP GG PP F P P G PPPP Sbjct: 715 PPPPLP---------GGTIPPPPPLF-----------GGAVPPPPPLPGGGAGPPPPPPG 754 Query: 246 XPPRXPXTPXXPGGP 202 PP P P P Sbjct: 755 GPPMAPSLGSYPFAP 769 Score = 49.6 bits (113), Expect = 1e-04 Identities = 31/89 (34%), Positives = 31/89 (34%), Gaps = 5/89 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX-----PP 733 PPPPP GG PPPPP PP P GG P P PP Sbjct: 662 PPPPPLPGGAAVI------PPPPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPP 715 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 PPP P PP PP GG Sbjct: 716 PPPLPGGTIPPPPPLFGGAVPPPPPLPGG 744 Score = 48.4 bits (110), Expect = 2e-04 Identities = 36/115 (31%), Positives = 36/115 (31%), Gaps = 13/115 (11%) Frame = -1 Query: 718 PGGXXWXXXPPXXGGXXGGGXGXXXGGGG-----GGXXGXXAXXPPPPXXXGGGGXXX-- 560 PGG PP GG GG G A PPPP GG Sbjct: 592 PGGAAIPPAPPLPGGTVVPPAPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPP 651 Query: 559 ----GXXXXXPPPPPXXXGEXXKXPXXPXXXXXP--PPPPXXXXXXXTPPPPPPP 413 G PPPPP G P P PPPP PPPPP P Sbjct: 652 PPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPPPLLPGGTVIPPPPPLP 706 Score = 48.4 bits (110), Expect = 2e-04 Identities = 36/115 (31%), Positives = 36/115 (31%), Gaps = 14/115 (12%) Frame = -1 Query: 718 PGGXXWXXXPPXXGGXXGGGXGXXXGGGGG------GXXGXXAXXPPPPXXXGGGGXXX- 560 PGG PP GG GG G A PPPP GG Sbjct: 604 PGGTVVPPAPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPP 663 Query: 559 -----GXXXXXPPPPPXXXGEXX--KXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 G PPPPP G P P PPPPP PPPPP Sbjct: 664 PPPLPGGAAVIPPPPPLPGGAAVIPPPPLLPGGTVIPPPPPLPGGAAAVLPPPPP 718 Score = 46.4 bits (105), Expect = 0.001 Identities = 34/99 (34%), Positives = 34/99 (34%), Gaps = 14/99 (14%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP-----PPPPPXXXPGPPPPXPPXXGGXXX--PXAPXXXAX 727 PPPPP GG P PP PP PP PP GG P P Sbjct: 573 PPPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAPPLPGGAAVIPPPPPLPGGA 632 Query: 728 PPPPPXPPXPXAG---PPXPAAP----XXXPPXXGXGGA 823 PP PP P PP P P PP GGA Sbjct: 633 AVIPPPPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGA 671 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPPP GG PPPPP G P P PPP Sbjct: 682 GGAAVIPPPPLLPGG--------TVIPPPPPLPGGAAAVLPPPPPLPGGTIPPPPPLFGG 733 Query: 439 XTPPPPPPP 413 PPPPP P Sbjct: 734 AVPPPPPLP 742 Score = 45.2 bits (102), Expect = 0.002 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 5/78 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXX--PXAPXXXAXPPPPP 742 PP PP GG PPPPP PP PP GG P P PP Sbjct: 610 PPAPPLPGGAAVI------PPPPPLPGGAAVIPPPPPLPGGAAVIPPPPPLPGGAAVIPP 663 Query: 743 XPPXPXAG---PPXPAAP 787 PP P PP P P Sbjct: 664 PPPLPGGAAVIPPPPPLP 681 Score = 44.4 bits (100), Expect = 0.004 Identities = 41/141 (29%), Positives = 41/141 (29%), Gaps = 5/141 (3%) Frame = -2 Query: 600 PPPPXXGGGG---GXXXXXTXXXPPPPPXXXGXXXKX--PXPXXXXXPPPPPPXPXXPXX 436 PPPP GG PP PP G P P PPPPP P Sbjct: 575 PPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAPPLPGGAAVIPPPPPLPGGAAV 634 Query: 435 PPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPP 256 PPPPP GG PP P PG PPPP Sbjct: 635 IPPPPPL---------PGGAAVIPPP-----PPLPGGAAVIPPPPPLPGGAAV-IPPPPP 679 Query: 255 XXXXPPRXPXTPXXPGGPGXP 193 P P PGG P Sbjct: 680 LPGGAAVIPPPPLLPGGTVIP 700 Score = 41.1 bits (92), Expect = 0.035 Identities = 33/112 (29%), Positives = 33/112 (29%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PP PP P PPPPPP P PP PP P GG P Sbjct: 558 PPSPPALSSGVVPLP-------PPPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVP 610 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 P P PG PPPP P P PGG Sbjct: 611 P----APPLPGGAAVIPPPPPLPGGAAV-IPPPPPLPGGAAVIPPPPPLPGG 657 Score = 40.3 bits (90), Expect = 0.061 Identities = 34/116 (29%), Positives = 34/116 (29%), Gaps = 4/116 (3%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPPPPPPP--XXXXXXXXGXGGGG 373 PPPPP G P P PP PP P PP PP P GG Sbjct: 573 PPPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAPPLPGGAAVIPPPPPLPGGA 632 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 PP P PG PPPP P P PGG Sbjct: 633 AVIPPP----PPLPGGAAVIPPPPPLPGGAAV-IPPPPPLPGGAAVIPPPPPLPGG 683 Score = 40.3 bits (90), Expect = 0.061 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKX-PXXPXXXXXPPPPPXXXXXXXTPPP 425 PPPP GG PP PP G P P PP PP PPP Sbjct: 574 PPPPPLPGGAAI--------PPAPPLPGGAAIPPAPPLPGGTVVPPAPPLPGGAAVIPPP 625 Query: 424 PPPP 413 PP P Sbjct: 626 PPLP 629 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP----PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP GG P PP PP P PP GG PP P Sbjct: 570 PLPPPPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAPPLPGGAAVIPPPPPLP 629 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG PPPP G P P PP P P P P Sbjct: 715 PPPPLPGGTIPPPPPLFGGAVPPPPPLPGGGA-GPPPPPPGGPPMAPSLGSYPFAPVPVM 773 Query: 420 P 418 P Sbjct: 774 P 774 >UniRef50_A4S1A8 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 388 Score = 60.5 bits (140), Expect = 5e-08 Identities = 29/78 (37%), Positives = 31/78 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PPP PP P PPP PP P +P P PPP P Sbjct: 91 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSP 150 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P +P PP Sbjct: 151 P-PSPPPSPPPSPPPSPP 167 Score = 60.1 bits (139), Expect = 7e-08 Identities = 31/90 (34%), Positives = 32/90 (35%) Frame = +2 Query: 530 GGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA 709 G G V P PPP PP PPP P PPP PP P Sbjct: 79 GCGCGVSVCPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 138 Query: 710 PXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P PPP PP P PP P+ P P Sbjct: 139 PPNPPPSPPPSPPPSPPPSPP-PSPPPSPP 167 Score = 58.8 bits (136), Expect = 2e-07 Identities = 26/70 (37%), Positives = 26/70 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PP PPP P PPP PP P P PPP P Sbjct: 100 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPP 159 Query: 749 PXPXAGPPXP 778 P P PP P Sbjct: 160 PSPPPSPPVP 169 Score = 58.0 bits (134), Expect = 3e-07 Identities = 27/77 (35%), Positives = 29/77 (37%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 P PP PPP PP P PPP PP P +P P PPP PP Sbjct: 88 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPP 147 Query: 752 XPXAGPPXPAAPXXXPP 802 P P+ P PP Sbjct: 148 PSPPPSPPPSPPPSPPP 164 Score = 58.0 bits (134), Expect = 3e-07 Identities = 28/78 (35%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PP PPP P PPP PP P +P P PPP P Sbjct: 88 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP-----PPSPPPSPPPSPPPNP 142 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P+ P PP Sbjct: 143 PPSPPPSPPPSPPPSPPP 160 Score = 56.8 bits (131), Expect = 7e-07 Identities = 26/70 (37%), Positives = 27/70 (38%) Frame = +2 Query: 593 GGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP 772 G G PPP PP P PPP PP P +P P PPP PP P Sbjct: 79 GCGCGVSVCPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSP 138 Query: 773 XPAAPXXXPP 802 P P PP Sbjct: 139 PPNPPPSPPP 148 Score = 56.8 bits (131), Expect = 7e-07 Identities = 27/74 (36%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-PX 745 P PPP PP PPP P PPP PP P P PPP P Sbjct: 96 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPP 155 Query: 746 PPXPXAGPPXPAAP 787 P P + PP P P Sbjct: 156 PSPPPSPPPSPPVP 169 Score = 44.4 bits (100), Expect = 0.004 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP P PPP P P PPP PP P P PPP P Sbjct: 88 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP-PSPPPNPPPSP 146 Query: 420 PP 415 PP Sbjct: 147 PP 148 Score = 44.4 bits (100), Expect = 0.004 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP P PPP P P PPP PP P P PPP P Sbjct: 100 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPP-PSPPPSPPPSP 158 Query: 420 PP 415 PP Sbjct: 159 PP 160 Score = 44.4 bits (100), Expect = 0.004 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP P PPP P P PPP PP P P PPP P Sbjct: 104 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPP-PSPPPSPPPSP 162 Query: 420 PP 415 PP Sbjct: 163 PP 164 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP PPP P P P P PPP P P PPP Sbjct: 106 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSPPPS 165 Query: 420 PP 415 PP Sbjct: 166 PP 167 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = +3 Query: 528 GGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXX 704 G G P PP P P PPP PPP P PPP PP Sbjct: 81 GCGVSVCPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPP 140 Query: 705 XXPPGXP 725 PP P Sbjct: 141 NPPPSPP 147 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP PPP P P P P PPP P P PP PP Sbjct: 110 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPP--PSPPPSPP 167 Query: 420 PP 415 P Sbjct: 168 VP 169 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP PPP P P P PPP +PPP Sbjct: 90 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPS 149 Query: 421 PPP 413 PPP Sbjct: 150 PPP 152 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP PPP P P P PPP +PPP Sbjct: 102 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPS 161 Query: 421 PPP 413 PPP Sbjct: 162 PPP 164 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -1 Query: 571 GXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G G PPP P P P PPP PPP PP Sbjct: 79 GCGCGVSVCPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 131 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PPP PPP P P P PPP PPP Sbjct: 106 PPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPNPPPSPPPSPPPSPPPSPPPSPPPS 165 Query: 418 PP 413 PP Sbjct: 166 PP 167 >UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila melanogaster|Rep: CG5514-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 1150 Score = 60.5 bits (140), Expect = 5e-08 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PPPP PP P P PPPPP PP PP P AP P Sbjct: 404 PPPAPPTLVP-PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEP 461 Score = 59.3 bits (137), Expect = 1e-07 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP PPPPPP P PPPP PP P P PPPP Sbjct: 416 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPP 475 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P PP PA P P Sbjct: 476 PAPTELEPPPPPAPPKVELP 495 Score = 58.8 bits (136), Expect = 2e-07 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPP PP P PPP P P AP PPPPP Sbjct: 402 PPPPPAPP------TLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPA 455 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP PA PP Sbjct: 456 PTKVEPPPPPAPAEVEPP 473 Score = 56.4 bits (130), Expect = 9e-07 Identities = 31/81 (38%), Positives = 31/81 (38%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP---PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPP G P PPPP PPPP PP P P PPPP Sbjct: 370 PPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPP--TIKPPPP 427 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP PP P AP P Sbjct: 428 PAPPTVEPPPPPPPAPPTVEP 448 Score = 56.4 bits (130), Expect = 9e-07 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPP PP P PPPP P P P PPPP Sbjct: 413 PPPPPAPP------TIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPA 466 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PP PA PP Sbjct: 467 PAEVEPPPPPAPTELEPP 484 Score = 56.0 bits (129), Expect = 1e-06 Identities = 31/82 (37%), Positives = 31/82 (37%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPPP PPP PP P PPPP P P AP PPPP Sbjct: 424 PPPPPAP----PTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPT 479 Query: 743 --XPPXPXAGPPXPAAPXXXPP 802 PP P A P P PP Sbjct: 480 ELEPPPPPAPPKVELPPPPAPP 501 Score = 52.0 bits (119), Expect = 2e-05 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXP--GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP P PPPP PP G P P A P P PP PP PA P P Sbjct: 357 PPPPPRPASPKVEPPPPAPP---GVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVP 413 Query: 800 P 802 P Sbjct: 414 P 414 Score = 51.6 bits (118), Expect = 2e-05 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP T PPPP P P PPPPPP P PPPPP Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Query: 420 P 418 P Sbjct: 454 P 454 Score = 48.4 bits (110), Expect = 2e-04 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 10/88 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPPP PPPP P PP P PP P P PPPPP Sbjct: 357 PPPPPRPAS------PKVEPPPPAPPGVESPPGPQPPASPRFDPP--PPHTIEPPPPPAP 408 Query: 743 ----XPPXP----XAGPPXPAAPXXXPP 802 PP P PP PA P PP Sbjct: 409 PTLVPPPPPAPPTIKPPPPPAPPTVEPP 436 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPP P P PPPPPP Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPP 453 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP T PPPPP P P PPPPP P PPPP Sbjct: 436 PPPPPPA-------PPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPA 488 Query: 420 PP 415 PP Sbjct: 489 PP 490 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP T PPPPP P P PPPPP P PPPP Sbjct: 441 PAPPTVEPPPPPPPAPTKVEPPPPPAP-AEVEPPPPPAPTELEPPPPPAPPKVELPPPPA 499 Query: 420 PP 415 PP Sbjct: 500 PP 501 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/71 (36%), Positives = 26/71 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP PPPP P P AP PPPP P Sbjct: 448 PPPPPPPA------PTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAPP 501 Query: 749 PXPXAGPPXPA 781 A P A Sbjct: 502 KAEAAITPRRA 512 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP PP P P PPPPPP P PPPP P Sbjct: 427 PPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P PPPP P P AP PP P P P PP P PP Sbjct: 350 PAPPKVNP-PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPP 405 Score = 44.0 bits (99), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPP P P PPPPP Sbjct: 424 PPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 413 PPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVE-PPPPPPP 454 Score = 42.7 bits (96), Expect = 0.011 Identities = 20/64 (31%), Positives = 22/64 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP PPPPP + P P PPPP PPPP Sbjct: 428 PAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Query: 421 PPPE 410 PP+ Sbjct: 488 APPK 491 Score = 42.3 bits (95), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 T PPPP P P PPPPP P PPPPP Sbjct: 421 TIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 41.1 bits (92), Expect = 0.035 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 5/67 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP--XPXXPXXPP- 430 P PP G + PPPP P PPP PP P P PP Sbjct: 373 PAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPT 432 Query: 429 --PPPPP 415 PPPPP Sbjct: 433 VEPPPPP 439 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA--GPPXPAAPXXXPP 802 P P P PP PP P P PPPP PP + GP PA+P PP Sbjct: 344 PEPVQVPAPPKVNPP------PPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPP 395 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP E P PPPPP PPPPP P Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPP P P P PPPPP PPPP P E Sbjct: 426 PPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAE 469 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPPP E + P P PPPP PPPP PP+ Sbjct: 461 PPPPPAPAEV-EPPPPPAPTELEPPPPPAPPKVELPPPPAPPK 502 Score = 38.3 bits (85), Expect = 0.25 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 3/96 (3%) Frame = -2 Query: 471 PPPPPXPXXP-XXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX 295 PPPPP P P PPPP PP PP + P Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPP 416 Query: 294 PGXXXXGXXPP--PPXXXXPPRXPXTPXXPGGPGXP 193 P PP PP PP P P P P Sbjct: 417 PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPP 452 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 4/67 (5%) Frame = -1 Query: 601 PPPPXXXG----GGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT 434 PPPP G G PPPP + P P PPPP Sbjct: 370 PPPPAPPGVESPPGPQPPASPRFDPPPP-----HTIEPPPPPAPPTLVPPPPPAPPTIKP 424 Query: 433 PPPPPPP 413 PPPP PP Sbjct: 425 PPPPAPP 431 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPP-PPXPXXPXXPPPPP 421 PPPPP + P P PP P P P PPPP Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPP 397 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP PPPP P P PPPP P PPPP Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEP--PPPPA 407 Query: 420 PP 415 PP Sbjct: 408 PP 409 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP---PPPPXXXPXPPPXXPP 680 P PPPP G P P PPPP PPP PP Sbjct: 366 PKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP-PXXXPXPPPXXPP 680 P PPPP A PPPPP P PPP PP Sbjct: 390 PRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPP 431 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP-XPXXPXXPP---PPPPP 415 PP PP P PPPP P P PP PPPPP Sbjct: 372 PPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 60.5 bits (140), Expect = 5e-08 Identities = 33/73 (45%), Positives = 33/73 (45%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPP P GPPPP PP G P PPPPP P Sbjct: 983 PPPPPLPGFSGPP----PPPPPPLPGFSGGPPPPPPPPLPGFSGGAPP-----PPPPPMP 1033 Query: 749 PXPXAGPPXPAAP 787 P PP P AP Sbjct: 1034 GAPI--PPPPGAP 1044 Score = 50.4 bits (115), Expect = 6e-05 Identities = 27/62 (43%), Positives = 27/62 (43%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G GG PPPPP G P PPPPPP P P PPP Sbjct: 998 PPPPLPGFSGGPP-------PPPPPPLPGFSGGAP-------PPPPPPMPGAPIPPPPGA 1043 Query: 420 PP 415 PP Sbjct: 1044 PP 1045 Score = 50.0 bits (114), Expect = 8e-05 Identities = 29/65 (44%), Positives = 29/65 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPP P G PPP PP P AP PPPP P Sbjct: 997 PPPPPLPGFSGGP---PPPPPPPLPGFSGGAPPPPPP-----PMPGAP----IPPPPGAP 1044 Query: 749 PXPXA 763 P P A Sbjct: 1045 PLPGA 1049 Score = 47.6 bits (108), Expect = 4e-04 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPPP G P PPPPPP P PPPP Sbjct: 984 PPPPLPGFSG--------PPPPPPPPLPGFSGGPP-------PPPPPPLPGFSGGAPPPP 1028 Query: 420 PP 415 PP Sbjct: 1029 PP 1030 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPP P PPPPPPP G GG P Sbjct: 980 PPPPPPPPLPGFSGPPP------PPPPPLPGFSGGPPPPPPP-----PLPGFSGGAPPPP 1028 Query: 360 P 358 P Sbjct: 1029 P 1029 Score = 45.2 bits (102), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXP----PPPPXPPXPXAGPPXPAAPXXXPPXXG 811 GPPPP PP G P P P PPP PP P G A P PP G Sbjct: 979 GPPPPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPMPG 1034 Score = 44.0 bits (99), Expect = 0.005 Identities = 25/63 (39%), Positives = 25/63 (39%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G G PPPPP G P PPPPP PPPP Sbjct: 983 PPPPPLPGFSGPP-------PPPPPPLPGFSGGPPP-------PPPPPLPGFSGGAPPPP 1028 Query: 421 PPP 413 PPP Sbjct: 1029 PPP 1031 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPP P PPP PP G PP P Sbjct: 980 PPPPPPPPLPGFSG-----PPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPP 1030 Score = 39.9 bits (89), Expect = 0.081 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP GG P PPP P PPP PP G PPG P Sbjct: 994 PPPPPPPPLPGFSGG---PPPPPPPPLPGFSGGAPPPPPPPMPGA--PIPPPPGAP 1044 Score = 39.5 bits (88), Expect = 0.11 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 3/72 (4%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXP---XXXXXPPPPPXXX 449 G PPPP G G PPP P G P P PPPPP Sbjct: 976 GFNGPPPPPPPPLPG---FSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPM 1032 Query: 448 XXXXTPPPPPPP 413 PPPP P Sbjct: 1033 PGAPIPPPPGAP 1044 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 P PPPP GG P PPPP P PPP PP G Sbjct: 1009 PPPPPPPPLPGFSGG----APPPPPPPMPGAPIPPPPGAPPLPG 1048 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP G P PPP P PPP PP G PP P Sbjct: 980 PPPPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPP 1031 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXG--GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 P P P P P G G P P PPP PP P G P PP Sbjct: 959 PKPDSSPAPEKPAAKQEGFNGPPPPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLP 1018 Query: 809 GXGG 820 G G Sbjct: 1019 GFSG 1022 >UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 191 Score = 60.1 bits (139), Expect = 7e-08 Identities = 28/73 (38%), Positives = 30/73 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P P PP G P P + PPPPP P Sbjct: 117 PPPPPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPPPRDGSSPPPPP-P 175 Query: 749 PXPXAGPPXPAAP 787 A PP P+ P Sbjct: 176 RDGSAPPPPPSGP 188 Score = 59.7 bits (138), Expect = 9e-08 Identities = 29/84 (34%), Positives = 32/84 (38%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPP PPPP PP G P + PPPPP Sbjct: 54 PPPPNNGSDPALQQNKRSASPPPPRDGSSPPPP-PPRDGASPPAPPPRDGSSPPPPPPRD 112 Query: 752 XPXAGPPXPAAPXXXPPXXGXGGA 823 PP P+ PP G G + Sbjct: 113 GSSPPPPPPSKRAASPPPPGDGSS 136 Score = 58.8 bits (136), Expect = 2e-07 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPP PPP PP G P P + PPPPP P Sbjct: 106 PPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPP-P 164 Query: 749 PXPXAGPPXPAAPXXXPPXXGXG 817 + PP P PP G Sbjct: 165 RDGSSPPPPPPRDGSAPPPPPSG 187 Score = 58.4 bits (135), Expect = 2e-07 Identities = 33/83 (39%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPPPP PP P PP G P P + PPPPP P Sbjct: 74 PPPPRDGSS---------PPPPPPRDGASPPAP-PPRDGSSPPPPPPRDGSSPPPPP-PS 122 Query: 752 XPXAGPPXP---AAPXXXPPXXG 811 A PP P ++P PP G Sbjct: 123 KRAASPPPPGDGSSPPPPPPRDG 145 Score = 58.0 bits (134), Expect = 3e-07 Identities = 31/87 (35%), Positives = 34/87 (39%), Gaps = 6/87 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXC---XXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G PPPPPP PPPP P P P + PPPP Sbjct: 83 PPPPPPRDGASPPAPPPRDGSSPPPPPPRDGSSPPPPPPSKRAA--SPPPPGDGSSPPPP 140 Query: 740 PXPPXPXAGPPXP---AAPXXXPPXXG 811 P PP P ++P PP G Sbjct: 141 PPRDGSSPRPPPPRDGSSPPPPPPRDG 167 Score = 55.2 bits (127), Expect = 2e-06 Identities = 47/164 (28%), Positives = 47/164 (28%), Gaps = 1/164 (0%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G P G PPPP G PPPPP G Sbjct: 44 PPPSPSNGSAPPPPNNGSDPALQQNKRSASPPPPRDGSS-----------PPPPPPRDGA 92 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXX 331 P P PPPPPP PPPPPP G PP Sbjct: 93 SPPAPPPRDGSSPPPPPPRDGSS--PPPPPPSKRAASPPPPGDGSSPPPPPPRD--GSSP 148 Query: 330 XXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPR-XPXTPXXPGGP 202 P P G PPPP PPR P P GP Sbjct: 149 RPPPPRDGSSPPPPPPRDGSSPPPP----PPRDGSAPPPPPSGP 188 Score = 51.6 bits (118), Expect = 2e-05 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G P PPP G P P PPPPPP PPP Sbjct: 128 PPPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPPPRDGSSPPPPPPRDGSAPPPPPSG 187 Query: 420 PP 415 PP Sbjct: 188 PP 189 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP P PPP G P P PPPPP P Sbjct: 125 AASPPPPGDGSSPPPPPPRDGSSPRPPPPRDGSSPPPPP-PRDGSSPPPPPPRDGSAPPP 183 Query: 430 PPPPPP 413 PP PP Sbjct: 184 PPSGPP 189 Score = 40.7 bits (91), Expect = 0.046 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP- 425 PPPP PP PP G P P PPPPP PPP Sbjct: 74 PPPPRDGSSPPPPPPRDGASPPAPPPRDGSSPPPPP-PRDGSSPPPPPPSKRAASPPPPG 132 Query: 424 ----PPPP 413 PPPP Sbjct: 133 DGSSPPPP 140 Score = 40.3 bits (90), Expect = 0.061 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP-AAPXXXPPXX 808 PPPP G PP PP G A PPPP P PP A+P PP Sbjct: 43 PPPPSPSNGSAPP-PPNNGSDPALQQNKRSASPPPPRDGSSPPPPPPRDGASPPAPPPRD 101 Query: 809 G 811 G Sbjct: 102 G 102 Score = 36.7 bits (81), Expect = 0.75 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 13/66 (19%) Frame = +2 Query: 629 PPPPPXXXPGPPPPX--------PPXXGGXXXPXAPXXXAXPPPP-----PXPPXPXAGP 769 P P P GPPPP PP G A PPPP P PP P G Sbjct: 33 PRPRPGNSTGPPPPSPSNGSAPPPPNNGSDPALQQNKRSASPPPPRDGSSPPPPPPRDGA 92 Query: 770 PXPAAP 787 PA P Sbjct: 93 SPPAPP 98 Score = 35.5 bits (78), Expect = 1.7 Identities = 33/135 (24%), Positives = 33/135 (24%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P P G G PPP G PPPP PPPPPP Sbjct: 33 PRPRPGNSTGPPPPSPSNGSAPPPPNNGSDPALQQNKRSASPPPPRDG----SSPPPPPP 88 Query: 417 PXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP 238 G PP P P PPPP P Sbjct: 89 RDGASPPAPPPRDGSSPPPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPPRDGSSP 148 Query: 237 RXPXTPXXPGGPGXP 193 R P P P P Sbjct: 149 R-PPPPRDGSSPPPP 162 >UniRef50_UPI0000DA1EB9 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 270 Score = 60.1 bits (139), Expect = 7e-08 Identities = 28/58 (48%), Positives = 28/58 (48%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 150 GRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 59.3 bits (137), Expect = 1e-07 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 150 GRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 56.0 bits (129), Expect = 1e-06 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G GG G GG GGGGG G G GG GGGG G GGGG G Sbjct: 152 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 210 Score = 53.6 bits (123), Expect = 6e-06 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G G GG G GG GGGGG G G GG GGGG G G G G Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGRGRGRG 216 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 154 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 195 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 196 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 156 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 197 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 198 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 158 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 199 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 200 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 160 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 201 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 161 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 202 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 162 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 203 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 163 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 204 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 164 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 205 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 165 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 206 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 166 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 167 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 208 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGGG G G GGGGGG G G GGGGG Sbjct: 152 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 193 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G G GGG G G GGGGGG G G GGGGG Sbjct: 150 GRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 191 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGGGGG G G GGGGGG G G Sbjct: 183 GGGGGGGGGGGGGGGGGGGGGGGGGGRG 210 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGGGGG G G GGGGGG G G Sbjct: 185 GGGGGGGGGGGGGGGGGGGGGGGGRGRG 212 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGGGGG G G GGGGGG G G Sbjct: 187 GGGGGGGGGGGGGGGGGGGGGGRGRGRG 214 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGGGGG G G GGGGGG G G Sbjct: 189 GGGGGGGGGGGGGGGGGGGGRGRGRGRG 216 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 152 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 207 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 155 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 210 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GGGG G Sbjct: 157 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGRG 212 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 GGGGGGG GGGGG G G GGGG R Sbjct: 168 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGRGR 213 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GG G G Sbjct: 159 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGRGRG 214 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 G GGGGG GGGGG G G GGGGG Sbjct: 152 GRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 194 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GGG G GGGGGG G GGGG G Sbjct: 150 GRGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 190 >UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=1; Xenopus tropicalis|Rep: Wiskott-Aldrich syndrome protein (WASp). - Xenopus tropicalis Length = 451 Score = 60.1 bits (139), Expect = 7e-08 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGG--GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP P PPPP PPP PP P PPPPP Sbjct: 303 PPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPP 362 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP PP + P PP Sbjct: 363 PPPPSIPAPPPTSGPAPPPP 382 Score = 51.6 bits (118), Expect = 2e-05 Identities = 26/81 (32%), Positives = 26/81 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP G P P PP PPP PPPPP Sbjct: 304 PPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPP 363 Query: 420 PPXXXXXXXXGXGGGGXXXPP 358 PP G PP Sbjct: 364 PPPSIPAPPPTSGPAPPPPPP 384 Score = 50.8 bits (116), Expect = 4e-05 Identities = 24/69 (34%), Positives = 24/69 (34%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPPP P PPP G P P P PPP Sbjct: 298 GETAPPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGG 357 Query: 439 XTPPPPPPP 413 PPPPPPP Sbjct: 358 PPPPPPPPP 366 Score = 50.0 bits (114), Expect = 8e-05 Identities = 27/82 (32%), Positives = 27/82 (32%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPPPP P PP GG P P PPP P Sbjct: 326 PPPPVRGSSA--------PPPPPPSRSTPPIPPPTARSGGPPPPPPPPPSIPAPPPTSGP 377 Query: 752 XPXAGPPXPAAPXXXPPXXGXG 817 P PP P G Sbjct: 378 APPPPPPVSGTQSIPSPTPSGG 399 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP PP P P P P + PPPP P P P A PP Sbjct: 302 PPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPP 359 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP PP PP P P P PPP Sbjct: 320 GRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPPPPPSIPAPPP---TSG 376 Query: 439 XTPPPPPP 416 PPPPPP Sbjct: 377 PAPPPPPP 384 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP P P PPPPPP P P P Sbjct: 337 PPPPPSRSTPPIPPPTARSGGPPPPPPPPPSIPAPPPTSGPAPPPPPPVSGTQSIPSPTP 396 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP P P P PPP PPPPPP G PP Sbjct: 302 PPPPPPSRNAPPAPTPSRGRTGPLPPPPVRGSSAPPPPPPSRSTPPIPPPTARSGGPPPP 361 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP------PXPPXXGGXXXPXAP 712 P PPP GG PPPPPP P PPP P PP G +P Sbjct: 347 PIPPPTARSGGPP------PPPPPPPSIPAPPPTSGPAPPPPPPVSGTQSIPSP 394 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P P PPPP P P P Sbjct: 338 PPPPSRSTPPIPPPTARSGGPPPPPPPP---PSIPAPPPTSGPAPPPPPPVSGTQSIPSP 394 Query: 420 PP 415 P Sbjct: 395 TP 396 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 APPPPP P PPP + PPPPPP Sbjct: 301 APPPPPPSRNAPPAPTPSRGRTGPLPPPP-VRGSSAPPPPPP 341 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPPP----PPPXXXPXPPPXXPPXXG 689 PPP GG P PPP PPP P PPP PP G Sbjct: 349 PPPTARSGG---PPPPPPPPPSIPAPPPTSGPAPPP-PPPVSG 387 >UniRef50_Q197B3 Cluster: Putative uncharacterized protein; n=1; Aedes taeniorhynchus iridescent virus|Rep: Putative uncharacterized protein - Aedes taeniorhynchus iridescent virus Length = 407 Score = 60.1 bits (139), Expect = 7e-08 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P PPP P PPPP PP P P PPP P PP P PP P P P Sbjct: 286 PKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPPIPPQPVP 343 Score = 53.2 bits (122), Expect = 8e-06 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPPPPP P P PP P P P PPP P P Sbjct: 279 PQPPPDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPD-----PVPPPKPTPPPPKPTP 333 Query: 749 PXPXAGPPXPAAP 787 P P P P P Sbjct: 334 PPPIPPQPVPILP 346 Score = 52.4 bits (120), Expect = 1e-05 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P P PP PP P P P PPP PP P P P P PP Sbjct: 273 PPPQPKPQPPPDPPKPPPDPPKPDPPPPPPPK-PTPPPDPPKPKPDPVPPPKPTPPPP 329 Score = 48.0 bits (109), Expect = 3e-04 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +2 Query: 608 CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP-XAGPPXPAA 784 C PPP P P PP PP P P PPP P P P PP P Sbjct: 267 CVFKPDPPPQPKPQPPPDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTP 326 Query: 785 PXXXP 799 P P Sbjct: 327 PPPKP 331 Score = 44.0 bits (99), Expect = 0.005 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP P P PPPP PP Sbjct: 298 PPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPPIPP 339 Score = 43.6 bits (98), Expect = 0.007 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPPPP P P PPP P TPPPP PP+ Sbjct: 297 PPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPPIPPQ 340 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP---PPPP 415 PP PP P P PPP PP P PPP PPPP Sbjct: 285 PPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPP 329 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPP P P PP PP P Sbjct: 273 PPPQPKPQPPPDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKP 314 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P P PPP P P P PPPP Sbjct: 295 PDPPPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPP 336 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPP P P PPPPPP P P PP P P Sbjct: 279 PQPPPDPP---KPPPDPPKPDPPPPPPPKPTPPPDPPKPKP 316 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P P PP P P PPP PP Sbjct: 271 PDPPPQPKPQPPPDPPKPPPDPPKPDPPPPPPPKPTPPPDPP 312 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P K P PPPPPP P PP P P Sbjct: 275 PQPKPQPPPDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKP 316 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKX-PXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP K P P P PPP P P PPP P Sbjct: 282 PPDPPKPPPDPPKPDPPPPPPPKPTPPPDPPKPKPDPVPPPKP 324 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP-PPPPXXXPXPPPXXPP 680 P PP P P PP P PP P PPP PP Sbjct: 298 PPPPPPKPTPPPDPPKPKPDPVPPPKPTPPPPKPTPPPPIPP 339 >UniRef50_Q127H7 Cluster: Putative uncharacterized protein precursor; n=1; Polaromonas sp. JS666|Rep: Putative uncharacterized protein precursor - Polaromonas sp. (strain JS666 / ATCC BAA-500) Length = 261 Score = 60.1 bits (139), Expect = 7e-08 Identities = 29/58 (50%), Positives = 29/58 (50%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G GA G GG A G GG GGGG G G GG GGGG G GGGGGG Sbjct: 198 GGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 255 Score = 58.0 bits (134), Expect = 3e-07 Identities = 27/59 (45%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G +G GG GG GGG G G G GG GGGG G GGGGGG Sbjct: 194 GGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 252 Score = 56.8 bits (131), Expect = 7e-07 Identities = 32/72 (44%), Positives = 32/72 (44%) Frame = -2 Query: 783 AAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXK 604 AAG GG G G GGGGG A G GG GGGG G GGGGGG Sbjct: 190 AAGSGGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGG 249 Query: 603 XPPPPXXGGGGG 568 GGGGG Sbjct: 250 G----GGGGGGG 257 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/59 (49%), Positives = 29/59 (49%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG A G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 204 GGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGGGG 259 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/65 (38%), Positives = 25/65 (38%) Frame = -2 Query: 762 AXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXX 583 A G G GGG GA G G G GG G GGGGGG Sbjct: 185 AKGGNAAGSGGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGG 244 Query: 582 GGGGG 568 GGGGG Sbjct: 245 GGGGG 249 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G G GGGGGG G G GGGGG Sbjct: 215 GGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 256 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGGG G G GGGGGG G G GGGGG Sbjct: 216 GNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 257 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGG G G G GGGGGG G G GGGGG Sbjct: 218 GGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 259 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGGG G G G GGGG G G GGGGG Sbjct: 202 GAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGG 243 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGG G G GGGGGG G G GGGGG Sbjct: 211 GGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGG 251 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGG G G G GGGGGG G G GGGGG Sbjct: 212 GNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 253 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G GGGGGG G G GGGGG Sbjct: 214 GGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 255 Score = 40.3 bits (90), Expect = 0.061 Identities = 26/68 (38%), Positives = 26/68 (38%) Frame = -2 Query: 771 GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPP 592 GG A G GG GGG A G G GGG G G GGGG Sbjct: 187 GGNAAGSGGGKGGGSGAGGGGGNA--------GGNGGGNGGGGGNGGGGGGGGGGGGGGG 238 Query: 591 PXXGGGGG 568 GGGGG Sbjct: 239 GGGGGGGG 246 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G G GGG GG G G GGGGG Sbjct: 206 GGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGG 247 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGG G GGGGGG G G GGGGG Sbjct: 211 GGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 252 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG G GG G G GGG G G G GGGGG Sbjct: 199 GGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGG 240 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGG G GGGGG G G GGGGG Sbjct: 204 GGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGG 245 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG G G GGGG G G G GGGGG Sbjct: 205 GGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGG 246 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G GG GGG G G GGGGG Sbjct: 207 GGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGG 248 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGG GG G G GG GG G G GGGGG GGG Sbjct: 194 GGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 253 Query: 599 G 601 G Sbjct: 254 G 254 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGGG G GGGG G Sbjct: 214 GGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 254 Score = 35.5 bits (78), Expect = 1.7 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 422 GGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGG 601 G GGG G G GGGGG G GGGGG GGGG Sbjct: 192 GSGGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGG 251 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GG G GGGGGG G GGGG G Sbjct: 204 GGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 259 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 G GGGGG GGGGG G G GGGGG Sbjct: 216 GNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 258 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 SG GGGGG GGGG G G GGGGG Sbjct: 201 SGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGG 244 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GG G GGGG G G GGGG G Sbjct: 192 GSGGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGG 247 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG G GGG G G GGGG G GGGG G Sbjct: 195 GGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGG 250 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GG G G G G GGG G G GGGGG GG Sbjct: 187 GGNAAGSGGGKGGGSGAGGGGGNAGGNGGGNGGGGGNGGGGGGGGGGGGGGGGGGGGGGG 246 Query: 596 GG 601 GG Sbjct: 247 GG 248 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGG 539 +GGGGG G GGGGG G G GGGG Sbjct: 217 NGGGGGNGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 259 >UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|Rep: B1160F02.7 protein - Oryza sativa subsp. japonica (Rice) Length = 906 Score = 60.1 bits (139), Expect = 7e-08 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPPPX 745 PPP P G G PPPP P PPPP P P G P P P Sbjct: 303 PPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPR 362 Query: 746 PPXPXAGPPXP 778 PP P GPP P Sbjct: 363 PPGPGPGPPPP 373 Score = 49.6 bits (113), Expect = 1e-04 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 4/85 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP----PPPPPXPXXPXXP 433 PPPP G T PPPP P P PPPPP P P P Sbjct: 302 PPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAP 361 Query: 432 PPPPPPXXXXXXXXGXGGGGXXXPP 358 PP P G GG PP Sbjct: 362 RPPGPGPGPPPPPGAAGRGGGGPPP 386 Score = 49.6 bits (113), Expect = 1e-04 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP-XXXAXPPPPPX 745 PPP P G PPPPPP P P P P G P A PPPP Sbjct: 334 PPPAPSPSAAGAGSG----PPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPAL 389 Query: 746 PPXPXA-GPP 772 P P A GPP Sbjct: 390 PGGPRARGPP 399 Score = 44.8 bits (101), Expect = 0.003 Identities = 36/106 (33%), Positives = 36/106 (33%), Gaps = 12/106 (11%) Frame = -2 Query: 474 PPPP--PPXPXXPXXPP---------PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXX 328 PPPP PP P P PP PPPP G G G PP Sbjct: 276 PPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAH-------P 328 Query: 327 XXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPG-GPGXP 193 P P G PPPP PP P P PG GPG P Sbjct: 329 AAPAPPPPAPSPSAAGAGSGPPPPP---PPAAPAAPRPPGPGPGPP 371 Score = 44.8 bits (101), Expect = 0.003 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 19/83 (22%) Frame = +2 Query: 626 PPPPPPXXX------PGPPPPXPPXXGG----XXXPXAPXXXAXPPPPPXPPXPXAG--- 766 PPP PP P PP P PP G P P A P PPP P P A Sbjct: 287 PPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAG 346 Query: 767 -----PPXPAAP-XXXPPXXGXG 817 PP PAAP PP G G Sbjct: 347 SGPPPPPPPAAPAAPRPPGPGPG 369 Score = 44.4 bits (100), Expect = 0.004 Identities = 43/150 (28%), Positives = 43/150 (28%), Gaps = 2/150 (1%) Frame = -2 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPP-PXXXGXXXKXPXPXXXXXPPP 466 GGG PPPP PPPP P G PPP Sbjct: 268 GGGQVPAAPPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAGA----GTGAPPP 323 Query: 465 PPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGX 286 PP P P PPP P P G G G PP P PG Sbjct: 324 PPAHPAAPAPPPPAPSPSAA-----GAGSGPPPPPPPA--APAAPRPPGPGPGPPPPPGA 376 Query: 285 XXXGXX-PPPPXXXXPPRXPXTPXXPGGPG 199 G PPPP PR P PG Sbjct: 377 AGRGGGGPPPPALPGGPRARGPPPFKKSPG 406 Score = 42.3 bits (95), Expect = 0.015 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 10/73 (13%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP----------PPPXPPXPXAGPPXP 778 PPPP P PPP PP P PP PPP P P A P P Sbjct: 276 PPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPP 335 Query: 779 AAPXXXPPXXGXG 817 AP G G Sbjct: 336 PAPSPSAAGAGSG 348 Score = 41.9 bits (94), Expect = 0.020 Identities = 28/91 (30%), Positives = 28/91 (30%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGE 512 PP G G G G A PPPP G PPPPP Sbjct: 303 PPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAA---GAGSGPPPPPPP---A 356 Query: 511 XXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 P P PPPPP PPPP Sbjct: 357 APAAPRPPGPGPGPPPPPGAAGRGGGGPPPP 387 Score = 39.9 bits (89), Expect = 0.081 Identities = 27/94 (28%), Positives = 28/94 (29%) Frame = -2 Query: 702 GXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPX 523 G PP G G G G PPPP PPPPP Sbjct: 299 GHHPPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGP---PPPPPP 355 Query: 522 XXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 + P P PPPPP PPPP Sbjct: 356 AAPAAPRPPGPGPG--PPPPPGAAGRGGGGPPPP 387 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPP--PXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP G PPPPP P PPP P G PP P Sbjct: 302 PPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPP 355 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 686 GGXXXPXAPXXXAXPPPPPXPPXPXA----GPPXPAAPXXXPPXXGXG 817 GG P AP A PPPP PP P + P P PP G G Sbjct: 268 GGGQVPAAPPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAG 315 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP-----PXXPPXXGGXXXXXXPP 716 PPPP P PPPP P PP P PP G PP Sbjct: 333 PPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPP 386 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP + P P PPPP PPPP P Sbjct: 350 PPPPPPAAPAAPRPPGPGPGP-PPPPGAAGRGGGGPPPPALP 390 >UniRef50_Q5VS40 Cluster: Putative glycine-rich protein; n=3; Oryza sativa|Rep: Putative glycine-rich protein - Oryza sativa subsp. japonica (Rice) Length = 174 Score = 60.1 bits (139), Expect = 7e-08 Identities = 33/77 (42%), Positives = 34/77 (44%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G GG + G GG GGGGG GA G GG GG G G GGGGGG Sbjct: 24 GGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGG---GGGGGGKG 80 Query: 618 XXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 81 RKGGAGGHGGAGGGGGG 97 Score = 56.4 bits (130), Expect = 9e-07 Identities = 32/77 (41%), Positives = 33/77 (42%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G GA+G GG G GG GGGGG G G GG GGGG G GG GG Sbjct: 30 GGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHG 89 Query: 618 XXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 90 GAGG------GGGGGGG 100 Score = 53.6 bits (123), Expect = 6e-06 Identities = 30/78 (38%), Positives = 31/78 (39%), Gaps = 1/78 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXX-GGXGGGGPGXXXGGGGGG 625 GG G G GG A G GG GG GG G G GG GG G GGGGGG Sbjct: 41 GGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGG 100 Query: 624 XXXXXXKXPPPPXXGGGG 571 + G GG Sbjct: 101 KGRKGGRGGDGGSGGAGG 118 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G GG GG GG GA G G GG G GGGGG Sbjct: 38 GGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGG 97 Query: 621 XXXXXKXPPPPXXGGGGG 568 + GG GG Sbjct: 98 GGGKGRKGGRGGDGGSGG 115 Score = 52.8 bits (121), Expect = 1e-05 Identities = 28/73 (38%), Positives = 28/73 (38%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G GG G GGGGG G G GG GG G GGGGGG Sbjct: 22 GRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGR 81 Query: 606 KXPPPPXXGGGGG 568 K G GGG Sbjct: 82 KGGAGGHGGAGGG 94 Score = 51.6 bits (118), Expect = 2e-05 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G GG GG GGGGG GA G GG GGGG G G GG G Sbjct: 55 GGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGG-AGGGGGGGGGKGRKGGRGGDGGS 113 Query: 618 XXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 114 GGAGGRGGDGGSGGQGG 130 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG G G GGG GG G G GGGGG GG Sbjct: 37 GGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGG 96 Query: 596 GG 601 GG Sbjct: 97 GG 98 Score = 46.8 bits (106), Expect = 7e-04 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G G A G GG GGGGG G G G GG G GG GG Sbjct: 72 GGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGG 130 Score = 46.8 bits (106), Expect = 7e-04 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G GA G GG G GG GG G G G GG GG G GG GGG Sbjct: 80 GRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGRGGDGGG 137 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = -2 Query: 765 PAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPX 586 P G G GG G G G GG GGGG G GGG GG Sbjct: 10 PVDGEPGQPGGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGA 69 Query: 585 XGGGGG 568 GGGGG Sbjct: 70 GGGGGG 75 Score = 44.8 bits (101), Expect = 0.003 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GGGG G G GGGGGG G G GGGGG GG Sbjct: 34 GASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGG 93 Query: 596 GG 601 GG Sbjct: 94 GG 95 Score = 42.7 bits (96), Expect = 0.011 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GG GG G G GGGGGG G G GGGGG Sbjct: 59 GKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGG 100 Score = 39.9 bits (89), Expect = 0.081 Identities = 32/116 (27%), Positives = 32/116 (27%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G G G G G GG GGGG G GG Sbjct: 22 GRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGR 81 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGG G G G GG GG G G G GGG Sbjct: 82 KGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGRGGDGGG 137 Score = 38.7 bits (86), Expect = 0.19 Identities = 33/116 (28%), Positives = 33/116 (28%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG PG G RGG GG G G K GG Sbjct: 13 GEPGQPGGRG----RGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGG 68 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G G GGGG G G GG GG Sbjct: 69 AGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGG 124 Score = 37.1 bits (82), Expect = 0.57 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G G G GG GG GG G G GG GGGG GG GG Sbjct: 13 GEPGQPG-GRGRGGRGGRGGRGGASGGGGGGG--GGGGGGGGGGAGGKGGKGGAGGHGGA 69 Query: 606 KXPPPPXXGGGGG 568 GGGGG Sbjct: 70 GG----GGGGGGG 78 Score = 37.1 bits (82), Expect = 0.57 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXX 590 SGGGGGGG GGGGG G G GGGGG Sbjct: 36 SGGGGGGG---GGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAG 92 Query: 591 GGGG 602 GGGG Sbjct: 93 GGGG 96 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGG G G GGGG G Sbjct: 38 GGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGG 78 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 GGGGG G GG GG G G GG GGA R Sbjct: 74 GGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGR 119 >UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n=5; root|Rep: Chromosome 13 contig 1, DNA sequence - Ostreococcus tauri Length = 1990 Score = 60.1 bits (139), Expect = 7e-08 Identities = 28/70 (40%), Positives = 29/70 (41%), Gaps = 2/70 (2%) Frame = +2 Query: 599 GXXCXXXXXPPPPP--PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP 772 G C P PPP P P PPPP PP P P PPP P P P PP Sbjct: 774 GLGCVSSPPPSPPPPNPPPLPSPPPPSPPPP-SPTPPLPPPPSPFPPPSPSPSPPPPSPP 832 Query: 773 XPAAPXXXPP 802 P+ P PP Sbjct: 833 PPSPPPPSPP 842 Score = 59.3 bits (137), Expect = 1e-07 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPPPX 745 PP PP PPPP P P PPPP P P P P PPPP Sbjct: 782 PPSPPPPNPPPLPSPPPPSPPPPSPTP-PLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPS 840 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P PP PA P PP Sbjct: 841 PPPPSPFPP-PAPPPPSPP 858 Score = 49.6 bits (113), Expect = 1e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPP P P P P PP P +P + PPP P PP Sbjct: 796 PPPPSPP---PPSPTPPLPPPPSPFPPPSPSPSPPPP---SPPPPSPPPPSPPPPSPFPP 849 Query: 752 XPXAGPPXPAAPXXXPPXXGXGG 820 P PP P P GG Sbjct: 850 -PAPPPPSPPPADECPNLKVVGG 871 Score = 48.0 bits (109), Expect = 3e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXP-PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP P PPP P P P PPPP P P PPPP Sbjct: 796 PPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPPP 855 Query: 423 PPP 415 PP Sbjct: 856 SPP 858 Score = 47.6 bits (108), Expect = 4e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PPP P P P P PPPP P P PPP P Sbjct: 782 PPSPPPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSP 841 Query: 420 PP 415 PP Sbjct: 842 PP 843 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPPXXXXXXXXXXGG 378 PPP P P P PPPP PPP PPP GG Sbjct: 818 PPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPPPSPPPADECPNLKVVGG 871 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPP P +PPPP PP Sbjct: 796 PPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPP 837 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G + PP P PPP P P P PPPP Sbjct: 776 GCVSSPPPSPPPPNPPPLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPS 835 Query: 439 XTPPPPPPP 413 PP PPPP Sbjct: 836 PPPPSPPPP 844 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P P PPP P PPP PP PP Sbjct: 792 PLPSPPPPSPPPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPP 844 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PPPP P PPP PP PP P Sbjct: 802 PPPSPTPPLPPPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPPPSP 857 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPPP PPP PPP Sbjct: 812 PPPSPFPPPSPSPSPPPPSPPPPSPPPPSPPPPSPFPPPAPPP 854 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + P PPPP P P PPP PP Sbjct: 822 PSPSPPPPSPP----PPSPPPPSPPPPSPFPPPAPPPPSPP 858 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 594 GGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 G G + P PPPP P P PPP PP PP Sbjct: 774 GLGCVSSPPPSPPPPNPPPLPSPPPPSPPPPSPTPPLPPPP 814 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPP P P PPP P PP P Sbjct: 781 PPPSPPPPNPPP---LPSPPPPSPPPPSP-TPPLPPPPSPFPPPSPSPSPPPPSPP 832 >UniRef50_Q7Z152 Cluster: Collagen protein 51; n=4; Caenorhabditis|Rep: Collagen protein 51 - Caenorhabditis elegans Length = 435 Score = 60.1 bits (139), Expect = 7e-08 Identities = 55/203 (27%), Positives = 56/203 (27%), Gaps = 6/203 (2%) Frame = -2 Query: 783 AAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXK 604 A G GG A G GG GGGGG G G G G PG G G + Sbjct: 102 AGGGGGYAAGGGGGGGGGG-----GGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQ 156 Query: 603 XPPPPXXG----GGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXX 436 P G G G PP PP G P P P P Sbjct: 157 DGQPGQAGQADSGSSGQACITCPAGPPGPPGPDGNAGPAGAPGVPG-PDGDAGSPPPPGP 215 Query: 435 PPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXX--PP 262 P PP PP G P PG G P Sbjct: 216 PGPPGPPGNDGQPGAPGQDGQPGAPGTNTVNSPGGPGPAGPPGPPGPPGQDGSGGAAQPG 275 Query: 261 PPXXXXPPRXPXTPXXPGGPGXP 193 PP PP P PG PG P Sbjct: 276 PPGPPGPPGNDGQPGGPGQPGGP 298 Score = 58.0 bits (134), Expect = 3e-07 Identities = 55/206 (26%), Positives = 57/206 (27%), Gaps = 9/206 (4%) Frame = -2 Query: 783 AAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXK 604 AAG GG GG GGGGG G G G G PG G G + Sbjct: 101 AAGGGGGYAAGGGGGGGGG----GGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQ 156 Query: 603 XPPPPXXG----GGGGXXXXXTXXXPPPPPXXXGXXXK-----XPXPXXXXXPPPPPPXP 451 P G G G PP PP G P P PPPP Sbjct: 157 DGQPGQAGQADSGSSGQACITCPAGPPGPPGPDGNAGPAGAPGVPGPDGDAGSPPPP--- 213 Query: 450 XXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGX 271 PP PP P G G P + P P Sbjct: 214 ----GPPGPPGPPGNDGQPGAPGQDGQPGAPGTNTVNSPGGPGPAGPPGPPGPPGQDGSG 269 Query: 270 XPPPPXXXXPPRXPXTPXXPGGPGXP 193 P PP P PGGPG P Sbjct: 270 GAAQPGPPGPPGPPGNDGQPGGPGQP 295 Score = 51.6 bits (118), Expect = 2e-05 Identities = 44/144 (30%), Positives = 44/144 (30%), Gaps = 8/144 (5%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGG-----XXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPP-- 574 GGGGG G G GGGGGG G P G G P Sbjct: 103 GGGGGYAAGGGGGGGGGGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQDGQPGQ 162 Query: 575 -PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 G G C PP PP P P G P A PPPP PP Sbjct: 163 AGQADSGSSGQACITCPAGPPGPPGPDGNAGPAGAPGVPG------PDGDAGSPPPPGPP 216 Query: 752 XPXAGPPXPAAPXXXPPXXGXGGA 823 P GPP P G GA Sbjct: 217 GP-PGPPGNDGQPGAPGQDGQPGA 239 Score = 51.6 bits (118), Expect = 2e-05 Identities = 42/150 (28%), Positives = 44/150 (29%), Gaps = 14/150 (9%) Frame = +2 Query: 416 GGGGGG------------GXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXX 559 GGGGGG G G G G G G G G + Sbjct: 119 GGGGGGCHCAAQASGCPAGPPGPPGEAGTDGEPGQAGQDGQPGQAGQADSGSSGQACITC 178 Query: 560 XXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXX-GGXXXPXAPXXXAXPP 733 PP PP G P P P PP PP PP G P AP P Sbjct: 179 PAGPPGPPGPDGNAGPAGAPGVPGPDGDAGSPPPPGPPGPPGPPGNDGQPGAPGQDGQPG 238 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P G P PA P P G G+ Sbjct: 239 APGTNTVNSPGGPGPAGPPGPPGPPGQDGS 268 Score = 46.8 bits (106), Expect = 7e-04 Identities = 38/96 (39%), Positives = 38/96 (39%), Gaps = 12/96 (12%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGX--GGGGGXAXXXGAXGXXXPP--XXGGXGGGGPG 652 PP GG G GG G GG GGGGG A GA G GG GGGG G Sbjct: 314 PPRTPAGGGGGGDFPAGG---GGGGYSTGGGGGRADSGGAAGGAGGAGGYSGGGGGGGGG 370 Query: 651 XXXGGG---GGGXXXXXXKXP-----PPPXXGGGGG 568 GGG GGG P P P GGG Sbjct: 371 AAAGGGYNAGGGGGGAPQAAPAPQAAPAPAAPAGGG 406 Score = 45.6 bits (103), Expect = 0.002 Identities = 40/143 (27%), Positives = 42/143 (29%), Gaps = 7/143 (4%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PGPPG G G GG GG PG + GG Sbjct: 275 GPPGPPGPPGNDGQPGGPGQPGG---------PGQDGGPGTDAAYCPCPPRTPAGGGGGG 325 Query: 374 PPPPXPXXXXXXFXGGGG-------GGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGG 532 P GGGG GG G G GGGGG G + GG Sbjct: 326 DFPAGGGGGGYSTGGGGGRADSGGAAGGAGGAGGYSGGGGGGGGGAAAG--GGYNAGGGG 383 Query: 533 GGGXXXVXXXXXPPPPPXXGGGG 601 GG P P GGG Sbjct: 384 GGAPQAAPAPQAAPAPAAPAGGG 406 Score = 44.4 bits (100), Expect = 0.004 Identities = 38/151 (25%), Positives = 38/151 (25%), Gaps = 3/151 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGG-PAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG--GGPGX 649 PP G AG G P G G A G PP G G G PG Sbjct: 141 PPGEAGTDGEPGQAGQDGQPGQAGQADSGSSGQACITCPAGPPGPPGPDGNAGPAGAPGV 200 Query: 648 XXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP 469 G G PP G G P P P P PP Sbjct: 201 PGPDGDAGSPPPPGPPGPPGPPGNDGQPGAPGQDGQPGAPGTNTVNSPGGPGPAGPPGPP 260 Query: 468 PPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PP P PP G GG Sbjct: 261 GPPGQDGSGGAAQPGPPGPPGPPGNDGQPGG 291 Score = 43.2 bits (97), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G GG A G G GGGG A P GGG GGG GG Sbjct: 364 GGGGGGGAAAGGGYNAGGGGGGAPQAAPAPQAAPAPAAPAGGGYNAGGGGGAGG 417 Score = 42.7 bits (96), Expect = 0.011 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 6/63 (9%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGX--GGGGGXAXXXGAXGXXXP----PXXGGXGGGGPGXXXG 640 GG G G GG A GG GGGGG A P P GG GG G G Sbjct: 358 GGYSGGGGGGGGGAAAGGGYNAGGGGGGAPQAAPAPQAAPAPAAPAGGGYNAGGGGGAGG 417 Query: 639 GGG 631 GGG Sbjct: 418 GGG 420 Score = 42.3 bits (95), Expect = 0.015 Identities = 31/76 (40%), Positives = 31/76 (40%), Gaps = 3/76 (3%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG-GGGXXXXX 610 G AG GP G G GG A G G PP G GG PG G G GG Sbjct: 252 GPAGPPGPPGPPGQDGSGG--AAQPGPPGPPGPPGNDGQPGG-PGQPGGPGQDGGPGTDA 308 Query: 609 XKXPPPPXX--GGGGG 568 P PP GGGGG Sbjct: 309 AYCPCPPRTPAGGGGG 324 Score = 40.3 bits (90), Expect = 0.061 Identities = 41/154 (26%), Positives = 41/154 (26%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 G PPPP P G G G G G G G G P G G Sbjct: 205 GDAGSPPPPGPPGPPGP-PGNDGQPGAPGQDGQPGAPGTNTVNSPGG-----PGPAGPPG 258 Query: 539 GXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXX 718 PP PP G G PP PP P P P G Sbjct: 259 ----------PPGPPGQDGSGGAAQPGPPGPPGPPGNDGQPGGPGQPGGPGQDGGPGTDA 308 Query: 719 XAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P G PA G GG Sbjct: 309 AYCPCPPRTPAGGGGGGDFPAGGGGGGYSTGGGG 342 Score = 39.9 bits (89), Expect = 0.081 Identities = 33/117 (28%), Positives = 34/117 (29%), Gaps = 1/117 (0%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PGPPG G G GG G G G Sbjct: 255 GPPGPPGPPGQDGS-GGAAQPGPPGPPGPPGNDGQPGGPGQPGGPGQDGGPGTDAAYCPC 313 Query: 374 PP-PPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 PP P F GGGGGG G GG G G + GGGGG Sbjct: 314 PPRTPAGGGGGGDFPAGGGGGG-YSTGGGGGRADSGGAAGGAGGAGGYSGGGGGGGG 369 Score = 38.3 bits (85), Expect = 0.25 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P G G G G G GG G A PP GGGG G Sbjct: 276 PPGPPGPPGNDGQPGGPGQPGGPGQDGGPGTDAAYCPC-----PPRTPAGGGGGGDFPAG 330 Query: 639 GGGGG 625 GGGGG Sbjct: 331 GGGGG 335 Score = 36.3 bits (80), Expect = 1.00 Identities = 35/123 (28%), Positives = 36/123 (29%), Gaps = 8/123 (6%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PGPPG G G G G G G + GG Sbjct: 217 GPPGPPGNDGQPGAPGQDGQPGAPGTNTVNSPGGPGPAGPPGPPGPPG---QDGSGGAAQ 273 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGG--------GXXXXXGXGXFXXFPXXXG 529 P PP P G GG G G G GG G G G FP G Sbjct: 274 PGPPGPPGPPGN-DGQPGGPGQPGGPGQDGGPGTDAAYCPCPPRTPAGGGGGGDFPAGGG 332 Query: 530 GGG 538 GGG Sbjct: 333 GGG 335 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGA 706 A P P AG G A G GG GGGGG A GA Sbjct: 389 AAPAPQAAPAPAAPAGGGYNAGGGGGAGGGGGYAGGAGA 427 Score = 34.3 bits (75), Expect = 4.0 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 1/68 (1%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPP-PXX 587 SGG GG GGGGG G+ GGGGG P P P Sbjct: 347 SGGAAGGAGGAGGYSGGGGGGGGGAAAGGGYNAG-----GGGGGAPQAAPAPQAAPAPAA 401 Query: 588 XGGGGXXA 611 GGG A Sbjct: 402 PAGGGYNA 409 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 537 GGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 GG P P PP G GG P PP PP P P G Sbjct: 249 GGPGPAGPPGPPGPPGQDGSGGAAQPGPPGPPGPPGNDGQPGGPGQPGGPG 299 Score = 33.9 bits (74), Expect = 5.3 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 2/86 (2%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXG--GPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXX 646 PP P GAA G GP G G GG G P P Sbjct: 259 PPGPPGQDGSGGAAQPGPPGPPGPPGNDGQPGGPGQPGGPGQDGGPGTDAAYCPCPPRTP 318 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGGG P GGGGG Sbjct: 319 AGGGGGGDF---------PAGGGGGG 335 Score = 33.5 bits (73), Expect = 7.0 Identities = 30/107 (28%), Positives = 30/107 (28%), Gaps = 5/107 (4%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGP--AXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG---GP 655 PP P GA G G A G GG G G PP G GG GP Sbjct: 218 PPGPPGNDGQPGAPGQDGQPGAPGTNTVNSPGGPGPA-GPPGPPGPPGQDGSGGAAQPGP 276 Query: 654 GXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXG 514 G G P P GG G P P G Sbjct: 277 PGPPGPPGNDGQPGGPGQPGGPGQDGGPGTDAAYCPCPPRTPAGGGG 323 Score = 33.1 bits (72), Expect = 9.3 Identities = 37/150 (24%), Positives = 37/150 (24%), Gaps = 1/150 (0%) Frame = +2 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 P PP P G G G G G G G G P G G Sbjct: 183 PGPPGPD-------GNAGPAGAPGVPGPDGDAGSPPPPGPPGP----PGPPGNDGQPGAP 231 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPP-PXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 P P PP PP P G P G P Sbjct: 232 GQDGQPGAPGTNTVNSPGGPGPAGPPGPPGPPGQDGSGGAAQPGPPGPPGPPGNDGQPGG 291 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P P GP AA PP GG Sbjct: 292 PGQPGGPGQDGGPGTDAAYCPCPPRTPAGG 321 Score = 33.1 bits (72), Expect = 9.3 Identities = 26/83 (31%), Positives = 26/83 (31%), Gaps = 5/83 (6%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG----- 637 GG AA P G GGGG G G G GG GG Sbjct: 302 GGPGTDAAYCPCPPRTPAGGGGGGDFPAGGGGGGYSTGGGGGRADSGGAAGGAGGAGGYS 361 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGGG GGGGG Sbjct: 362 GGGGGGGGGAAAGGGYNAGGGGG 384 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 60.1 bits (139), Expect = 7e-08 Identities = 29/64 (45%), Positives = 29/64 (45%), Gaps = 5/64 (7%) Frame = +2 Query: 626 PPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPX 790 PPPPPP PPPP P GG P P PPPPP PP P PP P P Sbjct: 255 PPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPP---PPPPPPPPPPKGVPPPPRGPP 311 Query: 791 XXPP 802 PP Sbjct: 312 PPPP 315 Score = 58.0 bits (134), Expect = 3e-07 Identities = 30/73 (41%), Positives = 31/73 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP GG PPPPPP P PPPP PP P PPPPP P Sbjct: 271 PPPPAPSAKGGA-------PPPPPPPPPPPPPPPPPPKG-------VPPPPRGPPPPPPP 316 Query: 749 PXPXAGPPXPAAP 787 P +G P P Sbjct: 317 KAPISGQPQVTQP 329 Score = 55.2 bits (127), Expect = 2e-06 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP---XPXXPXXPP 430 PPPP PPP P G P P PPPPPP P P PP Sbjct: 252 PPPPPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRGPP 311 Query: 429 PPPPP 415 PPPPP Sbjct: 312 PPPPP 316 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPPPP P PP P AP PPPP PP P PP P PP Sbjct: 252 PPPPP---PPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPR 308 Query: 809 G 811 G Sbjct: 309 G 309 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PP P G P P PPPPP PPP Sbjct: 253 PPPPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRGPPP 312 Query: 421 PPP 413 PPP Sbjct: 313 PPP 315 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP 451 PPPP GG PPPPP P P PPPPP P Sbjct: 271 PPPPAPSAKGGAPPPPPPPPPPPPPPPPPPKG-VPPPPRGPPPPPPPKAP 319 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 APPPPP + P P P PPPPPPP Sbjct: 251 APPPPPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPP 293 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP 656 P GG P PPPP P PPPPPP P Sbjct: 273 PPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPPKAP 319 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 10/71 (14%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX----------PGPPPPXPPXXGGXXXPXAPXX 718 PPP P GG PPPPPP P PPPP G P Sbjct: 272 PPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPPKAPISGQPQVTQPNT 331 Query: 719 XAXPPPPPXPP 751 P P Sbjct: 332 QQQQQAPKQQP 342 Score = 30.3 bits (65), Expect(2) = 0.11 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 294 PGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P G PPPP PP P P G P P Sbjct: 274 PAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPP 307 Score = 28.3 bits (60), Expect(2) = 0.11 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPPPP PPPP Sbjct: 249 PTAPPPPPPPPPSKQQQQQQVVPPPP 274 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 60.1 bits (139), Expect = 7e-08 Identities = 33/102 (32%), Positives = 33/102 (32%), Gaps = 7/102 (6%) Frame = +2 Query: 536 GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-------PPPXPPXXGGX 694 GG P P PPPPP P P PP PP G Sbjct: 513 GGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSP 572 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P AP PPPP PP P G P P PP GG Sbjct: 573 EPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGG 614 Score = 58.0 bits (134), Expect = 3e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 6/74 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP------XXXAXP 730 PPPPP G PP PP PPP PP G P P P Sbjct: 543 PPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 602 Query: 731 PPPPXPPXPXAGPP 772 PPPP PP P GPP Sbjct: 603 PPPPPPPPPPGGPP 616 Score = 48.0 bits (109), Expect = 3e-04 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP----XXP 433 PPPP G P PP P PPPPPP P P P Sbjct: 543 PPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVP 602 Query: 432 PPPPPP 415 PPPPPP Sbjct: 603 PPPPPP 608 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 4/67 (5%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT---- 434 PPPP G PP P G P P PPPPP T Sbjct: 542 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPV 601 Query: 433 PPPPPPP 413 PPPPPPP Sbjct: 602 PPPPPPP 608 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA 709 P PPP G PPPPP P PPPP PP P A Sbjct: 572 PEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPPDA 618 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P G+ P PPPPP PPPPPPP Sbjct: 574 PPPAPPLPGD------LPPPPPPPPPPPGTDGPVPPPPPPPPP 610 Score = 38.7 bits (86), Expect = 0.19 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP G G PPPPPP P PPP PP G PG Sbjct: 585 PPPPPPPPPPPGTDGPV------PPPPPP---PPPPPGGPPDALGRRDSELGPG 629 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXP--------XPPPPPXXLXXXXNPPPPPPP 414 APPPPP G P P P PPP PPPPPPP Sbjct: 541 APPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPP 591 Score = 37.5 bits (83), Expect = 0.43 Identities = 22/78 (28%), Positives = 22/78 (28%), Gaps = 4/78 (5%) Frame = -2 Query: 636 GGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP----P 469 GG P P PPP P P P P Sbjct: 513 GGDAPTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSP 572 Query: 468 PPPPXPXXPXXPPPPPPP 415 PPP P P PPPPPP Sbjct: 573 EPPPAPPLPGDLPPPPPP 590 Score = 35.1 bits (77), Expect = 2.3 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G G PPPPPP P PP P G P A P Sbjct: 589 PPPPPPPGTDGPV------PPPPPP--PPPPPGGPPDALGRRDSELGPGVKAKKP 635 Score = 34.3 bits (75), Expect = 4.0 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 6/67 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP------PPPPPXXXXXXXXGXGG 379 PPPPP G P PP PP P P PP PPP G G Sbjct: 542 PPPPPPLPGLPSPQEAPPSA--PPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDG 599 Query: 378 GGXXXPP 358 PP Sbjct: 600 PVPPPPP 606 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 59.7 bits (138), Expect = 9e-08 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 7/80 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-----P 733 PPPPP G PPPP P GPPPP PP P P P P Sbjct: 559 PPPPPMPG------IMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGP 612 Query: 734 PPPXPPXP--XAGPPXPAAP 787 PPP PP P GPP P P Sbjct: 613 PPPPPPIPGMMTGPPSPPPP 632 Score = 58.0 bits (134), Expect = 3e-07 Identities = 29/63 (46%), Positives = 31/63 (49%), Gaps = 9/63 (14%) Frame = +2 Query: 626 PPPPPPXXXPG-----PPPPXPPXXGG--XXXPXAPXXXAXPPPPPXPPXP--XAGPPXP 778 PPPPPP PG PPPP P G P P + PPPPP PP P +GPP P Sbjct: 556 PPPPPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPP 615 Query: 779 AAP 787 P Sbjct: 616 PPP 618 Score = 52.8 bits (121), Expect = 1e-05 Identities = 33/87 (37%), Positives = 33/87 (37%), Gaps = 9/87 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-------PPPPXPPXXGGXXXPXAPXXXA- 724 PPPPP PPPPPP PG PPPP P G P P A Sbjct: 585 PPPPPMP-------EMMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPPLVAT 637 Query: 725 -XPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PP A P P PP Sbjct: 638 VVGPPPPLPPGGPAALPLPPVGGWNPP 664 Score = 52.4 bits (120), Expect = 1e-05 Identities = 38/117 (32%), Positives = 38/117 (32%), Gaps = 4/117 (3%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX----PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 PPPPP G P P PPPPPP P PPPPPPP G G Sbjct: 558 PPPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMP-----GMMSGP 612 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 PP PG PPPP P P PGGP Sbjct: 613 PPPPPPI-------------------PGMMTGPPSPPPPPLVATVVGPPPPLPPGGP 650 Score = 48.4 bits (110), Expect = 2e-04 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 1/72 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP G PPPP P GPP PP PP P P P P Sbjct: 600 PPPPPMPG----MMSGPPPPPPPIPGMMTGPPSPPPPPLVATVVGPPPPLPPGGPAALPL 655 Query: 746 PPXPXAGPPXPA 781 PP PP A Sbjct: 656 PPVGGWNPPSRA 667 Score = 46.8 bits (106), Expect = 7e-04 Identities = 24/59 (40%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGG----XXXPXAPXXXAXPPPPPXP-PXPXAGPPXPAAP 787 PP P PPPP PP G P P + PPPPP P P +GPP P P Sbjct: 545 PPSRPEMLASLPPPPPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPP 603 Score = 45.2 bits (102), Expect = 0.002 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX---PPPPPPXPXXPXXPP 430 PPPP G G PP P G P P PPPPPP P PP Sbjct: 572 PPPPMPGMMSGPPPPP----PPMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPP 627 Query: 429 PPPPP 415 PPPP Sbjct: 628 SPPPP 632 Score = 41.5 bits (93), Expect = 0.026 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPPP GPPPP P G P P PP Sbjct: 612 PPPPPPPIPGMMTGPPSPPPPPLVATVVGPPPPLP-PGGPAALPLPPVGGWNPPSRAMIR 670 Query: 752 XPXAGPPXPAAP 787 P P P P Sbjct: 671 KPPVNPETPMKP 682 Score = 40.7 bits (91), Expect = 0.046 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 5/71 (7%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXX---GEXXKXPXXPXXXXXPPPPPXXXXXX 440 A PPPP G PPPPP G P P PPPPP Sbjct: 553 ASLPPPPPPPPMPGIMQ-----PPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPPPMPG 607 Query: 439 XT--PPPPPPP 413 PPPPPPP Sbjct: 608 MMSGPPPPPPP 618 Score = 40.7 bits (91), Expect = 0.046 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXX-PXXXXXPPPPPXXXXXXXTPPP 425 PPPP G G PP P G P P PPPPP T PP Sbjct: 571 PPPPPMPG---MMSGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPP 627 Query: 424 PPPP 413 PPP Sbjct: 628 SPPP 631 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP G P PPPP P PPP PP G PP P Sbjct: 586 PPPPMPEMMSGP----PPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPP 633 Score = 36.7 bits (81), Expect = 0.75 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 3/72 (4%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXX-GEXXKXPXXPXXXXXP--PPPPXXX 449 G + PPPP G PPP P G P P P PPPP Sbjct: 578 GMMSGPPPPPPPMPE--MMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPPLV 635 Query: 448 XXXXTPPPPPPP 413 PPPP PP Sbjct: 636 ATVVGPPPPLPP 647 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP G P PPPPP P PPPPP Sbjct: 599 PPPPPPMPGMMS-------GPPPPPPPIPGMMTGPPSPPPPP 633 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAP---XXXAXPPPPPXPPXPXAGPPXPAAP 787 P P PP P P P PPPPP P +GPP P P Sbjct: 537 PASLSPPSPPSRPEMLASLPPPPPPPPMPGIMQPPPPPPMPGMMSGPPPPPPP 589 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP G P PPPP + PPPP PP Sbjct: 613 PPPPPPIPGMMT-------GPPSPPPPPLVATVVGPPPPLPP 647 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP-PPPPE 410 PPPPP P P PPPPP PPP PP PE Sbjct: 556 PPPPPP--------PPMPGIMQPPPPPPMPGMMSGPPPPPPPMPE 592 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP G P PP P P PPP PP G PP P Sbjct: 565 PGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPP--PPPMPGMMSGPPPPPPP 618 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PP P G P P PPPP P P P Sbjct: 597 PPPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPPLVATVVGPPPPLPPGGPAALPLP 656 Query: 420 P 418 P Sbjct: 657 P 657 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 576 PPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PP A P PPPPP PPP PP G PP P Sbjct: 542 PPSPPSRPEMLASLPPPPPPPPMPGIMQPPP--PPPMPGMMSGPPPPPPP 589 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G P PPPP P PP PP PP P Sbjct: 597 PPPPPPPPMPGMMSG-----PPPPPPPIPGMMTGPPSPPPPPLVATVVGPPPPLPP 647 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 59.7 bits (138), Expect = 9e-08 Identities = 29/68 (42%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +2 Query: 569 PPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G PPPPPP GPPPP PP P PPPPP Sbjct: 270 PPPPPLPSGPAYASALPPPPGPPPPPPLPSAGPPPPPPP-----PPPLPNQVPPPPPPPP 324 Query: 743 XPPXPXAG 766 PP P +G Sbjct: 325 APPLPASG 332 Score = 55.2 bits (127), Expect = 2e-06 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP P PP G P P PPPPP PP P PP P P P Sbjct: 270 PPPPPLPSGPAYASALPPPPGPPPPPPLPSAGPPPPPPPPPPLPNQVPPPPPPPPAPP 327 Score = 54.4 bits (125), Expect = 4e-06 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P P PPPPPP P PPPPP Sbjct: 271 PPPPLPSGPAYASALPPPPGPPPPP---------PLPSAGPPPPPPPPPPLPNQVPPPPP 321 Query: 420 PP 415 PP Sbjct: 322 PP 323 Score = 50.4 bits (115), Expect = 6e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP G P PPPPP P PPPPPPP Sbjct: 270 PPPPPLPSGPAYASALPPPPGPPPPPPLPSAGPPPPPPPPPP 311 Score = 46.4 bits (105), Expect = 0.001 Identities = 26/73 (35%), Positives = 26/73 (35%) Frame = -1 Query: 631 GGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXX 452 G G A PPPP G PPPPP P PPPPP Sbjct: 261 GHVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPP---------PLPSAGPPPPPPPPPP 311 Query: 451 XXXXXTPPPPPPP 413 PPPPPPP Sbjct: 312 LPNQVPPPPPPPP 324 Score = 46.0 bits (104), Expect = 0.001 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP PP G A P PPP PP P AGPP P P P Sbjct: 267 PAPPPP-PPLPSG--PAYASALPPPPGPPPPPPLPSAGPPPPPPPPPPLP 313 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXX 707 G P PPPP G A P PPPPP P PPP PP Sbjct: 261 GHVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSAGPPPPPPPPPPLPNQVPPPP 320 Query: 708 XPPGXP 725 PP P Sbjct: 321 PPPPAP 326 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP G P PP P P PPP PP Sbjct: 287 PPPGPPPPPPLPSAGPPPPPPPPPPLPNQVPPPPPPPPAPP 327 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = -2 Query: 474 PPPPPPXPXXP----XXPPPPPPP 415 PPPPPP P P PPPP PP Sbjct: 269 PPPPPPLPSGPAYASALPPPPGPP 292 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 59.7 bits (138), Expect = 9e-08 Identities = 24/53 (45%), Positives = 24/53 (45%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPP P PPPP PP P P PPPP PP P PP P Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTP 142 Score = 51.2 bits (117), Expect = 3e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P PPP PPP Sbjct: 90 PPPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 131 Score = 50.4 bits (115), Expect = 6e-05 Identities = 25/57 (43%), Positives = 25/57 (43%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PPPP PP P P PPPP PP P PP P P PP Sbjct: 90 PPPP-----PPPPPPP----PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 Score = 46.8 bits (106), Expect = 7e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P P PP PPPP Sbjct: 93 PPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPP--PPSPPPP 132 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P PPPP P P P P PPPP Sbjct: 92 PPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 132 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P PPP P Sbjct: 95 PPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTP 136 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 K P P PPPPPP P PP PPPP Sbjct: 88 KVPPPPPPPPPPPPPPPPPPSPPPPSPPPP 117 Score = 41.9 bits (94), Expect = 0.020 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPPPP P P PPP PPP Sbjct: 86 PNKVPPPPPPPPPPPPPPPPPPSPPP 111 Score = 40.7 bits (91), Expect = 0.046 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPPP P P P PPPP P P PP Sbjct: 100 PPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P P PP PP Sbjct: 98 PPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPP--PPTTTPP 137 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P PPPP P P P P PP Sbjct: 97 PPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + P PPPP P PPP PP Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPP 131 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPP PP P PP PP Sbjct: 97 PPPPPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPP 137 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPP P PP P Sbjct: 101 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTP 142 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P P P Sbjct: 103 PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPTTTPPTTTTPTP 144 Score = 33.9 bits (74), Expect = 5.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPP 680 P PPPPP P PPP PP Sbjct: 86 PNKVPPPPPPPPPPPPPPPPP 106 >UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thaliana|Rep: F14J22.4 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 494 Score = 59.7 bits (138), Expect = 9e-08 Identities = 31/76 (40%), Positives = 31/76 (40%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPX 754 PPP PPPPPP P PPPP PP P P PPPP PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPP---PCPPPPSPPPC-----PPPPSPPPSPPPPQLPPP 97 Query: 755 PXAGPPXPAAPXXXPP 802 P PP P P PP Sbjct: 98 PQLPPPAPPKPQPSPP 113 Score = 58.0 bits (134), Expect = 3e-07 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-PPPXPPXPXAGPPXPAAP 787 PPPPPP P PPP PP P P P PPP PP P PP P P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 51.6 bits (118), Expect = 2e-05 Identities = 27/71 (38%), Positives = 27/71 (38%) Frame = +2 Query: 590 GGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP 769 GGG P P P PPPP PP P P P PPP PP P P Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPC--PPPPSPPPCPPPPSPPPSPPPPQL-P 95 Query: 770 PXPAAPXXXPP 802 P P P PP Sbjct: 96 PPPQLPPPAPP 106 Score = 46.0 bits (104), Expect = 0.001 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 576 GGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 GGG P P P P PP PPP P P PP PPPP Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP--PPP 415 PPPPP P P PP PPP P P PPPP PPP Sbjct: 62 PPPPPPPP--CPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 44.4 bits (100), Expect = 0.004 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP C PPP PPP P PPPP P P P P PP Sbjct: 62 PPPPPPP-----PCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQ---PSPP 113 Query: 743 XPPXPXA 763 P P A Sbjct: 114 TPDLPFA 120 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP--XPXXPXXPPPPPP 418 PPPPP P P PP PPP P P PPP PP Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = -2 Query: 579 GGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP--PXPXXPXXPPPP--PPP 415 GGG P P P P P P PPP P P P PPPP PPP Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = +3 Query: 537 GGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 GG P P P P P PPPP P PPP PP PP Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Query: 717 GXP 725 P Sbjct: 99 QLP 101 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P P PPP L PPP PP Sbjct: 65 PPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = -2 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 GGG P P PP PP P P PPPP Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Query: 462 PPXPXXPXXPPPPPP 418 P P P P PP Sbjct: 99 QLPPPAPPKPQPSPP 113 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPP--PPXPXXPXXPPPPPPP 415 PPP P P P PPPP PP P P PP P P Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPP PP PPP PP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = -1 Query: 574 GGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 GG P P P P P PP PP PP PPPP+ Sbjct: 39 GGGNDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQ 93 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PP PPP P PP PP Sbjct: 67 PPPCPPPPSPP----PCPPPPSPPPSPPPPQLPPPPQLPPP 103 >UniRef50_Q0J6R0 Cluster: Os08g0280200 protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Os08g0280200 protein - Oryza sativa subsp. japonica (Rice) Length = 658 Score = 59.7 bits (138), Expect = 9e-08 Identities = 33/81 (40%), Positives = 34/81 (41%), Gaps = 8/81 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXX----PPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXA 724 PPPPP C PPPP P P GPPPP PP P A Sbjct: 31 PPPPPLQSPSTPRCSPVRTLASPPPPPAPTSSPVRMSGPPPPPPPPAPNS----CPSRPA 86 Query: 725 XPPPPPXPPXPXAGPPXPAAP 787 PPPPP P + PP PAAP Sbjct: 87 PPPPPPPPLASTSSPPRPAAP 107 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/63 (38%), Positives = 27/63 (42%), Gaps = 5/63 (7%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPX-----APXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPPPP P P P P +P + PPPPP PP P + P PA P Sbjct: 31 PPPPPLQSPSTPRCSPVRTLASPPPPPAPTSSPVRMSGPPPPPPPPAPNSCPSRPAPPPP 90 Query: 794 XPP 802 PP Sbjct: 91 PPP 93 Score = 48.8 bits (111), Expect = 2e-04 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXX-TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP T PPPPP + P PP P P P PPPP Sbjct: 32 PPPPLQSPSTPRCSPVRTLASPPPPPAPTSSPVRMSGPPPPPPPPAPNSCPSRPAPPPPP 91 Query: 423 PPP 415 PPP Sbjct: 92 PPP 94 Score = 44.4 bits (100), Expect = 0.004 Identities = 27/87 (31%), Positives = 29/87 (33%), Gaps = 9/87 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP PP P + A P PPP P Sbjct: 69 PPPPPPPPAPNSCPSRPAPPPPPPPPLASTSSPPRPAAPSPCQLHTSTSSPARPVPPPPP 128 Query: 749 ---------PXPXAGPPXPAAPXXXPP 802 P P P +AP PP Sbjct: 129 TLSTIRSSAPTPPLLPGATSAPSPPPP 155 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXL---XXXXNPPPPPPP 414 R APPPPP + PPPPP PPPPPPP Sbjct: 27 RPPAPPPPPLQSPSTPRCSPVRTLASPPPPPAPTSSPVRMSGPPPPPPP 75 Score = 36.7 bits (81), Expect = 0.75 Identities = 29/104 (27%), Positives = 31/104 (29%), Gaps = 26/104 (25%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP---------------------PXPPXX 685 PPPPP PPPPPP PP P PP Sbjct: 70 PPPPPPPAPNSCPSRPAPPPPPPPPLASTSSPPRPAAPSPCQLHTSTSSPARPVPPPPPT 129 Query: 686 GGXXXPXAPXXXAXP-----PPPPXPPXPXAGPPXPAAPXXXPP 802 AP P P PP PP P + +AP PP Sbjct: 130 LSTIRSSAPTPPLLPGATSAPSPPPPPPPCSSSNQLSAPPPPPP 173 Score = 36.7 bits (81), Expect = 0.75 Identities = 25/84 (29%), Positives = 26/84 (30%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P P P PPPP PP P PPPP Sbjct: 124 PPPPPTLST--IRSSAPTPPLLPGATSAPSPPPPPPPCSSSNQLSAPP-----PPPPSFS 176 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGG 820 + P PA P G G Sbjct: 177 KNNGSIAPPPAPPGGNAKLPGMRG 200 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 541 PPPPPXXXGEXXKX-PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP + P PPP P + PPPPPP Sbjct: 31 PPPPPLQSPSTPRCSPVRTLASPPPPPAPTSSPVRMSGPPPPPP 74 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPX--------PPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP + PPPPPP Sbjct: 124 PPPPPTLSTIRSSAPTPPLLPGATSAPSPPPPPPPCSSSNQLSAPPPPPP 173 Score = 33.9 bits (74), Expect = 5.3 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P P PPPPP Sbjct: 51 ASPPPPPAPTSSPVRMSGPP---PPPPPPAPNSCPSRPAPPP----PPPPPLASTSSPPR 103 Query: 430 PPPPPP 413 P P P Sbjct: 104 PAAPSP 109 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 R PPPPP P P PPPP L +PP P P Sbjct: 65 RMSGPPPPPPPPAPNSCPSRPAPPPPPPPP---LASTSSPPRPAAP 107 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P PPPPPP P PP P Sbjct: 69 PPPPPPPPAPNSCPSRP----APPPPPPPPLASTSSPPRP 104 Score = 33.5 bits (73), Expect = 7.0 Identities = 26/80 (32%), Positives = 27/80 (33%), Gaps = 8/80 (10%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGP---PPPXPPXXGGXXXPXAPXXXAXPPPPP 742 P PP G PPPPPP PPP PP AP PP PP Sbjct: 138 PTPPLLPGA---TSAPSPPPPPPPCSSSNQLSAPPPPPPSFSKNNGSIAP-----PPAPP 189 Query: 743 -----XPPXPXAGPPXPAAP 787 P GP P+ P Sbjct: 190 GGNAKLPGMRGRGPAPPSGP 209 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP + P PPPPP PPP P G G G P Sbjct: 152 PPPPPPPCSSSNQLSAP-----PPPPPSFSKNNGSIAPPPAPPGGNAKLPGMRGRGPAPP 206 >UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreococcus|Rep: Homology to unknown gene - Ostreococcus tauri Length = 1931 Score = 59.7 bits (138), Expect = 9e-08 Identities = 26/65 (40%), Positives = 27/65 (41%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PP PPP P PPP PP P P P PPP PP P P +P PP Sbjct: 1810 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPP 1869 Query: 806 XGXGG 820 GG Sbjct: 1870 SLNGG 1874 Score = 58.0 bits (134), Expect = 3e-07 Identities = 25/58 (43%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P PPP PP P P P PPP PP P PP P+ P PP Sbjct: 1808 PPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPPSPPP 1865 Score = 51.6 bits (118), Expect = 2e-05 Identities = 23/64 (35%), Positives = 24/64 (37%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 K PPPP + PPP P P PPP PP P P PPP Sbjct: 1806 KIPPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPPSPPP 1865 Query: 426 PPPP 415 PPP Sbjct: 1866 SPPP 1869 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PPP P P P PP PPP P P PPP PPP GG Sbjct: 1821 PPPSPPPSPPPSPPPSPPPPSPPPSPPPSPP-PSPPPPSPPPSPPPSPPPSLNGG 1874 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP-PPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PP PPPP P PPP PP PP P Sbjct: 1811 PSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPPSPPPSP 1867 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPP + P PP PPP P PPP PP PP Sbjct: 1808 PPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPP 1855 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP + P PP PPP P PPP PP PP P Sbjct: 1808 PPPPSPP-----PSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSP 1854 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPP-PPPPXXXPXPPPXXPPXXGG 692 PPP + P PP PPPP P PPP PP G Sbjct: 1833 PPPSPPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSLNG 1873 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P P PPP P PPP P Sbjct: 1808 PPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSP 1850 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP P PPP P +PPP PPP Sbjct: 1810 PPSPPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPP 1852 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP P PPPP +PPP PPP Sbjct: 1814 PPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPP 1856 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P PPP P PPP PPP Sbjct: 1819 PSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSPPP 1861 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPPP PPP PP Sbjct: 1813 PPPSPPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPP 1855 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P P PPP PPPP P Sbjct: 1817 PPPSPPPSPPPSPPPSPPPSPPPPSPPPSPPPSPPPSPPPPSP 1859 >UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG05727; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG05727 - Caenorhabditis briggsae Length = 288 Score = 59.7 bits (138), Expect = 9e-08 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP G PPP PP A PPPPP P Sbjct: 130 PPPPPSDEPQEVVAGGASRRPPPPPPRGTGTPPP-PPTGVPEELNEANHASRRPPPPPPP 188 Query: 749 PXPXAGPPXPAAPXXXPP 802 P GPP P P P Sbjct: 189 PKGTGGPPPPPPPPSDEP 206 Score = 50.4 bits (115), Expect = 6e-05 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 10/71 (14%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX----------PPPPPPXPXXPXXPPPPPPPXXXXXXXX 391 PPPPP G P P PPPPPP P PPPPPPP Sbjct: 82 PPPPPPPRGTGTPSPPPSEEPRDLVEGNASRRPPPPPPPPKATGSPPPPPPPPSDEPQEV 141 Query: 390 GXGGGGXXXPP 358 GG PP Sbjct: 142 VAGGASRRPPP 152 Score = 50.0 bits (114), Expect = 8e-05 Identities = 25/66 (37%), Positives = 26/66 (39%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP G P P PP PPPPP P + PP P P P Sbjct: 82 PPPPPPPRGTGTPSP-PPSEEPRDLVEGNASRRPPPPPPPPKATGSPPPPPPPPSDEPQE 140 Query: 806 XGXGGA 823 GGA Sbjct: 141 VVAGGA 146 Score = 48.8 bits (111), Expect = 2e-04 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 14/79 (17%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-----XPPXPXAGPPXP---- 778 PPPPPP PPPP PP A PPPPP PP P G P Sbjct: 116 PPPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPPPPPRGTGTPPPPPTGVPEELNEA 175 Query: 779 -----AAPXXXPPXXGXGG 820 P PP G GG Sbjct: 176 NHASRRPPPPPPPPKGTGG 194 Score = 48.4 bits (110), Expect = 2e-04 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 PPPPPP G PPP PP + PPPP P PP P Sbjct: 115 PPPPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPPPPPRGTGTPPPPP 165 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/70 (34%), Positives = 26/70 (37%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G + PPPP G G PPPPP E PPPPP Sbjct: 144 GGASRRPPPPPPRGTG---------TPPPPPTGVPEELNEANHASRRPPPPPPPPKGTGG 194 Query: 439 XTPPPPPPPE 410 PPPPPP + Sbjct: 195 PPPPPPPPSD 204 Score = 42.7 bits (96), Expect = 0.011 Identities = 25/77 (32%), Positives = 25/77 (32%), Gaps = 8/77 (10%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXP--------XXPXXXXXPPP 464 G PPPP G PPPPP G P PPP Sbjct: 125 GSPPPPPPPPSDEPQEVVAGGASRRPPPPPPRGTGTPPPPPTGVPEELNEANHASRRPPP 184 Query: 463 PPXXXXXXXTPPPPPPP 413 PP PPPPPPP Sbjct: 185 PPPPPKGTGGPPPPPPP 201 Score = 41.1 bits (92), Expect = 0.035 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 PPPPPP P PPPPPPP Sbjct: 31 PPPPPPPPKGTGSPPPPPPP 50 Score = 40.3 bits (90), Expect = 0.061 Identities = 34/112 (30%), Positives = 34/112 (30%), Gaps = 34/112 (30%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP-------------------------GPPPPX 673 PPPPP G G PPPPPP P PPPP Sbjct: 33 PPPPPPKGTGSPP------PPPPPPSDEPQEVKLTFRYVRTTYVSQIVAGISSRRPPPPP 86 Query: 674 PPXXGGXXXPXAP---------XXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP G P PPPPP PP PP P P P Sbjct: 87 PPRGTGTPSPPPSEEPRDLVEGNASRRPPPPPPPPKATGSPPPPPPPPSDEP 138 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPPPP PPPPPPP Sbjct: 26 PVSKRPPPPPPPPKGTGSPPPPPPPP 51 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 9/58 (15%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXP---------XXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPPP G P PPPPP +PPPPPPP Sbjct: 76 GISSRRPPPPPPPRGTGTPSPPPSEEPRDLVEGNASRRPPPPPPPPKATGSPPPPPPP 133 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP E + PPPPP TPPPP Sbjct: 116 PPPPPPKATGSP--------PPPPPPPSDEPQEVVAGGASRRPPPPPP---RGTGTPPPP 164 Query: 421 P 419 P Sbjct: 165 P 165 Score = 36.7 bits (81), Expect = 0.75 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 23/85 (27%) Frame = -2 Query: 600 PPPPXXGGGGG--------------XXXXXTXXXPPPPPXXXGXXXKXP---------XP 490 PPPP G + PPPPP G P Sbjct: 117 PPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPPPPPRGTGTPPPPPTGVPEELNEAN 176 Query: 489 XXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPPP P PPPPPPP Sbjct: 177 HASRRPPPPPPPPKGTGGPPPPPPP 201 Score = 36.3 bits (80), Expect = 1.00 Identities = 23/78 (29%), Positives = 23/78 (29%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G P PPP PP P P PPPP Sbjct: 83 PPPPPPRGTGTPSPPPSEEPRDLVEGNASRRPPPPPPPPKATGSPPPP-----PPPPSDE 137 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP Sbjct: 138 PQEVVAGGASRRPPPPPP 155 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 490 PXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPPPP PPPPPPP Sbjct: 26 PVSKRPPPPPPPPKGTGSPPPPPPPP 51 Score = 35.1 bits (77), Expect = 2.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPP 679 PPPPPP G PPP PP Sbjct: 32 PPPPPPPKGTGSPPPPPP 49 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP G PPPPP P P P PPPP Sbjct: 94 PSPPPSEEPRDLVEGNASRRPPPPPPPPKATGSPPPPPPPPSDEPQEVVAGGASRRPPPP 153 Query: 421 PP 416 PP Sbjct: 154 PP 155 Score = 34.7 bits (76), Expect = 3.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 597 GGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 GG + P PPPPP PPP PP Sbjct: 24 GGPVSKRPPPPPPPPKGTGSPPPPPPPP 51 Score = 34.3 bits (75), Expect = 4.0 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX----PX 439 + PPPP G G PPPPP PPPPPP P Sbjct: 149 RPPPPPPRGTG----------TPPPPPTGVPEELNEANHASRRPPPPPPPPKGTGGPPPP 198 Query: 438 XPPPPPPP 415 PPP P Sbjct: 199 PPPPSDEP 206 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP PP PP P P P Sbjct: 31 PPPPPPPPKGTGSPPPPPPPPSDEP 55 >UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|Rep: Formin 1,2/cappuccino - Aedes aegypti (Yellowfever mosquito) Length = 891 Score = 59.7 bits (138), Expect = 9e-08 Identities = 28/78 (35%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP P PP PPP P PPPP PP P P PPPPP P Sbjct: 281 PPQAPPLVSSAVEAETPPPPPLPPPLPPPHPPPP-PPMFKTAVAPPGPPPLPPPPPPPPP 339 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P + P + PP Sbjct: 340 PPPISSVSIPPSTSGGPP 357 Score = 58.0 bits (134), Expect = 3e-07 Identities = 31/80 (38%), Positives = 32/80 (40%), Gaps = 7/80 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA----PXXXAXPPP 736 P PPP PP PPP P PPPP PP P + P PPP Sbjct: 305 PLPPPHPPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPPISSVSIPPSTSGGPPAPPLPPP 364 Query: 737 PPXPPXPXA---GPPXPAAP 787 PP P P A GPP P P Sbjct: 365 PPPPTAPLAVGSGPPAPPPP 384 Score = 50.4 bits (115), Expect = 6e-05 Identities = 26/64 (40%), Positives = 26/64 (40%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPPPP P PPP PP P A P PPP PP P PP P P Sbjct: 297 PPPPPLPPPLPPPHPPPPP-----PMFKTAVAPPGPPPLPPPPPPPPPPPPISSVSIPPS 351 Query: 809 GXGG 820 GG Sbjct: 352 TSGG 355 Score = 48.0 bits (109), Expect = 3e-04 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 T PP PP P P PP P P P PPPPPPP GG Sbjct: 296 TPPPPPLPPPLPPPHPPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPPISSVSIPPSTSGG 355 Query: 372 XXXPP 358 PP Sbjct: 356 PPAPP 360 Score = 41.1 bits (92), Expect = 0.035 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 16/58 (27%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX----------------PXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 311 PPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPPISSVSIPPSTSGGPPAPPLPPPPPPP 368 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 5/61 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP-----XXPPXXGGXXXXXXPPGX 722 P PPPP P PPPPPP P PPP P GG PP Sbjct: 308 PPHPPPPPPMFKTAVAPPGPPPLPPPPPP--PPPPPPISSVSIPPSTSGGPPAPPLPPPP 365 Query: 723 P 725 P Sbjct: 366 P 366 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP P PP P PPPP Sbjct: 312 PPPPPMFKTAVAPPGPPPLPPPPPPPPPPPPISSVSIPPSTSGGPPAP------PLPPPP 365 Query: 421 PPP 413 PPP Sbjct: 366 PPP 368 Score = 37.1 bits (82), Expect = 0.57 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PP P PPPP P AP PP P P Sbjct: 337 PPPPPPISSVSIPPSTSGGPPAPP---LPPPPPP----------PTAPLAVGSGPPAPPP 383 Query: 749 PXPXAGPPXPAAPXXXP 799 P P A P Sbjct: 384 PMMAMVAPVTTAATLGP 400 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = -3 Query: 539 PPPPPXXX-----GXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPP L PP PPPP Sbjct: 338 PPPPPISSVSIPPSTSGGPPAPPLPPPPPPPTAPLAVGSGPPAPPPP 384 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP PP PP P PPP P G PP Sbjct: 333 PPPPPPPPPPISSVSIPPSTSGG-PPAPPLPPPPPPPTAPLAVGSGPPAPPPP 384 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 59.7 bits (138), Expect = 9e-08 Identities = 33/81 (40%), Positives = 33/81 (40%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G C P P P P PPPP P P AP PPPPP P Sbjct: 369 PPPPPCPGP--YECLSPYPVPYPYPSPVPYPPPPAPYPPPSAPYP-APYTPPSPPPPPCP 425 Query: 749 ---PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 426 VPCPPPPPPPPPPPCPVPCPP 446 Score = 58.4 bits (135), Expect = 2e-07 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 1/71 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP-PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPP P P PPPPP P PPPP PP P P PP PP Sbjct: 398 PPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPP 457 Query: 746 PPXPXAGPPXP 778 PP P P P Sbjct: 458 PPPPPCPIPCP 468 Score = 57.2 bits (132), Expect = 5e-07 Identities = 28/77 (36%), Positives = 28/77 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPP P P PPPP PP P P PPPPP P Sbjct: 402 PYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPP 461 Query: 749 PXPXAGPPXPAAPXXXP 799 P P P P P Sbjct: 462 PCPIPCPEPYPVPVPIP 478 Score = 54.8 bits (126), Expect = 3e-06 Identities = 31/77 (40%), Positives = 32/77 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP C PPPPPP P PPPP PP P +P PPPPP Sbjct: 419 PPPPPCP----VPCPPPPPPPPPPPCPVPCPPPPPPP-------PPSPP----PPPPPPC 463 Query: 749 PXPXAGPPXPAAPXXXP 799 P P P P P Sbjct: 464 PIPCPEPYPVPVPIPEP 480 Score = 52.4 bits (120), Expect = 1e-05 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXPPP 427 PP P T PPPPP P P P P PPP P P PPP Sbjct: 399 PPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPP 458 Query: 426 PPPP 415 PPPP Sbjct: 459 PPPP 462 Score = 50.0 bits (114), Expect = 8e-05 Identities = 25/60 (41%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP-PXPXAGPPXPAAPXXXPP 802 PPP P P PP PP P P PPPPP P P P PP P +P PP Sbjct: 404 PPPSAPYPAPYTPPSPPPPPCPVPCPPPP---PPPPPPPCPVPCPPPPPPPPPSPPPPPP 460 Score = 46.8 bits (106), Expect = 7e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPP P PPPPPPP Sbjct: 397 PPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPP 438 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P P PPPP P PPPPPPP Sbjct: 395 PYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPP 436 Score = 42.7 bits (96), Expect = 0.011 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P P P P Sbjct: 433 PPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVP 474 Score = 42.3 bits (95), Expect = 0.015 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P P P P Sbjct: 435 PPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVPVP 476 Score = 41.5 bits (93), Expect = 0.026 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP--PPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PP PPPP P PPP PP PP P Sbjct: 393 PVPYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPP 450 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP P PPPPPP P PPP P Sbjct: 425 PVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCP 464 Score = 41.5 bits (93), Expect = 0.026 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 1/78 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP C PPPPPP P PPP PP P P P P P P Sbjct: 431 PPPPPPPPPCPVPC-----PPPPPP--PPPSPPPPPP-------PPCPIPCPEPYPVPVP 476 Query: 749 -PXPXAGPPXPAAPXXXP 799 P P P P P Sbjct: 477 IPEPYYVPSPEPYPVPVP 494 Score = 40.7 bits (91), Expect = 0.046 Identities = 26/72 (36%), Positives = 26/72 (36%), Gaps = 3/72 (4%) Frame = +2 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXP-PPPPXP-PXPXAG 766 G C P P P P PPP P P P P PPPP P P P A Sbjct: 350 GCCKCVMIPYPVPSPAPGYPPPPPCPGPYECLSPYPVPYPYPSPVPYPPPPAPYPPPSAP 409 Query: 767 PPXPAAPXXXPP 802 P P P PP Sbjct: 410 YPAPYTPPSPPP 421 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P PPPPP PPPPPPP Sbjct: 397 PPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPP 438 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP P P P P P Sbjct: 431 PPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYP 472 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 534 PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP G P P PPP PP P PPP PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIP--PPPAPP 215 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP PP PPP PP G P AP PPPP P Sbjct: 179 PPPAPPGVLA--PPPAPP--GVLPPPPAPPGALIPPPPAPP 215 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP P P P P Sbjct: 434 PPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVPVP 476 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPP-PXPXXPXXPPPPPPP 415 PPPPP P P P P P P P P PP P P Sbjct: 369 PPPPPCPGPYECLSPYPVPYPYPSPVPYPPPPAPYPPPSAPYP 411 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP P P P P Sbjct: 432 PPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVP 474 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPP P P P P P P Sbjct: 437 PPPCPVPCPPPPPPPPPSPPPPPPPPCPIPCPEPYPVPVPIP 478 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G P P P P P PP P P P P P Sbjct: 370 PPPPCPGPYECLSPYPVPYPYPSPVPYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCP 429 Query: 420 PP 415 PP Sbjct: 430 PP 431 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXX-PXXPPPPP---PXXXPXPPPXXPPXXGGXXXXXXPP 716 P PP P A P PPPPP P P PPP PP PP Sbjct: 395 PYPPPPAPYPPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPP 451 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 APPP P P P PP PP L PPPP PP Sbjct: 178 APPPAPPGV-LAPPPAPPGVLPPPPAPPGALI----PPPPAPP 215 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 59.7 bits (138), Expect = 9e-08 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 1/74 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP-PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP P PPP P PPPP PP P P PPPPP Sbjct: 196 PPPPPISHSAAASLPRRTLPSRLPPPSHTPSPPPPPPP--SHTPAPPPPSHTPAPPPPPP 253 Query: 746 PPXPXAGPPXPAAP 787 PP PP P P Sbjct: 254 PPSSSLPPPPPPPP 267 Score = 58.4 bits (135), Expect = 2e-07 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP P P PPPPP PP PP P A PP Sbjct: 228 PPPPPPSHTPAPPPPSHTP-APPPPPPPPSSSLPPPPPPPPPSSTRPPPPPPAQTTPPP 285 Score = 52.4 bits (120), Expect = 1e-05 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPPP P PPPPPPP Sbjct: 227 PPPPPPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPP 267 Score = 50.0 bits (114), Expect = 8e-05 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP + PPPP P P PPPPPP P PPPPPP Sbjct: 219 PPPSHTPSPPPPPPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPPPPP 278 Score = 44.8 bits (101), Expect = 0.003 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP- 424 PPPP T PPP P P PPPP P P PPPP Sbjct: 197 PPPPISHSAAASLPRRTLPSRLPPPSHTPSPPPPPPPSHTPAPPPPSHTPAPPPPPPPPS 256 Query: 423 ---PPP 415 PPP Sbjct: 257 SSLPPP 262 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P P PPPPP PPPPPPP Sbjct: 225 PSPPPPPPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPP 267 Score = 42.3 bits (95), Expect = 0.015 Identities = 25/76 (32%), Positives = 27/76 (35%), Gaps = 14/76 (18%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXG---------XXXKXPXPXXXXXPPPPPPXPX 448 PPPP + PPPPP + P P PPPPPP Sbjct: 176 PPPPPPSHTPKPPPSHSPKPPPPPPISHSAAASLPRRTLPSRLPPPSHTPSPPPPPPPSH 235 Query: 447 XPXXPPP-----PPPP 415 P PPP PPPP Sbjct: 236 TPAPPPPSHTPAPPPP 251 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 P PPP P P PPPPP PPPPPP + Sbjct: 237 PAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPPPPPAQ 280 Score = 39.9 bits (89), Expect = 0.081 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXP-------XAPXXXAX 727 PPPPP P PPP PPPP P P Sbjct: 176 PPPPPPS----------HTPKPPPSHSPKPPPPPPISHSAAASLPRRTLPSRLPPPSHTP 225 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PP PP P+ PP Sbjct: 226 SPPPPPPPSHTPAPPPPSHTPAPPP 250 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPP P PPP Sbjct: 230 PPPPSHTPAPPPPSHTPAPPPPPPPPSSSLPPPPPPPPPSSTRPPPPP----PAQTTPPP 285 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPP 680 P PPPPPP P PPP P Sbjct: 173 PTQPPPPPPSHTPKPPPSHSP 193 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P PPPP + P PPPPP P PPP Sbjct: 246 PAPPPPPPPPSS-----SLPPPPPPPPPSSTRPPPPP 277 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 59.7 bits (138), Expect = 9e-08 Identities = 29/68 (42%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +2 Query: 569 PPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G PPPPPP GPPPP PP P PPPPP Sbjct: 546 PPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPP-----PPPLPNQAPPPPPPPP 600 Query: 743 XPPXPXAG 766 PP P +G Sbjct: 601 APPLPASG 608 Score = 56.4 bits (130), Expect = 9e-07 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP P PP G P P PPPPP PP P PP P P P Sbjct: 546 PPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPP 603 Score = 54.4 bits (125), Expect = 4e-06 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPPP P P PPPPPP P PPPPP Sbjct: 547 PPPPLPSGPAYASALPPPPGPPPPP---------PLPSTGPPPPPPPPPPLPNQAPPPPP 597 Query: 420 PP 415 PP Sbjct: 598 PP 599 Score = 50.4 bits (115), Expect = 6e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP G P PPPPP P PPPPPPP Sbjct: 546 PPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPP 587 Score = 46.8 bits (106), Expect = 7e-04 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P GPP P PP A P PPP PP P GPP P P P Sbjct: 533 PTPQGLVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLP 589 Score = 46.0 bits (104), Expect = 0.001 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPP P P PPPPP PPPP Sbjct: 546 PPPPPLPSGPAYASALPPPPGPPPP---------PPLPSTGPPPPPPPPPPLPNQAPPPP 596 Query: 421 PPP 413 PPP Sbjct: 597 PPP 599 Score = 45.6 bits (103), Expect = 0.002 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPPP G PPPPP P PPPPP Sbjct: 541 GPPAPPPPPPLPSGPAYASALPPPPGPPPPP---------PLPSTGPPPPPPPPPPLPNQ 591 Query: 439 XTPPPPPPP 413 PPPPPPP Sbjct: 592 APPPPPPPP 600 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP---PXPXAGPPXPAAPXXXPP 802 P PPPP P G P PPPPP P P P PP P PP Sbjct: 543 PAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPP 595 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXX 707 G P PPPP G A P PPPPP P PPP PP Sbjct: 537 GLVLGPPAPPPPPPLPSGPAYASALPPPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPP 596 Query: 708 XPPGXP 725 PP P Sbjct: 597 PPPPAP 602 Score = 42.3 bits (95), Expect = 0.015 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 6/87 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP------PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 PP P G PPP PPP P PPPP PP P A Sbjct: 414 PPSPTAPNGSLDSVTYPVSPPPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGS 473 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P P P A P P G Sbjct: 474 QASPPPGTPLASTPSSKPSVLPSPSAG 500 Score = 41.5 bits (93), Expect = 0.026 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P P PPPPP P P PPP PPP G PP Sbjct: 433 PPPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPP 479 Score = 41.1 bits (92), Expect = 0.035 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 PPP G A P PPPPPP P PPP PP Sbjct: 433 PPPT----SGPAAPPPPPPPPPPPPPPPLPPPPLPP 464 Score = 40.3 bits (90), Expect = 0.061 Identities = 23/63 (36%), Positives = 23/63 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PP P PPP P PPP PP P P PPPPP P Sbjct: 411 PQMPPSPTAPNGSLDSVTYPVSPPPTSGPAAPPPPPP-------PPPP-----PPPPPLP 458 Query: 749 PXP 757 P P Sbjct: 459 PPP 461 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP G P PP P P PPP PP Sbjct: 563 PPPGPPPPPPLPSTGPPPPPPPPPPLPNQAPPPPPPPPAPP 603 Score = 35.9 bits (79), Expect = 1.3 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -2 Query: 594 PPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP G T PPP P P PPPPPP P PPP PP Sbjct: 414 PPSPTAPNGSLDSVTYPVSPPPTSGPAAPPPPPPPPP---PPPPPPLP-----PPPLPP 464 Score = 35.1 bits (77), Expect = 2.3 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 4/79 (5%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPP--XXXPGPPPPXPPXXGGXXXPXAPXXXAXPP--PPP 742 PPP G PPPPPP P PP G P A P P Sbjct: 433 PPPTSGPAAPPPPPPPPPPPPPPPLPPPPLPPLASLSHCGSQASPPPGTPLASTPSSKPS 492 Query: 743 XPPXPXAGPPXPAAPXXXP 799 P P AG P A P Sbjct: 493 VLPSPSAGAPASAETPLNP 511 Score = 33.9 bits (74), Expect = 5.3 Identities = 22/80 (27%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP--PP 742 PP PP P P P P P P + PP P Sbjct: 381 PPSPPIMISSPPGKATGPRPVLPVCVSSPVPQMPPSPTAPNGSLDSVTYPVSPPPTSGPA 440 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P PP P P PP Sbjct: 441 APPPPPPPPPPPPPPPLPPP 460 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 59.3 bits (137), Expect = 1e-07 Identities = 30/70 (42%), Positives = 31/70 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPP P PPPP PP P A PPPPP P Sbjct: 304 PPPPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPP------PPPGFAGLASPPPPPPP 357 Query: 749 PXPXAGPPXP 778 P + PP P Sbjct: 358 PGGLSIPPPP 367 Score = 52.4 bits (120), Expect = 1e-05 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 4/58 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP----XAGPPXPAAP 787 PPPP P PPPP PP P P PPPPP PP P A PP P P Sbjct: 306 PPPPVPGLGSAPPPPPPPP------PPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPP 357 Score = 51.2 bits (117), Expect = 3e-05 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP G P P PPPPPP P PPPPPPP Sbjct: 304 PPPPPPVPGLGSAPPPP-----PPPPPPGPAGLFSPPPPPPP 340 Score = 51.2 bits (117), Expect = 3e-05 Identities = 23/61 (37%), Positives = 23/61 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPP PPP PP GG P P P Sbjct: 320 PPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPPGLFTTSPSQGLD 379 Query: 749 P 751 P Sbjct: 380 P 380 Score = 50.0 bits (114), Expect = 8e-05 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPPP G P P PPPPP PPPPP Sbjct: 306 PPPPVPGLGSA----PPPPPPPPPPGPAGLFSPPPPP-----PPPPPGFAGLASPPPPPP 356 Query: 420 PP 415 PP Sbjct: 357 PP 358 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPPP G P P PPPPP PPPPPPP Sbjct: 298 GLSNVIPPPPPPVPGLGSAPPPPP-----PPPPPGPAGLFSPPPPPPPP 341 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/60 (38%), Positives = 24/60 (40%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPPP G G + P PPPPP PP PP GG PPG Sbjct: 312 GLGSAPPPPPPPPP--PGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPGG-LSIPPPPG 368 Score = 41.1 bits (92), Expect = 0.035 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP G PPPPP G PPPPPP P PPPP Sbjct: 319 PPPPPPPPGPAGLFSPPPPPPPPPPGFAG----------LASPPPPPPPPGGLSIPPPP 367 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXP----PPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPPP P G P P P PPP PP P G A+P PP G Sbjct: 305 PPPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPPPPPPG 359 Score = 37.5 bits (83), Expect = 0.43 Identities = 25/69 (36%), Positives = 26/69 (37%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G + PPPP PPPPP G P P PPPPP Sbjct: 312 GLGSAPPPPP----------------PPPPPGPAG-LFSPPPPP-----PPPPPGFAGLA 349 Query: 439 XTPPPPPPP 413 PPPPPPP Sbjct: 350 SPPPPPPPP 358 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 662 PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 PPP PP P + PPPPP PP P P PP G G Sbjct: 304 PPPPPP---------VPGLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAG 347 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP G PPPPP P Sbjct: 316 APPPPPPPPPPGPAGLFSPPPPPPPPPPGFAG-----------LASPPPPPPPPGGLSIP 364 Query: 430 PPP 422 PPP Sbjct: 365 PPP 367 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P G G P PPPP G A P PPPPPP PPP Sbjct: 322 PPPPPGPAGLFSPPPPPPPPPPGFAG----LASPP--PPPPPPGGLSIPPP 366 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 59.3 bits (137), Expect = 1e-07 Identities = 35/91 (38%), Positives = 36/91 (39%), Gaps = 6/91 (6%) Frame = +2 Query: 569 PPPPPXXG---GGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP GGG PPP P P PPPP PP P PPPP Sbjct: 469 PPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQP-----PPPP 523 Query: 740 PXPPXPXA---GPPXPAAPXXXPPXXGXGGA 823 P PP P A G +P PP G A Sbjct: 524 PPPPPPGAASQGSSQGPSPLPAPPHGGWNPA 554 Score = 56.4 bits (130), Expect = 9e-07 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 8/74 (10%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPX--------PPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA 781 PPPPPP P PPPP PP P P PPPPP PP AG Sbjct: 459 PPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQ 518 Query: 782 APXXXPPXXGXGGA 823 P PP G A Sbjct: 519 PPPPPPPPPPPGAA 532 Score = 53.6 bits (123), Expect = 6e-06 Identities = 28/65 (43%), Positives = 28/65 (43%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP P PPPP PP P PPPPP PP P P P PP Sbjct: 458 PPPPPP---PPPPPPPPPPTQSSAAGGGP-----PPPPPPPPPPTPMIGVPPPPPPPPPS 509 Query: 806 XGXGG 820 GG Sbjct: 510 VFAGG 514 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPPPP + PPPPPPP Sbjct: 467 PPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPP 508 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXG--GGGXXAXXPXXPPPPPPXXXPXPPPXXPP--XXGGXXXXXXPPGXP 725 P PPPP GGG P PPP P P PPP PP GG PP P Sbjct: 466 PPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPP 525 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP + P PPPPP PPPPPPP Sbjct: 466 PPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPP 508 Score = 43.2 bits (97), Expect = 0.009 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT--PP 428 PPPP G PPPPP P P PPPPP PP Sbjct: 466 PPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPP-----PPPPPSVFAGGQQQQPP 520 Query: 427 PPPPP 413 PPPPP Sbjct: 521 PPPPP 525 Score = 41.5 bits (93), Expect(2) = 3e-04 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -2 Query: 531 PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PP P P PPPPPP P PPPPPPP GGG PP Sbjct: 440 PPLGRLSFTLPPSPLAASPPPPPPPPP-----PPPPPPP-----TQSSAAGGGPPPPP 487 Score = 41.1 bits (92), Expect = 0.035 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPP G P P P P PPPPP Sbjct: 470 PPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPPPPPP 529 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P P PPP PPPPPPP Sbjct: 484 PPPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPP 525 Score = 39.5 bits (88), Expect = 0.11 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 4/97 (4%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXX----PPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXX 331 P P PPPPPP P PPPPPPP G PP F Sbjct: 458 PPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGV-PPPPPPPPPSVFAGGQQ 516 Query: 330 XXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTP 220 P PG G P PP P Sbjct: 517 QQPPPPPPPPPPPGAASQGSSQGPSPLPAPPHGGWNP 553 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP------XXPPPPPPP 415 PPPPP P PPPP P P PPPPPPP Sbjct: 459 PPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTPMIGVPPPPPPP 506 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PP P P PPPPPPP GGG PP Sbjct: 450 PPSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPP 488 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPPP P P PPPP PPPPPPP Sbjct: 457 SPPPPPP----------PPPPPPPPPPTQSSAAGGGPPPPPPP 489 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 5/50 (10%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-----XXXPXPPPXXPPXXGG 692 P PPPP GG P PPPPPP P P P GG Sbjct: 501 PPPPPPPPSVFAGGQQQQPPPPPPPPPPPGAASQGSSQGPSPLPAPPHGG 550 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 609 AXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPPPPP P PP GG PP P Sbjct: 455 AASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPPPP 493 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 536 PPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PP P P P PPP PPPPPPP Sbjct: 450 PPSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPP 490 Score = 35.5 bits (78), Expect = 1.7 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP----PPPXXXXXXXXGXGGGG 373 PPPPP PPPPPP P PP P PPP GG Sbjct: 461 PPPPPPPPPPPPPTQSSAAGGGPPPPPP----PPPPPTPMIGVPPPPPPPPPSVFAGGQQ 516 Query: 372 XXXPP 358 PP Sbjct: 517 QQPPP 521 Score = 35.1 bits (77), Expect = 2.3 Identities = 21/65 (32%), Positives = 24/65 (36%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPX--XXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP 428 PPPP G PPPPP G+ + P P PPPPP + Sbjct: 484 PPPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPP----PPPPPPGAASQGSSQG 539 Query: 427 PPPPP 413 P P P Sbjct: 540 PSPLP 544 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP + P P PPPPP + P P P Sbjct: 503 PPPPPPSVFAGGQQQQPPPPPPPPPPPGAASQGSSQGPSPLP 544 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPP G + P P PPP P P P Sbjct: 485 PPPPPPPPPTPMIGVPPPPPPPPPSVFAGGQQQQPPPPPPPPPPPGAASQGSSQGPSPLP 544 Query: 420 PP 415 P Sbjct: 545 AP 546 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -1 Query: 535 PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP P P PPP PPPPPPP Sbjct: 450 PPSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPP 490 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = -1 Query: 571 GXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G G PP P P P PP PPPPPPP Sbjct: 439 GPPLGRLSFTLPPSPLAASPPPPPPPPPPPPPPPPTQSSAAGGGPPPPPPPPP 491 Score = 33.1 bits (72), Expect = 9.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 677 PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 P G P A PPPP PP P PP P Sbjct: 440 PPLGRLSFTLPPSPLAASPPPPPPPPPPPPPPPP 473 Score = 25.8 bits (54), Expect(2) = 3e-04 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = -2 Query: 276 GXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 G PPPP PP P P P P Sbjct: 480 GGGPPPPPPPPPPPTPMIGVPPPPPPPP 507 >UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF13974, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 692 Score = 59.3 bits (137), Expect = 1e-07 Identities = 31/78 (39%), Positives = 32/78 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP G PP P P PPPP PP P P PPPPP P Sbjct: 85 PLPPPQTGCASPGFYSPLQEPPACPVFLPLPPPPPPPPP-----PPLPSFTLSPPPPPPP 139 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P +P PP Sbjct: 140 PPP---PPLPPSPRPPPP 154 Score = 46.8 bits (106), Expect = 7e-04 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP---PPPPP 415 PPPPP P P PPPPPP P P PP PPPPP Sbjct: 115 PPPPPPPP----PPPLPSFTLSPPPPPPPPPPPPLPPSPRPPPPP 155 Score = 46.8 bits (106), Expect = 7e-04 Identities = 31/89 (34%), Positives = 32/89 (35%), Gaps = 11/89 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXP-XAPXXXAXPPP 736 PPPPP PPPPPP P PPPP P AP + PP Sbjct: 119 PPPPPPPLPSFTLSPPPPPPPPPPPPLPPSPRPPPPPYSYAIKHAGHPAAAPPLSSPSPP 178 Query: 737 PPXPPXPXAGP-------PXPAAPXXXPP 802 PP P A P P P P PP Sbjct: 179 SSLPPHPSALPRSSLDDLPLPPPPPPPPP 207 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/72 (36%), Positives = 28/72 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PP P PP A PP P Sbjct: 117 PPPPPPPPPLPSFTLSPPPPPPPPP-PPPLPPSPRPPPPPYSYAIKHAGHPAAAPPLSSP 175 Query: 749 PXPXAGPPXPAA 784 P + PP P+A Sbjct: 176 SPPSSLPPHPSA 187 Score = 44.8 bits (101), Expect = 0.003 Identities = 25/62 (40%), Positives = 25/62 (40%), Gaps = 4/62 (6%) Frame = +2 Query: 626 PPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPPPPP P PPPP PP P P PPPP AG P A P Sbjct: 118 PPPPPPPPLPSFTLSPPPPPPP----PPPPPLPPSPRPPPPPYSYAIKHAGHPAAAPPLS 173 Query: 794 XP 799 P Sbjct: 174 SP 175 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP--XAGPPXPAAPXXXP 799 PP PPP P P P PPPPP PP P PP P P P Sbjct: 84 PPLPPPQTGCASPGFYSPLQEPPACPVFLPLPPPPPPPPPPPLPSFTLSPPPPPPPPPPP 143 Query: 800 P 802 P Sbjct: 144 P 144 Score = 41.1 bits (92), Expect = 0.035 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPPPP P P P PP P P Sbjct: 115 PPPPPPPPPPPLPSFTLSPPPPPPPPPPPPLPPSPRPPPPPYSYAIKHAGHPAAAP 170 Score = 41.1 bits (92), Expect = 0.035 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PP P PP PP PPPPP P Sbjct: 151 PPPPPY----SYAIKHAGHPAAAPPLSSPSPPSSLPPHPSALPRSSLDDLPLPPPPPPPP 206 Query: 749 PXPXAGPPXPAAPXXXP 799 P P PA P Sbjct: 207 PL-SCFPTCPATGLLGP 222 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX----PXXP 433 PPPP G PP P P PPPPPP P P P Sbjct: 82 PPPPLPPPQTGCASPGFYSPLQEPPACPVFLPLPPPPP----PPPPPPLPSFTLSPPPPP 137 Query: 432 PPPPPP 415 PPPPPP Sbjct: 138 PPPPPP 143 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP P P P A PPPP PP P P +P PP Sbjct: 82 PPPPLPPPQTGCASPGFYSPLQEPPACPVFLPLPPPPPPPPPPPLPSFTLSPPPPPP 138 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 491 PXXXPXPPPPPXXL-XXXXNPPPPPPP 414 P P PPPPP L +PPPPPPP Sbjct: 113 PLPPPPPPPPPPPLPSFTLSPPPPPPP 139 >UniRef50_Q4A263 Cluster: Putative membrane protein; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein - Emiliania huxleyi virus 86 Length = 403 Score = 59.3 bits (137), Expect = 1e-07 Identities = 24/65 (36%), Positives = 28/65 (43%) Frame = +2 Query: 608 CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 C PPPPPP PPP PP P + + P PPP PP P P++P Sbjct: 132 CCLTPPPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSP 191 Query: 788 XXXPP 802 PP Sbjct: 192 PSPPP 196 Score = 58.8 bits (136), Expect = 2e-07 Identities = 29/82 (35%), Positives = 34/82 (41%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PP P PP PP P +P + P PPP P Sbjct: 139 PPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSP 198 Query: 749 P--XPXAGPP--XPAAPXXXPP 802 P P + PP P++P PP Sbjct: 199 PPSSPPSSPPSSPPSSPPSSPP 220 Score = 51.6 bits (118), Expect = 2e-05 Identities = 28/81 (34%), Positives = 31/81 (38%), Gaps = 4/81 (4%) Frame = +2 Query: 569 PPP--PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPP PP PP PPP P PPP PP P +P PP Sbjct: 154 PPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPPS 213 Query: 743 XPP-XPXAGPP-XPAAPXXXP 799 PP P + PP P +P P Sbjct: 214 SPPSSPPSSPPSSPPSPPLQP 234 Score = 49.6 bits (113), Expect = 1e-04 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPP PP PP P PPP PP P P PP PP Sbjct: 149 PPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPP 208 Query: 752 -XPXAGPP--XPAAPXXXPP 802 P + PP P++P PP Sbjct: 209 SSPPSSPPSSPPSSPPSSPP 228 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T PPPPP P P PPP P P PPP PPP Sbjct: 135 TPPPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPP 180 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PP PPP P PP PP PP P Sbjct: 136 PPPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSP 191 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -2 Query: 528 PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P G P PPPPPP P P PPP PPP Sbjct: 118 PNITGCAPCAPMLSCCLTPPPPPPPPPPPSSPPPSPPP 155 Score = 41.1 bits (92), Expect = 0.035 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPP P P P PPP P P PPP Sbjct: 142 PPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPS 201 Query: 420 PP 415 P Sbjct: 202 SP 203 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGG---GGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PP PPP P PPP PP PP P Sbjct: 149 PPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSP 207 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPP PP P PPP PP PP P Sbjct: 139 PPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPP 195 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP P PPP P P PPP PP P PP PP Sbjct: 153 PPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPP 212 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP + P PP PP P PPP PP PP P Sbjct: 144 PPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPP 199 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PP PPP P PP PP PP P Sbjct: 168 PSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSPPSSPPSSP 223 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P + P PP PPP P PPP PP PP P Sbjct: 160 PSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSP 215 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PP PPP P PP PP PP P Sbjct: 172 PSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSPPSSPPSSPPSSP 227 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PP PP P PPP P Sbjct: 136 PPPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSP 178 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P P PPP PPP PP Sbjct: 137 PPPPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPP 179 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP PP PP P PPP P P P PP Sbjct: 151 PSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSS 210 Query: 420 PP 415 PP Sbjct: 211 PP 212 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP + P PP PP P PP PP PP P Sbjct: 156 PSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSP 211 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPP P P P PPP +PPP Sbjct: 141 PPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPPSPPPSSPP---SPPPS 197 Query: 421 PPP 413 PPP Sbjct: 198 PPP 200 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P + P PP PP P PPP PP PP P Sbjct: 164 PSSPPSSPPSPPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSPPSSP 219 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPP--PXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP P + P PP PP P PP PP PP P Sbjct: 174 PPPSPPPSSPPSPPPSSPPSPPPSPPPSSPPSSPPSSPPSSPPSSPPSSPPSSPPSPP 231 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPP---PPXXXXXXXTPPPPPPP 413 PPPPP P P PPP P +PPP PP Sbjct: 139 PPPPPPPPSSPPPSPPPPSSPPSPPPSSPPSSPPSPPPSPPPSSPP 184 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 59.3 bits (137), Expect = 1e-07 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 PPPPPP P PPPP PP P P PPPPP PP P Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 58.8 bits (136), Expect = 2e-07 Identities = 28/64 (43%), Positives = 28/64 (43%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP P PPPP PP PPPPP PP P PP P P PP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPP--------------PPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Query: 806 XGXG 817 G Sbjct: 1455 ISSG 1458 Score = 57.6 bits (133), Expect = 4e-07 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 56.4 bits (130), Expect = 9e-07 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -2 Query: 582 GGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 G G T PPPPP P P PPPPPP P P PPPPPP Sbjct: 1395 GNDVGLTLTPTGTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 55.2 bits (127), Expect = 2e-06 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T PPPPP P P PPPPPP P PPPPPPP Sbjct: 1407 TAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 Score = 54.4 bits (125), Expect = 4e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P PPPPPPP Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 54.4 bits (125), Expect = 4e-06 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P P PPPPPPP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 48.0 bits (109), Expect = 3e-04 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPPPP P P PPPPP PPPPPPP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 689 GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 G P P PPPPP PP P PP P P PP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 42.3 bits (95), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 P PPPP P PPP PP P PPP PP G Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPPISSG 1458 Score = 41.5 bits (93), Expect = 0.026 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 710 PXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P A PPPPP PP P PP P P PP Sbjct: 1404 PTGTAPPPPPPPPPPPPPPPPPPPPPPPPPP 1434 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 609 AXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPPPPP P PPP PP PP P Sbjct: 1408 APPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPPP P PPPPPP P PPP PP PP P Sbjct: 1409 PPPPPPP------PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 600 GXXAXXPXXPPPPPPXXXPXPPPXXPP 680 G P PPPPPP P PPP PP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPP 1432 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 59.3 bits (137), Expect = 1e-07 Identities = 27/62 (43%), Positives = 27/62 (43%), Gaps = 3/62 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA---GPPXPAAPXXX 796 P P PP P PP P PP G P P PPP P PP P A PP P P Sbjct: 164 PEPAPPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKPDPT 223 Query: 797 PP 802 PP Sbjct: 224 PP 225 Score = 55.2 bits (127), Expect = 2e-06 Identities = 27/60 (45%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA-GPPXPAAPXXXPP 802 P PPP P PPPP P P P PPP P PP P A PP P AP PP Sbjct: 157 PDNPPPEPEPAPPPPEPAPP-TPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPP 215 Score = 51.6 bits (118), Expect = 2e-05 Identities = 28/69 (40%), Positives = 28/69 (40%), Gaps = 1/69 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPP P PPPPP P PPP P PP P P PPPPP Sbjct: 160 PPPEPEPAPPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPE--PPPPP- 216 Query: 746 PPXPXAGPP 772 PP P PP Sbjct: 217 PPKPDPTPP 225 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP + P P PPPP P P P P PPPPP Sbjct: 168 PPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPP 208 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-PPPPPXPXXPXXPPPP 424 PPP PPPPP P P P PPPPP P P PPP Sbjct: 160 PPPEPEPAPPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPK 219 Query: 423 PPP 415 P P Sbjct: 220 PDP 222 Score = 46.4 bits (105), Expect = 0.001 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP PPPPP P P P PPPP P P PPP Sbjct: 168 PPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKPDPTPPP 226 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP P P PPPPP P P P P PPP Sbjct: 157 PDNPPPEPEPAPPPPEPAPPTPEPPPPPGPEPPPPPGPEPPP 198 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P P PPPP P PPPPP Sbjct: 166 PAPPPPEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPP 208 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP G P PPPP P P PPP P Sbjct: 182 PPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKPDP 222 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP G P PPPP P P P P PP PP Sbjct: 176 PTPEPPPP--PGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPPKPDPTPPP 226 Score = 36.7 bits (81), Expect = 0.75 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 K P P PPPP P P PPPPP Sbjct: 156 KPDNPPPEPEPAPPPPEPAPPTPEPPPPP 184 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 P PPP G PPPP P P PP P PP P P PPP Sbjct: 178 PEPPPPPGPEPPPPPGPEPPPPPAPEPPP-PPAPEPP------PPPPPKPDPTPPP 226 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-PPPPPXXXPXPPPXXPP 680 P PP P G P P PPPPP P PPP P Sbjct: 171 PEPAPPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEP 212 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPP P PPP P PP P Sbjct: 164 PEPAPPPPEPAPPTPEPPPPPGPEPPPPPG--PEPPPPPAPEPPPPPAPEPPPPPP 217 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 59.3 bits (137), Expect = 1e-07 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP GGG PPPPPP G PPPP PP GG P P PPPP Sbjct: 584 PPPPPMMGGG-------PPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPP 636 Score = 56.0 bits (129), Expect = 1e-06 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPP---XXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 PPPPP GPPPP PP GG P P PPPP P GPP P Sbjct: 584 PPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPP 636 Score = 53.6 bits (123), Expect = 6e-06 Identities = 30/69 (43%), Positives = 30/69 (43%), Gaps = 5/69 (7%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAP--XXXAXPPPPPXPPXPXAGPPXP---AAPXX 793 PPP P P PPPP P GG P P PPPPP PP GPP P Sbjct: 577 PPPAP---PAPPPP-PMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGG 632 Query: 794 XPPXXGXGG 820 PP G GG Sbjct: 633 PPPPPGGGG 641 Score = 53.6 bits (123), Expect = 6e-06 Identities = 25/58 (43%), Positives = 25/58 (43%), Gaps = 2/58 (3%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX--PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 PPPPP G P P PPPPPP P PPPPPP GGGG Sbjct: 584 PPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPPPGGGG 641 Score = 47.6 bits (108), Expect = 4e-04 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP GGG PPPPP G P P PPPP PPPP Sbjct: 584 PPPPPMMGGG-------PPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPPP 636 Query: 421 P 419 P Sbjct: 637 P 637 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/54 (44%), Positives = 24/54 (44%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP GGG PPPPPP PPP PP GG PPG Sbjct: 594 PPPPPPPPMMGGGG-------PPPPPPPPMMGGGPPP--PPPMGGKGGPPPPPG 638 Score = 46.0 bits (104), Expect = 0.001 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXX-----PPPPPPXXXPGPPPPXPPXXGG 691 PPPPP GGGG PPPPPP G PPP PP GG Sbjct: 597 PPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPP-PPGGGG 641 Score = 43.2 bits (97), Expect = 0.009 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXX--PPPPPPPXXXXXXXXGXGGGGXX 367 PPP P P P PPPPPP P PPPPPPP GG Sbjct: 577 PPPAPPAP-----PPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKG 631 Query: 366 XPP 358 PP Sbjct: 632 GPP 634 Score = 38.3 bits (85), Expect = 0.25 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP GGGG PPPPP G P PPPP Sbjct: 591 GGGPPPPPPPPMMGGGGPPP------PPPPPMMGGGPPPPPPMGGKGGPPPPPGGGGFGL 644 Query: 439 XTPPPPP 419 PP Sbjct: 645 FNSNKPP 651 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPPP PPP PP GG PP Sbjct: 581 PPAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPP 613 Score = 33.9 bits (74), Expect = 5.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPP P GG PP Sbjct: 582 PAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPP 614 Score = 33.5 bits (73), Expect = 7.0 Identities = 29/97 (29%), Positives = 29/97 (29%) Frame = +2 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 PPP P GGG GGG G P GG GG Sbjct: 577 PPPAPPAPPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGG---- 632 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP 664 PPPPP GGGG PP P P Sbjct: 633 -----PPPPP--GGGGFGLFNSNKPPANAPKFTVSKP 662 >UniRef50_P27483 Cluster: Glycine-rich cell wall structural protein precursor; n=49; root|Rep: Glycine-rich cell wall structural protein precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 349 Score = 59.3 bits (137), Expect = 1e-07 Identities = 33/78 (42%), Positives = 33/78 (42%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G AG GG A G GG GGG G GA G GG GGG G GG GGG Sbjct: 204 GGGAGGGAGGGGGAGGGGGLGGGHGGGFGGGAGGGLGGGAGGGTGGGFGGGAGGGAGGGA 263 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 264 GGGFGGGAGGGAGGGFGG 281 Score = 53.6 bits (123), Expect = 6e-06 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGX-GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG GA G GG A G GG GGG G G G GG GGG G GG GGG Sbjct: 61 GGAGGGAGGGLGGGAGGGGGIGGGAGGGAGGGLGGGAGGGLGGGHGGGIGGGAGGGAGGG 120 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 121 LGGGHGGGIGGGAGGGSGG 139 Score = 52.8 bits (121), Expect = 1e-05 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG GA G GG G GG GGG G G GG GGG G GGG GG Sbjct: 69 GGLGGGAGGGGGIGGGAGGGAGGGLGGGAGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGG 128 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 129 IGGGAGGGSGGGLGGGIG 146 Score = 52.8 bits (121), Expect = 1e-05 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G AG G GG GGG G GA G GG GGG G GG GGG Sbjct: 268 GGGAGGGAGGGFGGGAGGGAGGGAGGGFGGGAGGGHGGGVGGGFGGGSGGGFGGGAGGGA 327 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 328 GGGAG-----GGFGGGGG 340 Score = 52.4 bits (120), Expect = 1e-05 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG GA G G G G GG GG A G G GG GGG G GGG GG Sbjct: 127 GGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGG 186 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 187 IGGGAGGGSGGGLGGGIG 204 Score = 52.4 bits (120), Expect = 1e-05 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G AG G GG GGG G GA G GG GGG G GG GGG Sbjct: 252 GGGAGGGAGGGAGGGFGGGAGGGAGGGFGGGAGGGAGGGAGGGFGGGAGGGHGGGVGGGF 311 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 312 GGGSGGGFGGGAGGGAGG 329 Score = 52.0 bits (119), Expect = 2e-05 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG GA G GG G GG GGG G G GG GGG G GGG GG Sbjct: 147 GGAGGGAGGGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGG 206 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 207 AGGGAGG--GGGAGGGGG 222 Score = 52.0 bits (119), Expect = 2e-05 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G G GG GGG G GA G GG GGG G GG GGG Sbjct: 180 GGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGAGGGGGLGGGHGGGFGGGAGGGL 239 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 240 GGGAGGGTGGGFGGGAGG 257 Score = 51.6 bits (118), Expect = 2e-05 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G AG G GG GGG G G G GG GGG G GG GGG Sbjct: 248 GGGFGGGAGGGAGGGAGGGFGGGAGGGAGGGFGGGAGGGAGGGAGGGFGGGAGGGHGGGV 307 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 308 GGGFGGGSGGGFGGGAGG 325 Score = 51.2 bits (117), Expect = 3e-05 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G AG G GG GGG G GA G GG GGG G GG GGG Sbjct: 228 GGGFGGGAGGGLGGGAGGGTGGGFGGGAGGGAGGGAGGGFGGGAGGGAGGGFGGGAGGGA 287 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 288 GGGAGGGFGGGAGGGHGG 305 Score = 50.8 bits (116), Expect = 4e-05 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G GG A G G G GGG G G GG GGG G GG GGG Sbjct: 50 GGGIGAGGGFGGGAGGGAGGGLGGGAGGGGGIGGGAGGGAGGGLGGGAGGGLGGGHGGGI 109 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 110 GGGAGGGAGGGLGGGHGG 127 Score = 50.0 bits (114), Expect = 8e-05 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G AG G GG GGG G G G GG GGGG GG GGG Sbjct: 168 GGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGAGGGGGLGGGH 227 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 228 GGGFGGGAGGGLGGGAGG 245 Score = 50.0 bits (114), Expect = 8e-05 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G G G GG GGG G GA G GG GGG G GG GGG Sbjct: 225 GGHGGGFGGGAGGGLG-GGAGGGTGGGFGGGAGGGAGGGAGGGFGGGAGGGAGGGFGGGA 283 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 284 GGGAGGGAGGGFGGGAGG 301 Score = 50.0 bits (114), Expect = 8e-05 Identities = 25/59 (42%), Positives = 26/59 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G AG G GG GGG G G+ G GG GGG G GGGG G Sbjct: 284 GGGAGGGAGGGFGGGAGGGHGGGVGGGFGGGSGGGFGGGAGGGAGGGAGGGFGGGGGAG 342 Score = 49.6 bits (113), Expect = 1e-04 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXG-AXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG GG GGG G G G GG GGG G GGG GG Sbjct: 40 GGGFGGGKGFGGGIGAGGGFGGGAGGGAGGGLGGGAGGGGGIGGGAGGGAGGGLGGGAGG 99 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 100 GLGGGHGGGIGGGAGGGAG 118 Score = 49.6 bits (113), Expect = 1e-04 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG-GG 625 GG G G G GG GGG G GA G GG GGG G GGGG GG Sbjct: 102 GGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGLGG 161 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 162 GHGGGIGGGAGGGAGGGLG 180 Score = 49.6 bits (113), Expect = 1e-04 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG GA G G G GG GG GG G G GG GGG G GGG GG Sbjct: 201 GGIGGGAGGGAGGGGGAGGGGGLGG--GHGGGFGGGAGGGLGGGAGGGTGGGFGGGAGGG 258 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 259 AGGGAGGGFGGGAGGGAG 276 Score = 49.2 bits (112), Expect = 1e-04 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGX--GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG GA G GG G GG GGG G G GG GGG G GGG G Sbjct: 91 GGLGGGAGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAG 150 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G G GGG Sbjct: 151 GGAGGGGGLGGGHGGGIGGG 170 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G AG G GG GGG G G G GG GGG G GG GGG Sbjct: 90 GGGLGGGAGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGG 148 Score = 46.8 bits (106), Expect = 7e-04 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXG-GXGGGGGXAXXXGAXGXXXPPXXGGXG-GGGPGXXXGGGGG 628 GG G GG G G G GGG G GA G GG G GGG G GGG G Sbjct: 35 GGGGLGGGFGGGKGFGGGIGAGGGFGGGAGGGAGGGLGGGAGGGGGIGGGAGGGAGGGLG 94 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G GGG G Sbjct: 95 GGAGGGLGGGHGGGIGGGAG 114 Score = 46.8 bits (106), Expect = 7e-04 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G AG G GG GGG G GA G GG GGGG G G GGG Sbjct: 292 GGGFGGGAGGGHGGGVGGGFGGGSGGGFGGGAGGGAGGGAGGGFGGGG-GAGGGFGGG 348 Score = 44.8 bits (101), Expect = 0.003 Identities = 29/75 (38%), Positives = 29/75 (38%), Gaps = 2/75 (2%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGG-GGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXGGGGGGXXXX 613 G G GG G GG G GGG G G GG GGG G G GGG GG Sbjct: 32 GGGGGGGLGGGFGGGKGFGGGIGAGGGFGGGAGGGAGGGLGGGAGGGGGIGGGAGGGAGG 91 Query: 612 XXKXPPPPXXGGGGG 568 GGG G Sbjct: 92 GLGGGAGGGLGGGHG 106 Score = 43.6 bits (98), Expect = 0.007 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXGGGGGG 625 GG G G G GG GGG G G G GG GGG G G GGG GG Sbjct: 288 GGGAGGGFGGGAGGGHGGGVGGGFGGGSGGGFGGGAGGGAGGGAGGGFGGGGGAGGGFGG 347 Score = 41.1 bits (92), Expect = 0.035 Identities = 31/116 (26%), Positives = 32/116 (27%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G G G G+ G GG G GG G GG Sbjct: 213 GGGGAGGGGGLGGGHGGGFGGGAGGGLGGGAGGGTGGGFGGGAGGGAGGGAGGGFGGGAG 272 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G GG GGG G G F GGG G Sbjct: 273 GGAGGGFGGGAGGGAGGGAGGGFGGGAGGGHGGGVGGGFGGGSGGGFGGGAGGGAG 328 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 F GG GGG G G GGGGG G G GGG G Sbjct: 59 FGGGAGGGAGGGLGGGAGGGGGIGGGAGGGAGGGLGGGAGGGLG 102 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G GG GGG G G GGG G Sbjct: 73 GGAGGGGGIGGGAGGGAGGGLGGGAGGGLGGGHGGGIGGGAG 114 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G G GGGGG G G GGG G Sbjct: 204 GGGAGGGAGGGGGAGGGGGLGGGHGGGFGGGAGGGLGGGAG 244 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGG-GGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GGG GGG G G GGG G Sbjct: 64 GGGAGGGLGGGAGGGGGIGGGAGGGAGGGLGGGAGGGLGGGHG 106 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GG GGG G G GGGGG Sbjct: 118 GGGLGGGHGGGIG-GGAGGGSGGGLGGGIGGGAGGGAGGGGG 158 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGG-GGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGGG G G GGG GGG G G GGG G Sbjct: 210 GAGGGGGAGGGGGLGGGHGGGFGGGAGGGLGGGAGGGTGGGFG 252 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGG GG G GG GGG G G F GGG G GGG Sbjct: 280 GGGAGGGAGGGAGGGFGGGAGGGHGGGVGGGFGGGSGGGFGGGAGGGAGGGAGGGFGGGG 339 Query: 599 G 601 G Sbjct: 340 G 340 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GG GGG G G F G GGG Sbjct: 304 GGGVGGGFGGGSG-GGFGGGAGGGAGGGAGGGFGGGGGAGGG 344 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 7/49 (14%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-------GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G G G GGG G G GGGGG Sbjct: 32 GGGGGGGLGGGFGGGKGFGGGIGAGGGFGGGAGGGAGGGLGGGAGGGGG 80 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G GGG G G G GGG G Sbjct: 134 GGGSGGGLGGGIGGGAGGGAGGGGGLGGGHGGGIGGGAGGGAG 176 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GGGG G Sbjct: 289 GGAGGGFGGGAGGGHGGGVGGGFGGGSGGGFGGGAGGGAGGGAGGGFGGGGGAGGG 344 Score = 36.3 bits (80), Expect = 1.00 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGG GGG G G GG GGG G G GGG G GG Sbjct: 98 GGGLGGGHGGGIG-GGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGG 156 Query: 596 GG 601 GG Sbjct: 157 GG 158 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G GGG G G G GGG G Sbjct: 130 GGGAGGGSGGGLGGGIGGGAGGGAGGGGGLGGGHGGGIGGGAG 172 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGG GG G GG GGG G G GGG G GG Sbjct: 155 GGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGG 214 Query: 596 GG 601 GG Sbjct: 215 GG 216 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G GGGGG G G G GGG Sbjct: 196 GGGLGGGIGGGAGGGAGGGGGAGGGGGLGGGHGGGFGGGAGGG 238 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GGGG G G G F GGG G Sbjct: 200 GGGIGGGAGGGAG-GGGGAGGGGGLGGGHGGGFGGGAGGGLG 240 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G G GG GGG G G GGG G Sbjct: 208 GGGAGGGGGAGGGGGLGGGHGGGFGGGAGGGLGGGAGGGTG 248 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G GG GGG G G GGG G Sbjct: 151 GGAGGGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAG 192 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GG GGG G G GGG G Sbjct: 192 GGGSGGGLGGGIG-GGAGGGAGGGGGAGGGGGLGGGHGGGFG 232 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 205 GGAGGGAGGGGGAGGGGGLGGGHGGGFGGGAGGGLGGGAGGGTGGGFGGGAGGGAG 260 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 F GG G GG G GG GGG G G G GGG Sbjct: 49 FGGGIGAGGGFGGGAGGGAGGGLGGGAGGGGGIGGGAGGGAGGG 92 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G GG GGG G G GGG G Sbjct: 77 GGGGIGGGAGGGAGGGLGGGAGGGLGGGHGGGIGGGAGGGAG 118 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGGG G G G GGG G G G G GGG Sbjct: 152 GAGGGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAGGG 194 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G GGG G G G GGGGG Sbjct: 180 GGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGAGGGGG 222 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G GGG G G GG GG Sbjct: 188 GGGAGGGSGGGLGGGIGGGAGGGAGGGGGAGGGGGLGGGHGG 229 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 233 GGAGGGLGGGAGGGTGGGFGGGAGGGAGGGAGGGFGGGAGGGAGGGFGGGAGGGAG 288 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G GGGG G Sbjct: 107 GGIGGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGLGGG 162 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G GGGGG G G GGG G Sbjct: 138 GGGLGGGIGGGAGGGAGGGGGLGGGHGGGIGGGAGGGAGGGLG 180 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G GGGG G Sbjct: 165 GGIGGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGAGGG 220 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGG-GGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GGG G GGGG G Sbjct: 169 GGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGAGGGGGLGG 225 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 245 GGTGGGFGGGAGGGAGGGAGGGFGGGAGGGAGGGFGGGAGGGAGGGAGGGFGGGAG 300 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 285 GGAGGGAGGGFGGGAGGGHGGGVGGGFGGGSGGGFGGGAGGGAGGGAGGGFGGGGG 340 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GGG GG G F GG GG Sbjct: 308 GGGFGGGSGG--GFGGGAGGGAGGGAGGGFGGGGGAGGGFGG 347 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 F GG GGG G G GGGGG G G Sbjct: 319 FGGGAGGGAGGGAGGGFGGGGGAGGGFGGG 348 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 F GG G GG G G GGG G G G GGG G Sbjct: 43 FGGGKGFGGGIGAGGGFGGGAGGGAGGGLGGGAGGGGGIGGGAG 86 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGGG G G G GGG G G G G GGG Sbjct: 74 GAGGGGGIGGGAGGGAGGGLGGGAGGGLGGGHGGGIGGGAGGG 116 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGG G G GG GGG G G GGG G Sbjct: 143 GGIGGGAGGGAGGGGGLGGGHGGGIGGGAGGGAGGGLGGGHG 184 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G GGG G G G GGG G Sbjct: 176 GGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAGGGAGGGGGAG 218 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 225 GGHGGGFGGGAGGGLGGGAGGGTGGGFGGGAGGGAGGGAGGGFGGGAGGGAGGGFG 280 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 261 GGAGGGFGGGAGGGAGGGFGGGAGGGAGGGAGGGFGGGAGGGHGGGVGGGFGGGSG 316 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G G GGG G G G G GGG Sbjct: 72 GGGAGGGGGIGGGAGGGAGGGLGGGAGGGLGGGHGGGIGGG 112 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G GG GGG G G GGG G Sbjct: 94 GGGAGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAG 134 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 221 GGLGGGHGGGFGGGAGGGLGGGAGGGTGGGFGGGAGGGAGGGAGGGFGGGAGGGAG 276 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 253 GGAGGGAGGGAGGGFGGGAGGGAGGGFGGGAGGGAGGGAGGGFGGGAGGGHGGGVG 308 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G GG GGG G G GGG G Sbjct: 86 GGGAGGGLGGGAGGGLGGGHGGGIGGGAGGGAGGGLGGGHG 126 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G A GG G G Sbjct: 95 GGAGGGLGGGHGGGIGGGAGGGAGGGLGGGHGGGIGGGAGGGSGGGLGGGIGGGAG 150 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGG GG G A GGG G Sbjct: 308 GGGFGGGSGGGFGGGAGGGAGGGAGGGFGGGGGAGGGFGGG 348 >UniRef50_A7IPJ6 Cluster: SH3 type 3 domain protein precursor; n=2; cellular organisms|Rep: SH3 type 3 domain protein precursor - Xanthobacter sp. (strain Py2) Length = 589 Score = 58.8 bits (136), Expect = 2e-07 Identities = 46/151 (30%), Positives = 47/151 (31%), Gaps = 2/151 (1%) Frame = +2 Query: 374 PPPPX--PXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXX 547 PPPP P GG GG G G G GG G G G + P G GG Sbjct: 172 PPPPVAPPPPPGWNRPGGPGGPGYPGGPGYPGGPGRPGEPGGPG-YPGGPGRPGEPGGPG 230 Query: 548 XVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX 727 P P GG G P P PG PP P GG P P Sbjct: 231 GPGYPGGPGRPGEPGGPGRPGV------PGQPGVQPGTPPGQPGGPGGPGGPGRPGEPGG 284 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P P P P P P G G Sbjct: 285 PGRPGVPGQPGVQPGTPPGQPGGPGGPGRPG 315 Score = 56.0 bits (129), Expect = 1e-06 Identities = 56/199 (28%), Positives = 57/199 (28%), Gaps = 1/199 (0%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG PG G G GG GG G PG + G Sbjct: 197 GGPGYPGGPGRPGEPGGPGYPGGPGRPGEPGGPGGPGYPGGPGRPGEPGGPGRP--GVPG 254 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 P P GG GG G G G GG G G P GG G Sbjct: 255 QPGVQPGTPPGQ-PGGPGGPGGPGRPGEPGGPGRPGVPGQPGVQPGTPPGQPGGPG---- 309 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 P P GG G P P PG PP P GG P P P Sbjct: 310 ----GPGRPGEPGGPG------RPGVPGQPGVQPGTPPGQPGGPGGPGRPGVPGQPGVQP 359 Query: 734 -PPPXPPXPXAGPPXPAAP 787 PP P GP P P Sbjct: 360 GTPPGQPGGPGGPGRPGVP 378 Score = 52.4 bits (120), Expect = 1e-05 Identities = 56/210 (26%), Positives = 59/210 (28%), Gaps = 8/210 (3%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG PG G G GG G G PG + + GG Sbjct: 230 GGPGYPGGPGRPGEPGGPGRPGVPGQP--GVQPGTPPGQPGGPGGPGGPGRPGEPGGPGR 287 Query: 374 PPPPX-PXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXX 550 P P P G GG G G G GG G G P GG G Sbjct: 288 PGVPGQPGVQPGTPPGQPGGPGGPGRPGEPGGPGRPGVPGQPGVQPGTPPGQPGGPGGPG 347 Query: 551 VXXXXXPP------PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP 712 P PP GG G P P PG PP GG P P Sbjct: 348 RPGVPGQPGVQPGTPPGQPGGPGGPGRPGV---PGQPGVQPGTPPGQSGQPGGPGRPVVP 404 Query: 713 XXXAXPP-PPPXPPXPXAGPPXPAAPXXXP 799 + P PP P GP P P Sbjct: 405 GQPSGQPGTPPGQPGRPGGPGPNGLPNRPP 434 Score = 52.0 bits (119), Expect = 2e-05 Identities = 56/211 (26%), Positives = 58/211 (27%), Gaps = 1/211 (0%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXX 646 APP P G G G P G G GG G G P G GG GGPG Sbjct: 177 APPPPPGWNRPGGPGGPGYPG-GPGYPGGPGRPGEPGGPGYPGGPGRPGEPGGPGGPGYP 235 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP 466 G G G + P G G T P P G + P P Sbjct: 236 GGPGRPGEPGGPGRPGVPGQPGVQPG-----TPPGQPGGPGGPGGPGRPGEPGGPGRPGV 290 Query: 465 PPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGX 286 P P PP P GG G P PG Sbjct: 291 PGQPGVQPGTPPGQPGGPGGPGRPGEPGGPGRPGVPG-----QPGVQPGTPPGQPGGPGG 345 Query: 285 XXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P P P PGGPG P Sbjct: 346 PGRPGVPGQPGVQ-PGTPPGQPGGPGGPGRP 375 Score = 49.6 bits (113), Expect = 1e-04 Identities = 57/213 (26%), Positives = 58/213 (27%), Gaps = 6/213 (2%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAX-GXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXX 646 P P G G GGP G G G G G P GG GG GGPG Sbjct: 220 PGRPGEPGGPGGPGYPGGPGRPGEPGGPGRPGVPGQPGVQPGTPPGQPGGPGGPGGPGRP 279 Query: 645 XGGGGGGXXXXXXKXP----PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXX 478 GG G + PP GG G P P G P Sbjct: 280 GEPGGPGRPGVPGQPGVQPGTPPGQPGGPGGPGRPGEPGGPGRPGVPGQPGVQPGT---- 335 Query: 477 XPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXP 298 PP P P P P P P G GG P Sbjct: 336 -PPGQPGGPGGPGRPGVPGQPGVQPGTPPGQPGG-PGGPGRPGVPGQPGVQPGTPPGQSG 393 Query: 297 XPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPG 199 PG P P P P P PGGPG Sbjct: 394 QPGGPGRPVVPGQPSGQ-PGTPPGQPGRPGGPG 425 Score = 47.2 bits (107), Expect = 5e-04 Identities = 44/146 (30%), Positives = 44/146 (30%), Gaps = 11/146 (7%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG-----GXXXVXXXXXPPPP 580 GG G G G G GG GG G G P GG G G V P P Sbjct: 212 GGPGYPGGPGRPGEPGGPGGPGYPGGPGR----PGEPGGPGRPGVPGQPGVQPGTPPGQP 267 Query: 581 PXXGG-GGXXCXXXXXPP-----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 GG GG P P P PG PP P GG P P P P Sbjct: 268 GGPGGPGGPGRPGEPGGPGRPGVPGQPGVQPGTPPGQPGGPGGPGRPGEPGGPGRPGVPG 327 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P G G Sbjct: 328 QPGVQPGTPPGQPGGPGGPGRPGVPG 353 Score = 41.9 bits (94), Expect = 0.020 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 3/85 (3%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPP---PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPP G PP PPPP PPPP GG P P P P Sbjct: 150 PPPGPRQPGWWRNNYIAPPGMQPPPPVA--PPPPPGWNRPGGPGGPGYPGGPGYPGGPGR 207 Query: 746 PPXPXAGPPXPAAPXXXPPXXGXGG 820 P P GP P P G GG Sbjct: 208 PGEP-GGPGYPGGPGRPGEPGGPGG 231 Score = 36.7 bits (81), Expect = 0.75 Identities = 48/185 (25%), Positives = 50/185 (27%), Gaps = 2/185 (1%) Frame = +2 Query: 200 PGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKK-KXGGXXXP 376 PG PG G G G GG G PG + + GG P Sbjct: 264 PGQPGGPGGPGGPGRPGEPGGPGRPGVPGQPGVQPGTPPGQPGGPGGPGRPGEPGGPGRP 323 Query: 377 PPPX-PXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 P P G GG G G G G G G P GG G Sbjct: 324 GVPGQPGVQPGTPPGQPGGPGGPGRPGVPGQPG-----VQPGTPPGQPGGPGGPGRPGVP 378 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 P P G G P P PG PP P GG P P Sbjct: 379 GQPGVQPGTPP-GQSGQPGGPGRPVVPGQPSGQPGTPPGQPGRPGG------PGPNGLPN 431 Query: 734 PPPXP 748 PP P Sbjct: 432 RPPSP 436 Score = 34.7 bits (76), Expect = 3.0 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 276 GXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 G PPPP PP P PGGPG P Sbjct: 169 GMQPPPPVAPPPPPGWNRPGGPGGPGYP 196 >UniRef50_Q43522 Cluster: Tfm5 protein; n=9; Magnoliophyta|Rep: Tfm5 protein - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 207 Score = 58.8 bits (136), Expect = 2e-07 Identities = 33/84 (39%), Positives = 34/84 (40%), Gaps = 3/84 (3%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGG---GGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P GG G +G GG G GG GGG GG G G G GGGG G G Sbjct: 39 PGSGGSGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGG 98 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGG 568 GG GG GGGGG Sbjct: 99 GGSGGGGGGGGGGGGGGGGGGGGG 122 Score = 57.2 bits (132), Expect = 5e-07 Identities = 29/69 (42%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXG-GGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG +G GG G GG G GGGG G G GG GGGG G GGGGGG Sbjct: 60 GGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGGG 119 Query: 624 XXXXXXKXP 598 + P Sbjct: 120 GGGGQVRCP 128 Score = 40.7 bits (91), Expect = 0.046 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGG G G G GGGG G GGGGG GG Sbjct: 59 GGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGG 118 Query: 596 GG 601 GG Sbjct: 119 GG 120 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG G G G GGGGG G G GGGGG Sbjct: 82 GGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGGGGGGG 123 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 G GGGG G G G GGGG G G GGGGG V Sbjct: 80 GSGGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGGGGGGGQV 125 Score = 38.3 bits (85), Expect = 0.25 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +2 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXX 559 PP G GGGG G G G G GG G G G GGG Sbjct: 38 PPGSGGSGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSGGGGSGSGGGGSGTGG 97 Query: 560 XXXPPPPPXXGGGG 601 GGGG Sbjct: 98 GGGSGGGGGGGGGG 111 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 PP GG GGG G GG G G G + GGGG G Sbjct: 38 PPGSGGSGGGGSGSGGGGSGSGGGGGGSGSGGGGSGSGGGGSGSG 82 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 418 GGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 GGGG G GGGGG G G GGGGG R Sbjct: 82 GGGGSGSGGGGSGTGGGGGSGGGGGGGGGGGGGGGGGGGGGGQVR 126 >UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr1 scaffold_135, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 673 Score = 58.8 bits (136), Expect = 2e-07 Identities = 28/78 (35%), Positives = 30/78 (38%), Gaps = 5/78 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-----PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPP PPPP PP PP P PP P + PP Sbjct: 31 PPPPDDDSPSAPPPTSKTSPPPPSDSSPPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPP 90 Query: 734 PPPXPPXPXAGPPXPAAP 787 PPP PP +GPP P P Sbjct: 91 PPPPPPSSGSGPPKPPPP 108 Score = 53.2 bits (122), Expect = 8e-06 Identities = 26/77 (33%), Positives = 28/77 (36%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPP P P PP P P P + PP PP P Sbjct: 50 PPPPSDSSPPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPPPS 109 Query: 752 XPXAGPPXPAAPXXXPP 802 + PP P P PP Sbjct: 110 HSNSSPPPP--PTSPPP 124 Score = 49.2 bits (112), Expect = 1e-04 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP P P PPPPPP P PP PP Sbjct: 50 PPPP---SDSSPPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPP 106 Query: 420 PP 415 PP Sbjct: 107 PP 108 Score = 48.8 bits (111), Expect = 2e-04 Identities = 27/83 (32%), Positives = 28/83 (33%), Gaps = 2/83 (2%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP--PXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPP PPPP P P +P PPP P Sbjct: 22 PPPKSSTSPPPPPDDDSPSAPPPTSKTSPPPPSDSSPPPDSNTSPPSPPPPKSESPPPTP 81 Query: 749 PXPXAGPPXPAAPXXXPPXXGXG 817 P P PP P PP G G Sbjct: 82 PPPSPSPPPP---PPPPPSSGSG 101 Score = 42.3 bits (95), Expect = 0.015 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP----PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP 433 PPPP PPP PP P P PPP PP P P Sbjct: 31 PPPPDDDSPSAPPPTSKTSPPPPSDSSPPPDSNTSPPSPPPPKSESPPPTPPPPS----P 86 Query: 432 PPPPPP 415 PPPPP Sbjct: 87 SPPPPP 92 Score = 41.9 bits (94), Expect = 0.020 Identities = 25/83 (30%), Positives = 26/83 (31%), Gaps = 2/83 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX--PXXPPP 427 PPPP + PPPP P P PP PPP P PPP Sbjct: 30 PPPPPDDDSPSAPPPTSKTSPPPPSD------SSPPPDSNTSPPSPPPPKSESPPPTPPP 83 Query: 426 PPPPXXXXXXXXGXGGGGXXXPP 358 P P G G PP Sbjct: 84 PSPSPPPPPPPPPSSGSGPPKPP 106 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP E P PPPPP PP PPPP Sbjct: 66 PPSPPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPPP 108 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPP-PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPP + PP PPP P P PP PP P PPP Sbjct: 58 PPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPP 117 Query: 423 PP 418 PP Sbjct: 118 PP 119 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP- 424 PPPP + PPPPP P P PPPP PPPP Sbjct: 69 PPPPKSESPPPTPPPPSPSPPPPPPP--------PPSSGSGPPKPPPPSHSNSSPPPPPT 120 Query: 423 -PPP 415 PPP Sbjct: 121 SPPP 124 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 8/70 (11%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP--- 428 PPP PPPP P P PPPPP PP Sbjct: 50 PPPPSDSSPPPDSNTSPPSPPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPPPS 109 Query: 427 -----PPPPP 413 PPPPP Sbjct: 110 HSNSSPPPPP 119 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP G G P PPP P PPP PP Sbjct: 88 PPPPPPPPPSSGSG-----PPKPPPPSHSNSSPPPPPTSPP 123 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPP-PPPXXXXXXXTPPPP--PPP 413 P PPP P P PP PPP PPPP PPP Sbjct: 79 PTPPPPSPSPPPPPPPPPSSGSGPPKPPPPSHSNSSPPPPPTSPPP 124 Score = 35.1 bits (77), Expect = 2.3 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 8/66 (12%) Frame = +2 Query: 629 PPPPPXXXPGPPPPX---PPXXGGXXXPXAPXXXAXPPPPP-----XPPXPXAGPPXPAA 784 P PP PPP PP P AP + PPP PP PP P Sbjct: 12 PESPPEDSSSPPPKSSTSPPPPPDDDSPSAPPPTSKTSPPPPSDSSPPPDSNTSPPSPPP 71 Query: 785 PXXXPP 802 P P Sbjct: 72 PKSESP 77 >UniRef50_A4S5W2 Cluster: Predicted protein; n=2; Eukaryota|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 722 Score = 58.8 bits (136), Expect = 2e-07 Identities = 34/78 (43%), Positives = 34/78 (43%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 87 GGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGG---GGGGTGGGGTG-GNGGGGGGT 142 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 143 GGGTGGNGGGGNGGGGGG 160 Score = 56.0 bits (129), Expect = 1e-06 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G GG GG GG G G GG GGGG G GG GG Sbjct: 77 GGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNG 136 Query: 621 XXXXXKXPPPPXXGGGG 571 GGGG Sbjct: 137 GGGGGTGGGTGGNGGGG 153 Score = 56.0 bits (129), Expect = 1e-06 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGG--GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G G GG G GG GG GGG G G GG GGGG G GG GG Sbjct: 104 GGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGG 163 Query: 627 GXXXXXXKXPPPPXXGGGG 571 G GGGG Sbjct: 164 GTGGNGGGGGGGGGGGGGG 182 Score = 55.6 bits (128), Expect = 2e-06 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXG-AAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GG GG G G GG GGGG G GGGGGG Sbjct: 66 GGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGG 125 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 126 GTGGGGTGGNGGGGGGTGG 144 Score = 54.8 bits (126), Expect = 3e-06 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG G GGG G G GG GGGG G GG GG Sbjct: 133 GGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGG 191 Score = 54.4 bits (125), Expect = 4e-06 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGG-GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GG GGG G G GG GGG G G GGGG Sbjct: 113 GGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGG 172 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 173 GGGGGGGGGGTGGNGGDGG 191 Score = 53.6 bits (123), Expect = 6e-06 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGX-GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G GG G GG GG GG G G G GGGG G GGGGGG Sbjct: 63 GGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGG 122 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 123 GGGGTGGGGTGGNGGGGGG 141 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G GG G GG G G GG GGGG G G GG G Sbjct: 111 GGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGG 170 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 171 GGGGGGGGGGGGTGGNGG 188 Score = 46.8 bits (106), Expect = 7e-04 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G G G GGG G G GG GGG G GGG G Sbjct: 37 GGQGGGHGGHGG-GQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGG 95 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 96 DGGTGGGTGGNGGGGGGG 113 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G G G G G GGG G G G G GG G GGGGGG Sbjct: 58 GGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGG 116 Score = 45.6 bits (103), Expect = 0.002 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G G G G G GGG G G G G GG G GG GGG Sbjct: 51 GGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGG 110 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 111 GGGGGGGGGGGGGGGGTG 128 Score = 42.7 bits (96), Expect = 0.011 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG G G GGGG G G G GGG G GG Sbjct: 114 GGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGG 173 Query: 596 GG 601 GG Sbjct: 174 GG 175 Score = 42.3 bits (95), Expect = 0.015 Identities = 24/61 (39%), Positives = 24/61 (39%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGG GG G G GGGGGG G G GGGGG GGG Sbjct: 100 GGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGG 159 Query: 599 G 601 G Sbjct: 160 G 160 Score = 42.3 bits (95), Expect = 0.015 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGGGGG G G GG GGG G G G GGG GG Sbjct: 111 GGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGG 170 Query: 596 GG 601 GG Sbjct: 171 GG 172 Score = 41.5 bits (93), Expect = 0.026 Identities = 31/82 (37%), Positives = 31/82 (37%), Gaps = 4/82 (4%) Frame = -2 Query: 801 GGXXXGAA--GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG--GGPGXXXGGG 634 GG G A G GG G GG G GGG G G GG GG GG G GG Sbjct: 28 GGHVGGHAVGGQGGGHGGHGG-GQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGD 86 Query: 633 GGGXXXXXXKXPPPPXXGGGGG 568 GG GG GG Sbjct: 87 GGTGGGHGGDGGTGGGTGGNGG 108 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G G GGGGGG G G G GGG Sbjct: 104 GGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGG 145 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G GGGG G G GGGGG Sbjct: 139 GGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGG 180 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G GGGG G G GGGGG Sbjct: 136 GGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGG 176 Score = 39.5 bits (88), Expect = 0.11 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -2 Query: 777 GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXP 598 G GG G G GGG G G GG GGG G G GGG Sbjct: 26 GDGGHVGGHAVGGQGGGHGGHGGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGG 85 Query: 597 PPPXXGGGGG 568 GG GG Sbjct: 86 DGGTGGGHGG 95 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGG-GGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G GGGG GG G G GGGGG Sbjct: 136 GGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGG 178 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGG G G GGGGGG G G GG GG Sbjct: 97 GGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGG 137 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GGG G G G GGGGGG G G GGGG GG Sbjct: 98 GTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGG 157 Query: 596 GG 601 GG Sbjct: 158 GG 159 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGG G G G GGGGGG G GGGGG Sbjct: 141 GTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGG 182 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGG 658 GG G G GG G GG GGGGG G G GG GG Sbjct: 150 GGGGNGGGG-GGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGGYPAGG 196 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G G GG GGG G G GGGGG Sbjct: 73 GGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGG 114 Score = 37.5 bits (83), Expect = 0.43 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GG GGG G GGGGGG G G G GGG GG Sbjct: 97 GGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGG 156 Query: 596 GG 601 GG Sbjct: 157 GG 158 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGGG G GGGG G Sbjct: 104 GGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGG 144 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGG GG G G GGGGGG G G Sbjct: 157 GGGGTGGGTGGNGGGGGGGGGGGGGGTG 184 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G G G GG G G G GG GG Sbjct: 150 GGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGG 191 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G G G GG GG GG G G GGG P G GGG Sbjct: 534 GDGGEGGEGGDGSIGGGGGDGGDGGDGGDGTTGGDHPIGGDGTTGGGYPVGGDGTTGGG 592 Score = 36.3 bits (80), Expect = 1.00 Identities = 30/109 (27%), Positives = 31/109 (28%), Gaps = 1/109 (0%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G G G G G GG GGG G GG Sbjct: 85 GDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGG 144 Query: 374 PPPPXPXXXXXXFXGGGGGG-GXXGXXGXGGGGGGXXXXXGXGXFXXFP 517 GG GGG G G G GGGGGG G G +P Sbjct: 145 GTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGGDGGYP 193 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GG GG G G GGGGG G G GGG G GG Sbjct: 92 GHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGG 151 Query: 596 GG 601 GG Sbjct: 152 GG 153 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG GGG G G GGG GG G G GGGG Sbjct: 87 GGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGG 126 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G G GGG G G G GG GG Sbjct: 147 GGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGGNGG 188 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G GG GGG G G GGGGG Sbjct: 84 GGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGG 124 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG G GGG G GGGGGG G GGGG G Sbjct: 88 GTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTG 143 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGG G G GGG GG G G GG GG Sbjct: 44 GGHGGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGG 85 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GGG G GGGGGG G GGGG G Sbjct: 105 GNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGG 145 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGG GG G GGGG G Sbjct: 139 GGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGG 179 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G G GGG GG G G GG GG Sbjct: 144 GGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGGGTGG 185 Score = 34.7 bits (76), Expect = 3.0 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = +2 Query: 416 GGGGGGGXXGXXGX-GGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXG 592 GGG GGG G G GG GG G G GGGGG G Sbjct: 69 GGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTG 128 Query: 593 GGG 601 GGG Sbjct: 129 GGG 131 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG GGGGGG G GGGG G Sbjct: 109 GGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGG 164 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG G GGG G G GGGG G Sbjct: 111 GGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGG 170 Query: 594 GGG 602 GGG Sbjct: 171 GGG 173 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGG-GGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGG GG G GGGG G Sbjct: 101 GGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGG 157 Score = 33.9 bits (74), Expect = 5.3 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGG GG G G GG GG G GGGGG GGG Sbjct: 80 GGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGGGGGGGGGGGTGGGGTGGNGGGG 139 Query: 599 G 601 G Sbjct: 140 G 140 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 GGGG GG G GGG G G GGGGG Sbjct: 138 GGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGG 179 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GGG G G GG GG Sbjct: 47 GGGQGGGHGGHGGGHGGGHGGHGGGQGGGHGGHGGGHGGDGG 88 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGG GG G G G GGG G G GG GG GGG Sbjct: 58 GGGHGGGHGGHGGGQGGGHGGHGGGHGGDGGTGGGHGGDGGTGGGTGGNGGGGGGGGGGG 117 Query: 599 G 601 G Sbjct: 118 G 118 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GG G G GGGG G GGGG G Sbjct: 121 GGGGGGTGGGGTGGNGGGGGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGG 176 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGG GGG GGGG G G GGGGG Sbjct: 139 GGGTGGGTGGNGGGGNGGGGGGTGGGTGGNGGGGGGGGGGGGG 181 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGG G G G GG GG G G GG G Sbjct: 344 GGGGGNGGEGGEGGEGGEGGEGGEGGEGGDGDGTTGHDGGDG 385 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G P G G GGG G G GGG P G GGG Sbjct: 587 GTTGGGYPVGGDGTTGGGYPVGGDGTTGGDHPVGGDGTTGGGYPVGGDGATGGG 640 >UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-PA - Drosophila melanogaster (Fruit fly) Length = 993 Score = 58.8 bits (136), Expect = 2e-07 Identities = 33/78 (42%), Positives = 34/78 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPPP GPPPP P G P P PPP P Sbjct: 435 PPPPPPSGNYG--------PPPPPPSGNYGPPPPPP---SGNYGPPPPPSGNYGPPP--P 481 Query: 749 PXPXAGPPXPAAPXXXPP 802 P GPP P + PP Sbjct: 482 PSGNYGPPPPPSGNYGPP 499 Score = 52.0 bits (119), Expect = 2e-05 Identities = 30/70 (42%), Positives = 30/70 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G PPPPPP GPP PP G P P PPP P Sbjct: 446 PPPPPPSGNYG--------PPPPPPSGNYGPP---PPPSGNYGPPPPPSGNYGPPP---P 491 Query: 749 PXPXAGPPXP 778 P GPP P Sbjct: 492 PSGNYGPPPP 501 Score = 50.8 bits (116), Expect = 4e-05 Identities = 25/66 (37%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-- 427 PPPP G G + PPPP G P P PPPPP P PP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGN 495 Query: 426 --PPPP 415 PPPP Sbjct: 496 YGPPPP 501 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP------PPPPPXXXXXXXXGXGG 379 PPPPP P P PPPPPP PP PPPPP G Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSG 494 Query: 378 GGXXXPPXF 352 PP F Sbjct: 495 NYGPPPPQF 503 Score = 43.6 bits (98), Expect = 0.007 Identities = 33/98 (33%), Positives = 33/98 (33%), Gaps = 6/98 (6%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXP--PPPXXGGGGGXXXXXTXXXPPPPPXXX 517 PP GGGG GGGGG K P G PPPP Sbjct: 80 PPKLNFLGGGG----GGGGGGSSLHEQIKTHFGVPKPFYGPPHIQHKPAQQYGPPPPKPA 135 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPP----PPPP 415 P P PPPP P P PPP PPPP Sbjct: 136 PQYGPPPQPAPQYGPPPPKPAP--QYGPPPTQYGPPPP 171 Score = 42.3 bits (95), Expect = 0.015 Identities = 21/54 (38%), Positives = 22/54 (40%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 GPPPP P G P P PPP PP GPP P + PP G Sbjct: 434 GPPPPPP---SGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSG 484 Score = 41.9 bits (94), Expect = 0.020 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPP P GPPP P G P P PPP P P AP PP Sbjct: 129 PPPPKPAPQYGPPPQPAPQYG--PPPPKPAPQYGPPPTQYGPPPPLKIQHRPAPQYGPPK 186 Query: 806 XGXG 817 G Sbjct: 187 LQYG 190 Score = 41.1 bits (92), Expect = 0.035 Identities = 37/117 (31%), Positives = 37/117 (31%), Gaps = 11/117 (9%) Frame = +2 Query: 452 GXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXG---GGGXXCXXXX 622 G GGGGGG P G PPPP G Sbjct: 89 GGGGGGGGSSLHEQIKTHFGVPKPFYGPPHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQY 148 Query: 623 XPPPPPPXXXPGPPP----PXPP-XXGGXXXP--XAPXXXAXPPPPP-XPPXPXAGP 769 PPPP P GPPP P PP P P PPPPP P P A P Sbjct: 149 GPPPPKPAPQYGPPPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPPQLLPSPHAAP 205 Score = 40.7 bits (91), Expect = 0.046 Identities = 24/74 (32%), Positives = 25/74 (33%), Gaps = 4/74 (5%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G PPPPP P P PPPPP Sbjct: 431 GHSGPPPPPPSGNYGPPPPPPSGNYGPPPPPPSGN--YGPPPPPSGNYGPPPPPSGNYGP 488 Query: 439 XTPPP----PPPPE 410 PP PPPP+ Sbjct: 489 PPPPSGNYGPPPPQ 502 Score = 40.3 bits (90), Expect = 0.061 Identities = 24/76 (31%), Positives = 25/76 (32%), Gaps = 3/76 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP---GPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP P P P GPP P PP P P P P Sbjct: 609 PPPPPPSAPQLSLQQQLPAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPPLANVRPLGP 668 Query: 740 PXPPXPXAGPPXPAAP 787 P PP P P+ P Sbjct: 669 PPPPTQQYLPAAPSGP 684 Score = 39.9 bits (89), Expect = 0.081 Identities = 40/134 (29%), Positives = 40/134 (29%), Gaps = 3/134 (2%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXX 589 F GGGG GGGGGG P G PPPP Sbjct: 85 FLGGGG----------GGGGGGSSLHEQIKTHFGVPKPFYGPPHIQHKPAQQYGPPPPKP 134 Query: 590 GGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP---PXPPXPX 760 PPP P GPPPP P G P PPPP P P Sbjct: 135 A--------PQYGPPPQPAPQYGPPPPKPAPQYG-----PPPTQYGPPPPLKIQHRPAPQ 181 Query: 761 AGPPXPAAPXXXPP 802 GPP PP Sbjct: 182 YGPPKLQYGPPPPP 195 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 G P P PPPPP P PPPPPP G G PP Sbjct: 431 GHSGPPPPPPSGNYGPPPPP-PSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 35.1 bits (77), Expect = 2.3 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 11/69 (15%) Frame = +2 Query: 626 PPPPP-----------PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP 772 PPPPP P PGP G P P PPPPP GPP Sbjct: 610 PPPPPSAPQLSLQQQLPAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPPLANVRPLGPP 669 Query: 773 XPAAPXXXP 799 P P Sbjct: 670 PPPTQQYLP 678 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP---PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP 430 PPPP P P G P P PPPPP P PP Sbjct: 610 PPPPPSAPQLSLQQQLPAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPPLANVRPLGPP 669 Query: 429 PPP 421 PPP Sbjct: 670 PPP 672 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 9/50 (18%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP---------PPPPPXPXXPXXPPPPPP 418 PPPPP + P P PP PP P P PPPPP Sbjct: 610 PPPPPSAPQLSLQQQLPAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPP 659 Score = 33.5 bits (73), Expect = 7.0 Identities = 24/76 (31%), Positives = 24/76 (31%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G P G G PPP G G PPPPP G Sbjct: 437 PPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYG---------PPPPP--SGN 485 Query: 510 XXKXPXPXXXXXPPPP 463 P P PPPP Sbjct: 486 YGPPPPPSGNYGPPPP 501 >UniRef50_Q7QDL5 Cluster: ENSANGP00000000741; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000000741 - Anopheles gambiae str. PEST Length = 421 Score = 58.8 bits (136), Expect = 2e-07 Identities = 45/132 (34%), Positives = 45/132 (34%), Gaps = 4/132 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG GAA G G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 153 GGSGTGAAQGGRGRGGGGGYGGGGG-GGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGG 211 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP----X 454 PP GG PP G P P P PP Sbjct: 212 YG----NAPPSSYNPMGGYGQNNGGPGGGPPGPKRGRYDAGP-PTRALPPKAMPPHHGAA 266 Query: 453 PXXPXXPPPPPP 418 P PP P Sbjct: 267 APVPSYSAPPQP 278 Score = 48.4 bits (110), Expect = 2e-04 Identities = 37/123 (30%), Positives = 38/123 (30%), Gaps = 5/123 (4%) Frame = -2 Query: 780 AGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG--GGXXXXXX 607 +G G A GG GG G G G GG GGGG G GGGG GG Sbjct: 139 SGGGSGAGQSGGSSGGSGTGAAQGGRGRGGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGG 198 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXX 436 GGGGG P G P P PP P Sbjct: 199 GGGGMGGGGGGGGYGNAPPSSYNPMGGYGQNNGGPGGGPPGPKRGRYDAGPPTRALPPKA 258 Query: 435 PPP 427 PP Sbjct: 259 MPP 261 Score = 46.0 bits (104), Expect = 0.001 Identities = 38/131 (29%), Positives = 40/131 (30%), Gaps = 2/131 (1%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GGGGG G G GGGGGG G + GGG G PP Sbjct: 165 GRGGGGGYGG--GGGGGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGGYGNAPPSSYNP 222 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP--PXPPXPXAGP 769 G P PP G PP P A P P PP P A Sbjct: 223 MGGYGQNNGGPGGGPPGPKRGRYDAGPPTRALPPKAMPPHHGAAAPVPSYSAPPQPMANH 282 Query: 770 PXPAAPXXXPP 802 + P P Sbjct: 283 GGYSDPNAHAP 293 Score = 45.2 bits (102), Expect = 0.002 Identities = 40/133 (30%), Positives = 41/133 (30%), Gaps = 7/133 (5%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXX 589 + GGGGGGG G G G GGG G G GGGGG P Sbjct: 172 YGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGM-------GGGGGGGGYGNAPPSSYNPMG 224 Query: 590 GGGGXXCXXXXXPPPPP-------PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 G G PP P P PP PP G AP PP P Sbjct: 225 GYGQNNGGPGGGPPGPKRGRYDAGPPTRALPPKAMPPHHGA----AAPVPSYSAPPQPMA 280 Query: 749 PXPXAGPPXPAAP 787 P AP Sbjct: 281 NHGGYSDPNAHAP 293 Score = 44.8 bits (101), Expect = 0.003 Identities = 39/134 (29%), Positives = 40/134 (29%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GG G G G G GGGGGG G G GGGGG GGG Sbjct: 162 GGRGRGGGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGMGG----------GGGGGG 211 Query: 599 GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP 778 P G P PP P A PP PP A P P Sbjct: 212 YGNAPPSSYNPMGGYGQNNGGPGGGPPGPKRGRYDAGPPTRAL-PPKAMPPHHGAAAPVP 270 Query: 779 AAPXXXPPXXGXGG 820 + P GG Sbjct: 271 SYSAPPQPMANHGG 284 Score = 39.5 bits (88), Expect = 0.11 Identities = 32/100 (32%), Positives = 32/100 (32%), Gaps = 8/100 (8%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGG GG G GGG G G GGGGG P P G Sbjct: 168 GGGGYGGGGGGGGGGGYGGGGMSGGGGYGGGGGGGMGGGGGGGGYGNAP---PSSYNPMG 224 Query: 594 GGGXXAXXPXXPPPPP--------PXXXPXPPPXXPPXXG 689 G G P PP P P PP PP G Sbjct: 225 GYGQNNGGPGGGPPGPKRGRYDAGPPTRALPPKAMPPHHG 264 Score = 35.9 bits (79), Expect = 1.3 Identities = 31/95 (32%), Positives = 31/95 (32%), Gaps = 11/95 (11%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXG---XXXPP--XXGGXGGGGP 655 PP G GGP G GGGG G G PP G GGGP Sbjct: 15 PPRGGYSDRGRGRGRGGGPPMGPRMGMGGGGPPMMRGRGGMMRGGGPPRGMGGPPRGGGP 74 Query: 654 ----GXXXGGGGGGXXXXXXK--XPPPPXXGGGGG 568 G GGGGGG PP G G Sbjct: 75 PMSRGGPYGGGGGGRPMGGRSNYGGPPSSVSNGSG 109 Score = 35.9 bits (79), Expect = 1.3 Identities = 25/80 (31%), Positives = 26/80 (32%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGP--AXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG + GP A G GG A GA GG G G G GG G Sbjct: 98 GGPPSSVSNGSGPPAAIAAAENGDGGKVAETNGATKAVSTTSGGGSGAGQSGGSSGGSGT 157 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G GGGGG Sbjct: 158 GAAQGGRGRGGGGGYGGGGG 177 Score = 33.9 bits (74), Expect = 5.3 Identities = 32/101 (31%), Positives = 33/101 (32%), Gaps = 10/101 (9%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGX---GGXGGGGGXAXXXG---AXGXXXPPXXGGXGG----GGPG 652 G G G GGP G G G G G G G PP G GG GGP Sbjct: 3 GPPRGGYRGRGGPPRGGYSDRGRGRGRGGGPPMGPRMGMGGGGPPMMRGRGGMMRGGGPP 62 Query: 651 XXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPP 529 GG G + P GGGGG PP Sbjct: 63 RGMGGPPRGGGPPMSRG--GPYGGGGGGRPMGGRSNYGGPP 101 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 4/62 (6%) Frame = -2 Query: 801 GGXXXGAAGX---GGPAXGXGGX-GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 GG G G GGP GG GGGGG G PP G G P Sbjct: 59 GGPPRGMGGPPRGGGPPMSRGGPYGGGGGGRPMGGRSNYGGPPSSVSNGSGPPAAIAAAE 118 Query: 633 GG 628 G Sbjct: 119 NG 120 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 58.8 bits (136), Expect = 2e-07 Identities = 30/77 (38%), Positives = 30/77 (38%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP P P PP PP P P PPPPP P Sbjct: 249 PPPPYPN----PYPQPPYPPPPPPYPNPYPQPPYPPPPAPCSGP-GPCPYPGPPPPPYPA 303 Query: 752 XPXAGPPXPAAPXXXPP 802 PP P P PP Sbjct: 304 PTPYPPPPPPYPEQVPP 320 Score = 58.4 bits (135), Expect = 2e-07 Identities = 29/73 (39%), Positives = 29/73 (39%), Gaps = 3/73 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP---PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP P P P P PGPPPP P P P PPPP Sbjct: 263 PPPPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPP 322 Query: 740 PXPPXPXAGPPXP 778 P PP P PP P Sbjct: 323 PPPPPPPPPPPYP 335 Score = 58.0 bits (134), Expect = 3e-07 Identities = 29/66 (43%), Positives = 29/66 (43%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G C PPPP P P PPPP PP P P PPPPP PP Sbjct: 279 PPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPP-PPYPEQVPPPPPP----PPPPPPPPP 333 Query: 752 XPXAGP 769 P P Sbjct: 334 YPYPYP 339 Score = 50.8 bits (116), Expect = 4e-05 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPPP P P PPPPP P P PPP P Sbjct: 279 PPPPAPCSGPGPCPYP---GPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPPPYP 335 Query: 420 PP 415 P Sbjct: 336 YP 337 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 3/61 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP---PXPXAGPPXPAAPXXX 796 P PPPP P P PP PP P P PPP P P P GPP P P Sbjct: 247 PYPPPPYPNPYPQPPYPPPPPPYPNPY-PQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPT 305 Query: 797 P 799 P Sbjct: 306 P 306 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP-------PPPXPXXPXXPPPPPPP 415 PP PP P P PPP PPP P P PPPPPP Sbjct: 276 PPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPP 324 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPP G G P PP P P P PPP P PP P Sbjct: 276 PPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPP 331 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP + P P PPPPP P PP PPPP Sbjct: 247 PYPPPPYPNPYPQPPYP------PPPPPYPNPYPQPPYPPPP 282 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 10/51 (19%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXP----------XXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP + P P PPPPP P PPPPPP Sbjct: 263 PPPPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPP 313 Score = 36.3 bits (80), Expect = 1.00 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP-PXPAAPXXXPP 802 PP P P P P P P P PP PP PP P P P P P P Sbjct: 226 PPYPYPTAAPYPYQYSPYPYTPYPPPPYPNPYPQPPYPP-PPPPYPNPYPQPPYPPPPAP 284 Query: 803 XXGXG 817 G G Sbjct: 285 CSGPG 289 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P P PP P PPP PP Sbjct: 292 PYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPPPPPPPPPP 332 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXPPXPXAGP-PXPAAPXXXP 799 P P PP P P P P P P PP PP P P P P P P Sbjct: 222 PAPYPPYPYPTAAPYPYQYSPYPYTPYPPPPYPNPYPQPPYPPPPPPYPNPYPQPPYPPP 281 Query: 800 P 802 P Sbjct: 282 P 282 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +2 Query: 641 PXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPPPXP---PXPXAGPPXPAA--PXXXPP 802 P P P PP P P +P PPPP P P P PP P P PP Sbjct: 218 PAPGPAPYPPYPYPTAAPYPYQYSPYPYTPYPPPPYPNPYPQPPYPPPPPPYPNPYPQPP 277 >UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Aldrich syndrome (eczema-thrombocytopenia); n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to Wiskott-Aldrich syndrome (eczema-thrombocytopenia) - Strongylocentrotus purpuratus Length = 492 Score = 58.4 bits (135), Expect = 2e-07 Identities = 32/83 (38%), Positives = 33/83 (39%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPPP G P PPPP GPPPP P AP PPPPP Sbjct: 281 PPPPPSRTPGPPL--PNRPPAPPPPGNSRGPPPPAVPPSRSYPSAPAPSRGLPPPPPPQS 338 Query: 743 ---XPPXPXAGPPXPAAPXXXPP 802 PP P P +AP PP Sbjct: 339 QYNAPPAPPPTRPMTSAPPPPPP 361 Score = 52.0 bits (119), Expect = 2e-05 Identities = 31/88 (35%), Positives = 31/88 (35%), Gaps = 4/88 (4%) Frame = +2 Query: 569 PPP--PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXG--GXXXPXAPXXXAXPPP 736 PPP PP PPPPPP PP PP P P A PP Sbjct: 310 PPPAVPPSRSYPSAPAPSRGLPPPPPPQSQYNAPPAPPPTRPMTSAPPPPPPPPSAPMPP 369 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P PP PAAP G GG Sbjct: 370 PMNGSVPPPPPPPPAAPMGGGGGGGRGG 397 Score = 47.6 bits (108), Expect = 4e-04 Identities = 34/97 (35%), Positives = 34/97 (35%), Gaps = 14/97 (14%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP----PPPPXXXPGPPPPXPP----XXGGXXXPXAPXXXAX 727 PP P G PP P P G PPP PP P P A Sbjct: 297 PPAPPPPGNSRGPPPPAVPPSRSYPSAPAPSRGLPPPPPPQSQYNAPPAPPPTRPMTSAP 356 Query: 728 PPPPPXP----PXPXAG--PPXPAAPXXXPPXXGXGG 820 PPPPP P P P G PP P P P G GG Sbjct: 357 PPPPPPPSAPMPPPMNGSVPPPPPPPPAAPMGGGGGG 393 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/54 (42%), Positives = 23/54 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPPP PPP P G P PP P PP GPP PA P Sbjct: 269 PPPPPPSRGSHAPPPPPSRTPGPPLPNR-------PPAPPPPGNSRGPPPPAVP 315 Score = 47.2 bits (107), Expect = 5e-04 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 10/66 (15%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX--PPPPPPXPXXPXXPP--------PPPPPXXXXXXXX 391 PPPPP P P PPPPPP P P PP PPPPP Sbjct: 332 PPPPPQSQYNAPPAPPPTRPMTSAPPPPPPPPSAPMPPPMNGSVPPPPPPPPAAPMGGGG 391 Query: 390 GXGGGG 373 G G GG Sbjct: 392 GGGRGG 397 Score = 46.0 bits (104), Expect = 0.001 Identities = 34/122 (27%), Positives = 35/122 (28%), Gaps = 8/122 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPP-----PPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PPPPP G P P PP P PP P PPPP P Sbjct: 269 PPPPPPSRGSHAPPPPPSRTPGPPLPNRPPAPPPPGNSRGPPPPAVPPSRSYPSAPAPSR 328 Query: 375 GXXXPPX---FFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 G PP + P P PPP PP P P P G Sbjct: 329 GLPPPPPPQSQYNAPPAPPPTRPMTSAPPPPPPPPSAPMPPPMNGSVPPPPPPPPAAPMG 388 Query: 204 PG 199 G Sbjct: 389 GG 390 Score = 45.2 bits (102), Expect = 0.002 Identities = 24/78 (30%), Positives = 25/78 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP G P P G PPP PP P P PP P Sbjct: 300 PPPPGNSRGPPPPAVPPSRSYPSAPAPSRGLPPPPPPQSQYNAPPAPPPTRPMTSAPPPP 359 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P + P P PP Sbjct: 360 PPPPSAPMPPPMNGSVPP 377 Score = 44.0 bits (99), Expect = 0.005 Identities = 29/110 (26%), Positives = 30/110 (27%), Gaps = 1/110 (0%) Frame = -2 Query: 741 GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXX 562 GG A PP G P G PPPP G Sbjct: 253 GGNPLEGLARAAGSSAPPPPPPSRGSHAPPPPPSRTPGPPLPNRPPAPPPPGNSRGPPPP 312 Query: 561 XXX-TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 + P P G P PP PPP PPPPPPP Sbjct: 313 AVPPSRSYPSAPAPSRGLPPPPPPQSQYNAPPAPPPTRPMTSAPPPPPPP 362 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPP G P P G P P PPP PPPP Sbjct: 301 PPPGNSRGPPPPAVPPSRSYPSAPAPSRGLPPPPPPQSQYNAPPAPPPTRPMTSAPPPPP 360 Query: 421 PPP 413 PPP Sbjct: 361 PPP 363 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 APP PP P P P PP PPPPPP Sbjct: 342 APPAPPPTRPMTSAPPPPPPPPSAPMPPPMNGSVPPPPPPPP 383 >UniRef50_Q4T4L4 Cluster: Chromosome undetermined SCAF9593, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF9593, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 335 Score = 58.4 bits (135), Expect = 2e-07 Identities = 30/73 (41%), Positives = 30/73 (41%), Gaps = 3/73 (4%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP--XPP 751 PP GG PP PPP PGPPP PP P P PP PP PP Sbjct: 57 PPSMPGGIRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGLPPP 116 Query: 752 XPXAG-PPXPAAP 787 P G PP P P Sbjct: 117 PPRTGAPPRPLGP 129 Score = 47.6 bits (108), Expect = 4e-04 Identities = 31/90 (34%), Positives = 32/90 (35%) Frame = +2 Query: 533 GGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP 712 GG + P PPP G PP PPP GPPP PP P P Sbjct: 62 GGIRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPR---GPPPRLPPPAPPGLPPPPP 118 Query: 713 XXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 A PP P PP PP A PP Sbjct: 119 RTGA-PPRPLGPPMALFPPPLSANVLSAPP 147 Score = 44.8 bits (101), Expect = 0.003 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P P PGPPP PP P P P PPP P P PP P PP G Sbjct: 67 PLPRLLPPGPPPGRPP-----GPPPGPPPGLPPGPPPRGPPPRLPPPAPPGLPPPPPRTG 121 Score = 41.1 bits (92), Expect = 0.035 Identities = 37/142 (26%), Positives = 37/142 (26%), Gaps = 7/142 (4%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP--P 424 PP GG G P PPP P P PPP P P P PP P Sbjct: 57 PPSMPGGIRGPLPRLLP--PGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGLP 114 Query: 423 PPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXX 244 PPP G PP PPP Sbjct: 115 PPPPRTGAPPRPLGPPMALFPPPLSANVLSAPPNIVQRQKGSASQDGSQTNLPPPAMSMR 174 Query: 243 P-----PRXPXTPXXPGGPGXP 193 P P P TP GG P Sbjct: 175 PGVMQMPPPPGTPAAQGGANNP 196 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP G P PPP PP P GPP P P PP Sbjct: 52 PPFLRPPSMPGGIRGPLPRLLPPGPPPGRPPGPPPGPP-PGLPPGPPP 98 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPP-PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PP P G G PP PPP P P PPP P P PP Sbjct: 73 PPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGLPPPPPRTGAPPRPLGPPMA 132 Query: 423 --PPP 415 PPP Sbjct: 133 LFPPP 137 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 576 PPXXXGG--GGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PP GG G P PPP PP P PPP PP G PP P Sbjct: 57 PPSMPGGIRGPLPRLLPPGPPPGRPPGPPPGPPPGLPP---GPPPRGPPPRLP 106 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 58.4 bits (135), Expect = 2e-07 Identities = 29/61 (47%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP--PPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP P PPPP PP P P + PP PPP P P PP PA P P Sbjct: 1227 PPPPPPSPPPSPPPPSPP-------PTPPPPLSPPPSLPPPSSPPPSPNPP-PAPPPPSP 1278 Query: 800 P 802 P Sbjct: 1279 P 1279 Score = 58.0 bits (134), Expect = 3e-07 Identities = 27/54 (50%), Positives = 27/54 (50%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPP P P PPPP PP P P PPPPP PP P A PP P P Sbjct: 490 PPPPTPPPSPPPPPPSPPPS-----PFLPPPSLPPPPPPSPPPPSA-PPIPLPP 537 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/71 (39%), Positives = 29/71 (40%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PPPP P PPPP P P +P PPP P P Sbjct: 1226 PPPPPPPS---------PPPSPPPPSPPPTPPPPLSPPPS-LPPPSSPPPSPNPPPAPPP 1275 Query: 749 PXPXAGPPXPA 781 P P P PA Sbjct: 1276 PSPPPPLPFPA 1286 Score = 51.6 bits (118), Expect = 2e-05 Identities = 23/58 (39%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-PPPXPPXPXAGPPXPAAPXXXP 799 PPPPP P P PP P P +P PP PP P P PP P+ P P Sbjct: 1226 PPPPPPPSPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPPPPLP 1283 Score = 50.8 bits (116), Expect = 4e-05 Identities = 28/69 (40%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = +2 Query: 608 CXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA-A 784 C PPPPPP P PPP P A PPP P PP P PP PA + Sbjct: 198 CSKPPSPPPPPPSPFPPSPPPSP---------------APPPPSPLPPPPLPPPPSPAPS 242 Query: 785 PXXXPPXXG 811 P PP G Sbjct: 243 PPPPPPPIG 251 Score = 49.2 bits (112), Expect = 1e-04 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP PP P P PPP PP P + PP A P PP Sbjct: 488 PSPPPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPPIPLPP 537 Score = 49.2 bits (112), Expect = 1e-04 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 5/70 (7%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPP----PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 P P C PPPP P P PPPP PP P P PPPPP Sbjct: 1665 PRPVLKAFTGGCYPPAAPPPPSEPPLPPSPPSPPPPSPPPPASP--PLLPPAPPSPPPPP 1722 Query: 743 XP-PXPXAGP 769 P P P GP Sbjct: 1723 DPAPPPPPGP 1732 Score = 48.4 bits (110), Expect = 2e-04 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = +2 Query: 626 PP--PPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PP PPPP P PP PP PP P PP PP PP P PP P P Sbjct: 1678 PPAAPPPPSEPPLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPPPDP--APPPPPGP 1732 Score = 46.0 bits (104), Expect = 0.001 Identities = 20/44 (45%), Positives = 22/44 (50%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 PP PPP P PPPP PP P +P + PP PP P P Sbjct: 694 PPSPPPPSPPSPPPPSPP------PPPSPPPPSLPPSPPPPYAP 731 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P PPPP P P P PPPPPP Sbjct: 207 PPPSPFPPSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPP 248 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/49 (42%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP-XPXAGPPXPAAPXXXPP 802 P P GG P AP + PP PP PP P PP PA+P PP Sbjct: 1665 PRPVLKAFTGGCYPPAAPPPPSEPPLPPSPPSPPPPSPPPPASPPLLPP 1713 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 P P PPPP PP P P PPP P PP PP P AP Sbjct: 685 PLSRSPSPPPPSPPPPS---PPSPPPPSPPPPPSPPPPSLPPSPPPPYAP 731 Score = 44.8 bits (101), Expect = 0.003 Identities = 24/56 (42%), Positives = 26/56 (46%), Gaps = 2/56 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP--PPPXPPXPXAGPPXPAAP 787 P P PP P PPP PP P P PP PPP PP P + PP P+ P Sbjct: 1441 PSPSPPPSPPPSPPPSPP-------PLQPPPSPPPPLLPPPFPPPPNS-PPLPSFP 1488 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PP P PP Sbjct: 499 PPPPPPSPPPSPFLPPPSL---PPPPPPSPPPPSAPPIPLPP 537 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPP P P P PPP P P Sbjct: 205 PPPPPSPF-----PPSPPPSPAPPPPSPLPPPPLPPPPSPAP 241 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXPPPPPPP 415 P PPP P PPP PPP P P PPPP PP Sbjct: 1236 PSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPP 1279 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXG 382 PPPP P P PPP P P P PPPPP G G Sbjct: 1682 PPPPSEPPLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPPPDPAPPPPPGPG 1733 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPP-PPPPXPXXPXXPP-PPPPP 415 PPPPP P P P PPPP P P P PPPPP Sbjct: 204 PPPPPPSPFPPSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPP 247 Score = 41.5 bits (93), Expect = 0.026 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 + P P PPP PP P P PPPP PP Sbjct: 688 RSPSPPPPSPPPPSPPSPPPPSPPPPPSPP 717 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP P PP P PP P P PPPP P Sbjct: 692 PPPPSPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPPYAP 731 Score = 41.5 bits (93), Expect = 0.026 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 P P P PPPP PP P +P PPPPP PP Sbjct: 839 PSSTPCSPPSPPPPLPPP---PPPPNSPPPPYDPPPPPSPP 876 Score = 41.1 bits (92), Expect = 0.035 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPP-PXXXXXXXTPPPPPPP 413 PPPP P P PPPP P +PPPPPPP Sbjct: 206 PPPPSPFPPSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPPP 249 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T PPPPP P P PP PPP P P PPP PP Sbjct: 1223 TCSPPPPPP---------PSPPPSPPPPSPPPTPPPPLSPPPSLPP 1259 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P PPP PP P P PPPP P Sbjct: 690 PSPPPPSPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPPYAP 731 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP--PPPX--PXXPXXPPPPPPP 415 PP PP P P PPP PPP P P PP PPPP Sbjct: 1231 PPSPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPP 1276 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P P PPP P P PPP P P Sbjct: 1244 PPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPPPPLPFP 1285 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PP PP P P P PPPPP Sbjct: 1691 PPSPPSPP--PPSPPPPASPPLLPPAPPSPPPPPDPAPPPPP 1730 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = -2 Query: 498 PXPXXXXXPPPPPP-XPXXPXXPPPPPPP 415 P P PPPPPP P P PPPPP P Sbjct: 847 PSPPPPLPPPPPPPNSPPPPYDPPPPPSP 875 Score = 39.9 bits (89), Expect = 0.081 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP--XPXXPXXPPPPPPP 415 PP P P P P PPPP P P PP PPPP Sbjct: 1678 PPAAPPPPSEPPLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPP 1721 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P PPP P P PP PPPP Sbjct: 1240 PPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPPPP 1281 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PP P + P P PPPP P PPP PP Sbjct: 209 PSPFPPSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPPPPPP 249 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P PPP PP P PPP PPP Sbjct: 1441 PSPSPPPSPPPSPPPSPPPLQPPPSPPP 1468 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/55 (34%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +2 Query: 653 PGPPPP--XPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P PPP PP P P PP PP P + PP P PP G Sbjct: 1679 PAAPPPPSEPPLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPPPDPAPPPPPGPG 1733 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPP--PXPXXPXXPPPPPPP 415 P PPP P P PPP P P P P PPP PPP Sbjct: 488 PSPPPPTPPPSPPPPPPS----PPPSPFLPPPSLPPPPPPSPPP 527 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPP P P PPPP P Sbjct: 490 PPPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAP 531 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P PPP P P P PPP PP Sbjct: 491 PPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPP 532 Score = 37.5 bits (83), Expect = 0.43 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP-PPPXXXXXXXXGXGG 379 P P P P P PP PPP P PPPP PP GG Sbjct: 1441 PSPSPPPSPPPSPPPSPPPLQPPPSPPPPLLPPPFPPPPNSPPLPSFPPLCNEGG 1495 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PPPPP P P P PP L +P P PPP Sbjct: 203 SPPPPPPSPFPPSPPPSPAPPPPSPLPPPPLPPPPSPAPSPPP 245 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 P PPP PP P PP P PPPP PP P P P Sbjct: 488 PSPPPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPPIPLPPGYWQTP 543 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PPPPPP PPP PP Sbjct: 495 PPPSPPPPPPSPPPSPFLPPPSLPPPPPP---SPPPPSAPP 532 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 R +PPPP P P P PPP L PP PPPP Sbjct: 688 RSPSPPPPSPPPPSPPSPPPPSPPPPPSPPPPSL-----PPSPPPP 728 Score = 36.3 bits (80), Expect = 1.00 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 609 AXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPP PP P PPP PP PP P Sbjct: 485 ASEPSPPPPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPP 523 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP-PPPXPXXPXXPPPPPPP 415 PP PP P P PP PPP P P P PP P Sbjct: 492 PPTPPPSPPPPPPSPPPSPFLPPPSLPPPPPPSPPPPSAPPIP 534 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP-PPPPXXXPXPPPXXPPXXGG 692 P PP P P PP PPPP P PPP P G Sbjct: 690 PSPPPPSPPPPSPPSPPPPSPPPPPSPPPPSLPPSPPPPYAPLQTG 735 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 A PPPP P PPP L P PPPPP Sbjct: 1680 AAPPPPSEPPLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPPP 1722 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 P PPP P PP PPP P PPP PP G Sbjct: 1692 PSPPSPPPPSPPPPASPPLLPPAPPSPPPPPDPAPPP--PPGPG 1733 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = -2 Query: 528 PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP---PPPP 415 P G K P P P PP P P PPP PPPP Sbjct: 192 PVRCGVCSKPPSPPPPPPSPFPPSPPPSPAPPPPSPLPPPP 232 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPP P P PPP P PP P Sbjct: 1226 PPPPPPPSPPPSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPP-------PPSP 1278 Query: 421 PPP 413 PPP Sbjct: 1279 PPP 1281 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPP + P PPP P P PPP PP Sbjct: 1235 PPSPPPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPP 1275 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPP + P PPP P P PPP PP Sbjct: 1239 PPPSPPPTPPPPLSPPPSLPPPSSPPPSPNPPPAPPPPSPP 1279 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P P PPPPP P PPPPP Sbjct: 1695 PSPPPPSPPPPASPPLLPPAPPSPPPPPD-------PAPPPPP 1730 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P P PPPP P PPP PP PP Sbjct: 201 PPSPPPPPPSP----FPPSPPPSPAPPPPSPLP-PPPLPPPPSPAPSPPPPPP 248 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/49 (42%), Positives = 21/49 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP 772 PPP PP P PPP PP G P AP A PP P G P Sbjct: 1010 PPPLPPS--PYPPPSPPP---GAPPPKAPPIAAPPPTNCGPYGFRPGEP 1053 Score = 34.3 bits (75), Expect = 4.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -2 Query: 492 PXXXXX-PPPPPPXPXXPXXPPPPPPP 415 P PPPP P P P PPPP PP Sbjct: 685 PLSRSPSPPPPSPPPPSPPSPPPPSPP 711 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPP 680 P PP PPP P PPP PP Sbjct: 1443 PSPPPSPPPSPPPSPPPLQPP 1463 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +P PP P P PPPP +PPPPPPP Sbjct: 210 SPFPPSPPPSPAPPPPSPLPPPPLPPPP---SPAPSPPPPPPP 249 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPP PP PP P Sbjct: 694 PPSPPPPSP---PSPPPPSPPPPPSPPPPSLPPSPP 726 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPP--PPPP 415 P PP PP P P PPP PPPP Sbjct: 839 PSSTPCSPPSPPPPLPPPPPPPNSPPPP 866 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPP 680 P PPPPPP P PPP PP Sbjct: 851 PPLPPPPPPPNSP-PPPYDPP 870 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 PPP PP P P PPP PP Sbjct: 1010 PPPLPPSPYPPPSPPPGAPP 1029 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 710 PXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPP P P P PP P P PP Sbjct: 1447 PSPPPSPPPSPPPLQPPPSPPPPLLPPPFPP 1477 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXPP 680 P PPP + P PPPP PP P PP PP Sbjct: 1679 PAAPPPPSEPPLPPSPPSPPPPSPPPPASPPLLPPAPPSPPPP 1721 >UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG06865; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG06865 - Caenorhabditis briggsae Length = 646 Score = 58.4 bits (135), Expect = 2e-07 Identities = 36/85 (42%), Positives = 36/85 (42%), Gaps = 1/85 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGG-GGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 PP P GG G GG G GG GGG GG G G GG GGGG G Sbjct: 77 PPPPCGGGGGGCGGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGGG-GGCG 135 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGGG GGGGG Sbjct: 136 GGGGGGCGGGGG------GCGGGGG 154 Score = 57.6 bits (133), Expect = 4e-07 Identities = 38/87 (43%), Positives = 38/87 (43%), Gaps = 3/87 (3%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGX--GGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGX 649 PP P GG G G GG G GG GGGGG GA G GG GG GG G Sbjct: 76 PPPPPCGG---GGGGCGGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGGGG 132 Query: 648 XXGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGGG GGGGG Sbjct: 133 GCGGGGGGGCGGGGGG----CGGGGGG 155 Score = 54.8 bits (126), Expect = 3e-06 Identities = 32/77 (41%), Positives = 32/77 (41%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G GG A G GG G GGG G G GG GGGG G GGGG G Sbjct: 100 GGGGGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGG 159 Query: 618 XXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 160 SSGG------CGGGGGG 170 Score = 52.4 bits (120), Expect = 1e-05 Identities = 32/68 (47%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXG-GGGGXXXVXXXXXP--PPPPX 586 GGGGGGG G G GGG GG G G P G GGGG P PPPP Sbjct: 26 GGGGGGGCGGGCGGGGGCGG-----GCGPPPPPPCGGGCGGGGVCGGGGVCAPALPPPPP 80 Query: 587 XGGGGXXC 610 GGGG C Sbjct: 81 CGGGGGGC 88 Score = 52.4 bits (120), Expect = 1e-05 Identities = 28/63 (44%), Positives = 28/63 (44%) Frame = -2 Query: 756 GXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGG 577 G GG G GGG G G PP GGG G GGGG PPPP GG Sbjct: 27 GGGGGGCGGGCGGGGGCGGGCGPPPPPPCGGGCGGGGVCGGGG---VCAPALPPPPPCGG 83 Query: 576 GGG 568 GGG Sbjct: 84 GGG 86 Score = 50.8 bits (116), Expect = 4e-05 Identities = 31/72 (43%), Positives = 31/72 (43%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G GG G GG GG GG G PP GG GGGG GGGG Sbjct: 26 GGGGGGGCGGGCGGGGGCGG-----GCGPPPPPPCGGGCGGGGVC-----GGGGVCAPAL 75 Query: 606 KXPPPPXXGGGG 571 PPP GGGG Sbjct: 76 PPPPPCGGGGGG 87 Score = 50.8 bits (116), Expect = 4e-05 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G G GG G GG GGGG G G GG GGG G GGGGG Sbjct: 114 GGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCG-GGGGGCGGGSSGGCGGGGGG 170 Score = 49.6 bits (113), Expect = 1e-04 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 3/61 (4%) Frame = -1 Query: 688 PXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPP-PXXXGGGGXXXGXXXXXP--PPPPXXX 518 P GG GGG G GGGGG G PPP GGGG G P PPPP Sbjct: 23 PSLGGGGGGGCGGGCGGGGGCGGGCGPPPPPPCGGGCGGGGVCGGGGVCAPALPPPPPCG 82 Query: 517 G 515 G Sbjct: 83 G 83 Score = 49.2 bits (112), Expect = 1e-04 Identities = 33/85 (38%), Positives = 33/85 (38%), Gaps = 7/85 (8%) Frame = -2 Query: 801 GGXXXGAAGXGG-----PAXGXGGXGGGGGXAXXXG--AXGXXXPPXXGGXGGGGPGXXX 643 GG G G GG P GG GGGG G A PP GG GGG G Sbjct: 34 GGGCGGGGGCGGGCGPPPPPPCGGGCGGGGVCGGGGVCAPALPPPPPCGGGGGGCGGGCG 93 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGG GGGGG Sbjct: 94 GGGGGCGGGGGGCGGGGGACGGGGG 118 Score = 48.8 bits (111), Expect = 2e-04 Identities = 34/89 (38%), Positives = 34/89 (38%), Gaps = 5/89 (5%) Frame = +2 Query: 359 GGXXXP--PPPXPXXXXXXFXGGG--GGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXX 523 GG P PPP P GGG GGGG G G G GGGGG G G Sbjct: 68 GGVCAPALPPPPPCGGGGGGCGGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGC 127 Query: 524 XGGGGGXXXVXXXXXPPPPPXXGGGGXXC 610 GGGGG GGGG C Sbjct: 128 GGGGGGCGGGGGGGCGGGGGGCGGGGGGC 156 Score = 48.0 bits (109), Expect = 3e-04 Identities = 29/66 (43%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG--GXXXVXXXXXPPPPP 583 F GGGGG G G GGGGG G GGGG G V PPPPP Sbjct: 22 FPSLGGGGG-GGCGGGCGGGGGCGGGCGPPPPPPCGGGCGGGGVCGGGGVCAPALPPPPP 80 Query: 584 XXGGGG 601 GGGG Sbjct: 81 CGGGGG 86 Score = 48.0 bits (109), Expect = 3e-04 Identities = 32/88 (36%), Positives = 32/88 (36%), Gaps = 4/88 (4%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGG----PAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPG 652 PP P GG G GG PA GGGG G G GG G GG G Sbjct: 51 PPPPCGGGCGGGGVCGGGGVCAPALPPPPPCGGGGGGCGGGCGGGGGGCGGGGGGCGGGG 110 Query: 651 XXXGGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGGG GGGG Sbjct: 111 GACGGGGGGCGGGGGGCGGGGGGCGGGG 138 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/56 (44%), Positives = 25/56 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 GG G G GG G GG G GGG G G GG GGGG G GGG Sbjct: 121 GGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGGGGGG--CGGG 174 Score = 41.5 bits (93), Expect = 0.026 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG PP GG GGG G GGG A PPPP GGGG G Sbjct: 41 GGCGGGCGPPPPPPCGGGCGGG-----GVCGGGGVCAPALPPPPPCGGGGGGCGGG 91 Score = 41.5 bits (93), Expect = 0.026 Identities = 30/91 (32%), Positives = 30/91 (32%), Gaps = 7/91 (7%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXG-------XXGXGGGGGGXXXXXGXGXFXXFP 517 GG PPPP P G GGGG G GGGG G G G Sbjct: 44 GGGCGPPPPPPCGGGCGGGGVCGGGGVCAPALPPPPPCGGGGGGCGGGCGGGGGGCGGGG 103 Query: 518 XXXGGGGGXXXVXXXXXPPPPPXXGGGGXXC 610 GGGGG GGGG C Sbjct: 104 GGCGGGGGACGGGGGGCGGGGGGCGGGGGGC 134 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G GGGGG G G GGGGG Sbjct: 128 GGGGGGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGGGGG 169 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -1 Query: 691 PPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 PP G GGG G GGGGGG G GGGG G Sbjct: 77 PPPPCGGGGGGCGGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCG 121 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G G GGG GG G G GG GG Sbjct: 132 GGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGGGGGGCGG 173 Score = 35.5 bits (78), Expect = 1.7 Identities = 26/91 (28%), Positives = 29/91 (31%), Gaps = 6/91 (6%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGG--PGX 649 AP G++ PA GG G + P GG GGG G Sbjct: 424 APVESAPAASSYGSSESAAPAAPSGGDYSSSGSSESAAPAAPEPAPSAGGYSGGGSDAGA 483 Query: 648 XXGGG----GGGXXXXXXKXPPPPXXGGGGG 568 GGG GGG P P GGG Sbjct: 484 TSGGGSNYSGGGDASAAAPAPAPAQTYSGGG 514 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGG G A GGGG G Sbjct: 89 GGGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGG 129 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGG G GGGG G Sbjct: 132 GGCGGGGGGGCGGGGGGCGGGGGGCGGGSSGGCGGGGGGCG 172 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGG G G GGGG G Sbjct: 90 GGCGGGGGGCGGGGGGCGGGGGACGGGGGGCGGGGGGCGGG 130 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGG G GGGG G Sbjct: 103 GGGCGGGGGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCG 143 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGG G GGGG G Sbjct: 110 GGACGGGGGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCG 150 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGG G GGGG G Sbjct: 117 GGGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCG 157 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGG G G GGGG G Sbjct: 118 GGCGGGGGGCGGGGGGCGGGGGGGCGGGGGGCGGGGGGCGG 158 >UniRef50_Q4P6X2 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 1859 Score = 58.4 bits (135), Expect = 2e-07 Identities = 27/58 (46%), Positives = 27/58 (46%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP P PPP PP GG A PPP PP P PP P AP P Sbjct: 990 PPPPPPPPPPPPPPMLPPAAGGMSTSQKALLDAAAMPPPPPPPP---PPPPPAPGMMP 1044 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 609 AXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 A P PPPPPP P PPP PP GG Sbjct: 986 ATPPPPPPPPPP--PPPPPPMLPPAAGG 1011 Score = 36.7 bits (81), Expect = 0.75 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 PPPPPP P P PPP PP Sbjct: 988 PPPPPPPPPPPPPPPPMLPP 1007 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPP--PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P G PPPP P PPPPPPP Sbjct: 1000 PPPPMLPPAAGGMSTSQKALLDAAAMPPPPPP-----PPPPPPP 1038 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 722 AXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 A PPPPP PP PP P P PP G Sbjct: 986 ATPPPPPPPP-----PPPPPPPPMLPPAAG 1010 >UniRef50_Q2HGM6 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 238 Score = 58.4 bits (135), Expect = 2e-07 Identities = 58/197 (29%), Positives = 59/197 (29%), Gaps = 6/197 (3%) Frame = -2 Query: 765 PAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPX 586 P GG G G G G PP GGG P GG GGG PP P Sbjct: 46 PGNPPGGGGNAGNPPPAPGGGGNGRPP---APGGGNP---TGGNGGGA-------PPAPG 92 Query: 585 XGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP----- 421 G GGG P P G K PP PPP P P PP P Sbjct: 93 IGNGGG------APDPAGAPGPPGGGGKGGGNGNAGAPPEPPPAPAPPPGAPPAPNGGGG 146 Query: 420 -PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXX 244 P G GGGG P + P P G PP P Sbjct: 147 IPGGRPGMPGMGKGGGG--IPAGKGGIMPGMGGIPGSGGGMPMPPGPPPG--PPGPPPGP 202 Query: 243 PPRXPXTPXXPGGPGXP 193 PP P P P P Sbjct: 203 PPPIPMGPAPGPSPKPP 219 Score = 58.4 bits (135), Expect = 2e-07 Identities = 54/147 (36%), Positives = 54/147 (36%), Gaps = 11/147 (7%) Frame = -2 Query: 822 APPXPXXG--GXXXGAAGXGGPAXGXGGXGGGGGXAXXXG------AXGXXXPPXXGGXG 667 APP P G G AG GP G GG GGG G A A PP G G Sbjct: 87 APPAPGIGNGGGAPDPAGAPGPPGG-GGKGGGNGNAGAPPEPPPAPAPPPGAPPAPNGGG 145 Query: 666 ---GGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXP 496 GG PG G G GG K P GG G P PPP G P Sbjct: 146 GIPGGRPG-MPGMGKGGGGIPAGKGGIMPGMGGIPG-SGGGMPMPPGPPPGPPG-----P 198 Query: 495 XPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPP P P P PPPP Sbjct: 199 PP----GPPPPIPMGPAPGPSPKPPPP 221 Score = 56.8 bits (131), Expect = 7e-07 Identities = 46/147 (31%), Positives = 46/147 (31%), Gaps = 12/147 (8%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPP--XXGGXGGGGPGXX 646 PP P GG A GG G G GGG A G G P G GGGG G Sbjct: 60 PPAPGGGGNGRPPAPGGGNPTG--GNGGGAPPAPGIGNGGGAPDPAGAPGPPGGGGKGGG 117 Query: 645 XGGGGGGXXXXXXKXPPP--PXXGGGGGXXXXXTXXXPPPPPXXXG--------XXXKXP 496 G G PPP P GGG P G Sbjct: 118 NGNAGAPPEPPPAPAPPPGAPPAPNGGGGIPGGRPGMPGMGKGGGGIPAGKGGIMPGMGG 177 Query: 495 XPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P PP P P PPP PPP Sbjct: 178 IPGSGGGMPMPPGPPPGPPGPPPGPPP 204 Score = 50.4 bits (115), Expect = 6e-05 Identities = 38/111 (34%), Positives = 38/111 (34%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG PPP P GGGG G G G GG G P GGG Sbjct: 53 GGNAGNPPPAP---------GGGGNGRPPAPGGGNPTGG-----NGGGAPPAPGIGNGGG 98 Query: 539 GXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG 691 P PP GG G PP PPP P PPP PP G Sbjct: 99 APDPA----GAPGPPGGGGKGGGNGNAGAPPEPPP--APAPPPGAPPAPNG 143 Score = 50.0 bits (114), Expect = 8e-05 Identities = 45/151 (29%), Positives = 45/151 (29%), Gaps = 4/151 (2%) Frame = +2 Query: 380 PPXPXXXXXXFXG---GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXX 550 PP P G GGGG GGGG G G G P GGG Sbjct: 35 PPHPKRNHRFSPGNPPGGGGNAGNPPPAPGGGGNGRPPAPGGGN----PTGGNGGGA--- 87 Query: 551 VXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 PP P G GG P P PGPP G P P Sbjct: 88 -------PPAPGIGNGGGA---------PDPAGAPGPPGGGGKGGGNGNAGAPPEPPPAP 131 Query: 731 PPPPX-PPXPXAGPPXPAAPXXXPPXXGXGG 820 PPP PP P G P P GG Sbjct: 132 APPPGAPPAPNGGGGIPGGRPGMPGMGKGGG 162 Score = 50.0 bits (114), Expect = 8e-05 Identities = 44/157 (28%), Positives = 45/157 (28%), Gaps = 6/157 (3%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG PP P GG GGG G G GGG G P G GG Sbjct: 64 GGGGNGRPPAPGGGNPT---GGNGGGAPPAPGIGNGGGAPDPAGAPGP----PGGGGKGG 116 Query: 539 GXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX---PPXXGGXXXPXA 709 G PPP P G P PG P GG Sbjct: 117 GNGNAGAPPEPPPAPAPPPGAPPAPNGGGGIPGGRPGMPGMGKGGGGIPAGKGGIMPGMG 176 Query: 710 PXXXAX---PPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 + P PP PP P PP P P P G Sbjct: 177 GIPGSGGGMPMPPGPPPGPPGPPPGPPPPIPMGPAPG 213 Score = 47.2 bits (107), Expect = 5e-04 Identities = 45/162 (27%), Positives = 46/162 (28%), Gaps = 9/162 (5%) Frame = +2 Query: 200 PGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX-- 373 PG G GG G GG P G K GG Sbjct: 63 PGGGGNGRPPAPGGGNPTGGNGGGAPPAPGIGNGGGAPDPAGAPGPPGGGGKGGGNGNAG 122 Query: 374 -----PPPPXPXXXXXXFXGGGGG--GGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGG 532 PP P P GGGG GG G G G GGGG G G G Sbjct: 123 APPEPPPAPAPPPGAPPAPNGGGGIPGGRPGMPGMGKGGGGIPAGKG-GIMPGMGGIPGS 181 Query: 533 GGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPG 658 GGG + P PP G P P P PG Sbjct: 182 GGGMP-MPPGPPPGPPGPPPGPPPPIPMGPAPGPSPKPPPPG 222 Score = 37.1 bits (82), Expect = 0.57 Identities = 23/77 (29%), Positives = 23/77 (29%) Frame = +3 Query: 489 GXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 G G P GGGG P G GG P PP PP PPP Sbjct: 146 GIPGGRPGMPGMGKGGGGIPAGKGGIMPGMGGIPGSGGGMPMPPGPPPGPPGPPPGPPPP 205 Query: 669 XXPPXXGGXXXXXXPPG 719 G PPG Sbjct: 206 IPMGPAPGPSPKPPPPG 222 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 58.4 bits (135), Expect = 2e-07 Identities = 40/131 (30%), Positives = 41/131 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P G G PP PP G P P PP PPP P PPPP Sbjct: 435 PPTPPPLPGPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPPP 494 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP G G PP L P PG PPPP Sbjct: 495 PP---PPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMC---PVPPPPPLPRA 548 Query: 240 PRXPXTPXXPG 208 + P P PG Sbjct: 549 GQIPPPPPLPG 559 Score = 57.2 bits (132), Expect = 5e-07 Identities = 31/82 (37%), Positives = 32/82 (39%), Gaps = 5/82 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPP 733 P PPP G G PPPP P PG PPPP PP + PP Sbjct: 436 PTPPPLPGPGATS--PLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPP 493 Query: 734 PPPXPPXPXAGPPXPAAPXXXP 799 PPP PP P G P P P Sbjct: 494 PPPPPPLPGTGAVSPPPPPPLP 515 Score = 56.0 bits (129), Expect = 1e-06 Identities = 29/71 (40%), Positives = 31/71 (43%), Gaps = 7/71 (9%) Frame = +2 Query: 626 PPPPPPXXXPG-------PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAA 784 PP PPP PG PPPP PP G +P PPPP PP P +G P Sbjct: 435 PPTPPPLPGPGATSPLPPPPPPLPPPLPGSGTT-SPPPPPPPPPPLPPPLPGSGTISPPP 493 Query: 785 PXXXPPXXGXG 817 P PP G G Sbjct: 494 PPPPPPLPGTG 504 Score = 51.2 bits (117), Expect = 3e-05 Identities = 34/107 (31%), Positives = 35/107 (32%), Gaps = 16/107 (14%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPG----------PP 664 P G G + P PPP G G PPPP P PG PP Sbjct: 438 PPPLPGPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPPPPPP 497 Query: 665 PPXPPXXGGXXXPXAP------XXXAXPPPPPXPPXPXAGPPXPAAP 787 PP P P P PPPPP PP P P P P Sbjct: 498 PPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPPP 544 Score = 50.0 bits (114), Expect = 8e-05 Identities = 36/108 (33%), Positives = 36/108 (33%), Gaps = 12/108 (11%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPP------XXXPGPPPPXP 676 P G G PP PP G G PPPPPP P PPPP P Sbjct: 459 PPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPP---PPPPPPPLPGTGAVSPPPPPPLP 515 Query: 677 PXXGG----XXXPXAPXXXAXPPPPPXPPXPXAG--PPXPAAPXXXPP 802 P P P PP PP P AG PP P P P Sbjct: 516 SLPDSHKTQPPPPPPPPLPGMCPVPPPPPLPRAGQIPPPPPLPGFSVP 563 Score = 49.6 bits (113), Expect = 1e-04 Identities = 33/114 (28%), Positives = 33/114 (28%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 T PP PP G P P PPP P PPPPPPP G G Sbjct: 431 TPVLPPTPPPLPGPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTIS 490 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXP 211 PP L P PPPP P P P P Sbjct: 491 PPPPPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPPP 544 Score = 49.6 bits (113), Expect = 1e-04 Identities = 28/81 (34%), Positives = 28/81 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G P P P PPP PP P P PPPPP P Sbjct: 494 PPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQPPPPPP-------PPLPGMCPVPPPPPLP 546 Query: 749 PXPXAGPPXPAAPXXXPPXXG 811 PP P P G Sbjct: 547 RAGQIPPPPPLPGFSVPSMMG 567 Score = 48.4 bits (110), Expect = 2e-04 Identities = 28/76 (36%), Positives = 28/76 (36%), Gaps = 2/76 (2%) Frame = -2 Query: 636 GGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPP--PPXXXGXXXKXPXPXXXXXPPPP 463 G G PP P G G PPP PP G P P PPPP Sbjct: 443 GPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPP-----PPPP 497 Query: 462 PPXPXXPXXPPPPPPP 415 PP P PPPPPP Sbjct: 498 PPLPGTGAVSPPPPPP 513 Score = 47.2 bits (107), Expect = 5e-04 Identities = 27/69 (39%), Positives = 28/69 (40%), Gaps = 5/69 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG-----PPXPAAPX 790 P PP P PP PP G P A PPPP PP P +G PP P P Sbjct: 423 PTPPLSSSTPVLPPTPPPLPG----PGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPP 478 Query: 791 XXPPXXGXG 817 PP G G Sbjct: 479 LPPPLPGSG 487 Score = 46.8 bits (106), Expect = 7e-04 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 8/82 (9%) Frame = -2 Query: 636 GGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXP--------XXX 481 G G PPPP G PPPPP P P Sbjct: 463 GSGTTSPPPPPPPPPPLPPPLPGSGTISPPPPPPPPPLPGTGAVSPPPPPPLPSLPDSHK 522 Query: 480 XXPPPPPPXPXXPXXPPPPPPP 415 PPPPPP P P PPPPP Sbjct: 523 TQPPPPPPPPLPGMCPVPPPPP 544 Score = 43.6 bits (98), Expect = 0.007 Identities = 25/77 (32%), Positives = 26/77 (33%), Gaps = 6/77 (7%) Frame = +3 Query: 513 SPXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXP------XPPPXX 674 +P G G P P PP G G P PPPP P P PPP Sbjct: 437 TPPPLPGPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPPPPP 496 Query: 675 PPXXGGXXXXXXPPGXP 725 PP G PP P Sbjct: 497 PPPLPGTGAVSPPPPPP 513 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 9/65 (13%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP-PPP--------PXXXPXPPPXXPPXXGGXXXXXX 710 P P PP G G P PP PPP P P PPP PP G Sbjct: 432 PVLPPTPPPLPGPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISP 491 Query: 711 PPGXP 725 PP P Sbjct: 492 PPPPP 496 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/69 (33%), Positives = 24/69 (34%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G + PPPP G PPPPP P PPPPP Sbjct: 487 GTISPPPPPPPP-----PLPGTGAVSPPPPP----PLPSLPDSHKTQPPPPPPPPLPGMC 537 Query: 439 XTPPPPPPP 413 PPPPP P Sbjct: 538 PVPPPPPLP 546 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 7/62 (11%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPP-------PPPPPXXXXXXXXXX 384 +PPPPP P PPP P PP PPPPP Sbjct: 507 SPPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPPPLPRAGQIPPPPPLPGFSVPSMM 566 Query: 383 GG 378 GG Sbjct: 567 GG 568 >UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep: Protein enabled homolog - Homo sapiens (Human) Length = 591 Score = 58.4 bits (135), Expect = 2e-07 Identities = 29/69 (42%), Positives = 30/69 (43%), Gaps = 3/69 (4%) Frame = +2 Query: 569 PPPPPXXGG---GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G PPPPPP GPPPP PP P PPPP Sbjct: 314 PPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPP------PPLPNQVPPPPPPP 367 Query: 740 PXPPXPXAG 766 P PP P +G Sbjct: 368 PAPPLPASG 376 Score = 53.2 bits (122), Expect = 8e-06 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 3/60 (5%) Frame = +2 Query: 629 PPPPPXXXPGPPPPX---PPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP PGP PP G P P PPPPP PP P PP P P P Sbjct: 313 PPPPPPLPPGPAQASVALPPPPGPPPPPPLPST-GPPPPPPPPPLPNQVPPPPPPPPAPP 371 Score = 50.4 bits (115), Expect = 6e-05 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G P PPP P P PPPPPP P P PPPP Sbjct: 314 PPPPPLPPGPAQASVALPPPPGPPP---------PPPLPSTGPPPPPPPPPLPNQVPPPP 364 Query: 420 PP 415 PP Sbjct: 365 PP 366 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/69 (36%), Positives = 25/69 (36%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPPP G PPPP P P PPPPP Sbjct: 309 GPLAPPPPPPLPPGPAQASVALPPPPGPPPP---------PPLPSTGPPPPPPPPPLPNQ 359 Query: 439 XTPPPPPPP 413 PPPPPPP Sbjct: 360 VPPPPPPPP 368 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX-PXXPPPP 424 PPPP G PP PP P P PPPPPP P P PPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPP-----PPPPPPLPNQVPPPPPPP 367 Query: 423 PPP 415 P P Sbjct: 368 PAP 370 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP G P PPPPP PPPPPPP Sbjct: 314 PPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPP 355 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 APPPPP + P PPPP L PPPPPPP Sbjct: 312 APPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPP 354 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 3/59 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXX---PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G + P PPPPPP PPP PP PP P Sbjct: 310 PLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPP 368 Score = 40.3 bits (90), Expect = 0.061 Identities = 25/67 (37%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX-----PXXPXX 436 PPPP G + PPPP G P P PPPPPP P P Sbjct: 315 PPPPLPPGPA----QASVALPPPP----GPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPP 366 Query: 435 PPPPPPP 415 PP PP P Sbjct: 367 PPAPPLP 373 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P G P PPPP G P PPPPPP PPP PP Sbjct: 318 PLPPGPAQASVALPPPPGPPPPPPLPSTG-----PPPPPPPPPLPNQVPPPPPPP 367 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +2 Query: 662 PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP---PXPAAPXXXPPXXGXG 817 P P G P AP PPPPP PP P P P P PP G Sbjct: 297 PAETPSQQGIVLGPLAP-----PPPPPLPPGPAQASVALPPPPGPPPPPPLPSTG 346 >UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n=2; Rattus norvegicus|Rep: UPI0000DC1448 UniRef100 entry - Rattus norvegicus Length = 319 Score = 58.0 bits (134), Expect = 3e-07 Identities = 31/86 (36%), Positives = 32/86 (37%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP-PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-- 739 PP PP PP PPPP P PP P PP P P + PPPP Sbjct: 111 PPSPPSPPPPPPPLPPSPSPPSPPPPSPPPLPPSPSPPSLSSPLPPSPPSLSSPPPPPSP 170 Query: 740 -----PXPPXPXAGPPXPAAPXXXPP 802 P PP P P P P PP Sbjct: 171 SSLSSPLPPPPPLSPSPPPPPPPPPP 196 Score = 53.6 bits (123), Expect = 6e-06 Identities = 24/63 (38%), Positives = 25/63 (39%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PP PP P PPPP P P P + PPPPP P Sbjct: 136 PSPPPLPPSPSPPSLSSPLPPSPPSLSSP-PPPPSPSSLSSPLPPPPPLSPSPPPPPPPP 194 Query: 749 PXP 757 P P Sbjct: 195 PPP 197 Score = 52.4 bits (120), Expect = 1e-05 Identities = 29/80 (36%), Positives = 32/80 (40%), Gaps = 9/80 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXP-- 730 PPPPP PPP PP P P PP PP P +P + P Sbjct: 119 PPPPPLPPSPSPPSPPPPSPPPLPPSPSPPSLSSPLPPSPPSLSSPPPPPSPSSLSSPLP 178 Query: 731 -PPP--PXPPXPXAGPPXPA 781 PPP P PP P PP P+ Sbjct: 179 PPPPLSPSPPPPPPPPPPPS 198 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP + P PP P PPPPP P P PPPPP Sbjct: 136 PSPPPLPPSPSPPSLSSPLPPSPPSLSSPPPPPSPSSLSSPLPPPPPLSPSPPPPPPPPP 195 Query: 420 PP 415 PP Sbjct: 196 PP 197 Score = 42.7 bits (96), Expect = 0.011 Identities = 29/97 (29%), Positives = 29/97 (29%), Gaps = 1/97 (1%) Frame = -2 Query: 498 PXPXXXXXPPPP-PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXX 322 P P PPPP PP P P PPP PPP PP Sbjct: 112 PSPPSPPPPPPPLPPSPSPPSPPPPSPPPLPPSPSPPSLSSPLPPSPPSL---------- 161 Query: 321 XXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXP 211 P P PPPP PP P P P Sbjct: 162 -SSPPPPPSPSSLSSPLPPPPPLSPSPPPPPPPPPPP 197 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PP P PP PP PPPPP PPPP Sbjct: 135 PPSPPPLPPSPSPPSLSSPLPPSPPSLSSPPPPPSPSSLSSPLPPPPPLSPSPPPPPPPP 194 Query: 421 PPP 413 PPP Sbjct: 195 PPP 197 Score = 38.3 bits (85), Expect = 0.25 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 Query: 491 PXXXPXPPPPPXXLXXXXNPPPPPPP 414 P P PPPPP L +PP PPPP Sbjct: 111 PPSPPSPPPPPPPLPPSPSPPSPPPP 136 Score = 35.9 bits (79), Expect = 1.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PP P P P PP PP Sbjct: 118 PPPPPPLPPSPSPPSPPPPSPPPLPPSPSPPSLSSPLPPSPP 159 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPP PP P PP P PP P Sbjct: 115 PSPPPPPPPLPPSPSPPSPPPPSPPPLPP--SPSPPSLSSPLPPSPPSLSSPPPPP 168 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P P PP +P PP PP Sbjct: 117 PPPPPPPLPPSPSPPSPPPPSPPPLPPSPSPPSLSSPLPPSPP 159 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP P P P P PP P PPPPP P Sbjct: 130 PPSPPPPSPPPLPPSPSPPSLSSPLPPSPPSLSSPPPPPSP 170 Score = 33.9 bits (74), Expect = 5.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 707 APXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 +P PPPPP P P PP P P P Sbjct: 110 SPPSPPSPPPPPPPLPPSPSPPSPPPPSPPP 140 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP----PPPP 415 PP PP P PPPP P P P PP P PP Sbjct: 111 PPSPPSPPPPPPPLPPSPSPPSPPPPSPPPLPPSPSPPSLSSPLPP 156 Score = 33.1 bits (72), Expect = 9.3 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 490 PXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPPPP +PP PPPP Sbjct: 111 PPSPPSPPPPPPPLPPSPSPPSPPPP 136 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P P PPPP P PP PP Sbjct: 114 PPSPPPPPP------PLPPSPSPPSPPPPSPPPLPPSPSPP 148 >UniRef50_UPI0000F30DFE Cluster: UPI0000F30DFE related cluster; n=1; Bos taurus|Rep: UPI0000F30DFE UniRef100 entry - Bos Taurus Length = 591 Score = 58.0 bits (134), Expect = 3e-07 Identities = 25/59 (42%), Positives = 28/59 (47%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP P PP P PP P +P P PPP PP PP P++P PP Sbjct: 331 PRPPPPSPQPPPPSPPPPPSSPSSPPPSPPQPLPPSPPPSPPPSL--PPPPSSPSSPPP 387 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPP P P PPP PP P P PP PPP Sbjct: 333 PPPPSPQPPPPSPPPPPSSPSSPPPSPPQPLPPSPPPSPPP 373 Score = 41.9 bits (94), Expect = 0.020 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 5/63 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-----XPPXPXAGPPXPAAPX 790 PP PP P P PP P P PPPP PP P PP AP Sbjct: 501 PPTPPQALSPPEPADTPPGAQAPEGPPTPPQALRPPPPTPPQALSPPEPADTPPGAQAPE 560 Query: 791 XXP 799 P Sbjct: 561 GPP 563 Score = 41.5 bits (93), Expect = 0.026 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 3/88 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P P P PP P PPP PP P P A P P Sbjct: 341 PPPSPPPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPPPPSSPSSP-PPSINAHPSPSMPA 399 Query: 749 ---PXPXAGPPXPAAPXXXPPXXGXGGA 823 PP P + PP GA Sbjct: 400 TLISLQPESPPLPGSAVASPPRAPPPGA 427 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 + P P PP PPP P P PPP PP Sbjct: 332 RPPPPSPQPPPPSPPPPPSSPSSPPPSPP 360 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P PP PPP P P PPPP P Sbjct: 342 PPSPPPPPSSPSSPPPSPPQPLPPSPPPSPP-PSLPPPPSSP 382 Score = 38.7 bits (86), Expect = 0.19 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP-XPXXPXXPPPPPP 418 PPPP P P PP PPP P P P PPP Sbjct: 346 PPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPPPPSSPSSPPP 387 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P P PPP P P P PPP P Sbjct: 333 PPPPSPQPPPPSPPPPPSS--PSSPPPSPPQPLPPSPPPSP 371 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP-PPXXXPXPPPXXPP 680 P PPPP + P PP P PP P PPP PP Sbjct: 336 PSPQPPPPSPPPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPP 377 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPX-APXXXAXPPPPPXPPXPXAGP-PXPAAPXXXPP 802 PP P PPPP PP P P P PP PP P P AAP P Sbjct: 526 PPTPPQALRPPPPTPPQALSPPEPADTPPGAQAPEGPPTPPQALRPPDPANAAPGAQSP 584 Score = 37.1 bits (82), Expect = 0.57 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 3/78 (3%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-PPPXPPX 754 PP PP PP P P G P P PP P PP Sbjct: 460 PPEPANAAPGAQPPEGPPTPPQALRPPRARRRRPRRSGPQTPPTPPQALSPPEPADTPPG 519 Query: 755 PXA--GPPXPAAPXXXPP 802 A GPP P PP Sbjct: 520 AQAPEGPPTPPQALRPPP 537 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PP PP + P PPP Sbjct: 345 PPPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPPPPSSPSSPPP 387 Score = 36.7 bits (81), Expect = 0.75 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXP--AAPXXXP 799 PP PP P P P PP P A PP P P PP P AAP P Sbjct: 419 PPRAPPPGAPLPQLPSPP------DPANAAPGAQPPEGPPTPPQALSPPEPANAAPGAQP 472 Query: 800 P 802 P Sbjct: 473 P 473 Score = 35.1 bits (77), Expect = 2.3 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PP--PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXX--PXAPXXXAXPPP 736 PP PPP P P P P PP G P AP A P Sbjct: 372 PPSLPPPPSSPSSPPPSINAHPSPSMPATLISLQPESPPLPGSAVASPPRAPPPGAPLPQ 431 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 P PP P P A P PP Sbjct: 432 LPSPPDPANAAPG-AQPPEGPP 452 Score = 34.7 bits (76), Expect = 3.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPP 418 P PPPP P P PPPPP Sbjct: 331 PRPPPPSPQPPPPSPPPPP 349 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP--PPPP 415 P PPP P P P PP P P PPP PPPP Sbjct: 338 PQPPPPSPPPPPSSPSSPPPSPPQPLPPSP--PPSPPPSLPPPP 379 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPP-PPXXLXXXXNPPPPPPP 414 +PPPPP P PPP PP L + P PPP Sbjct: 344 SPPPPPSSPSSPPPSPPQPLPPSPPPSPPPSLPPPPSSPSSPPP 387 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXP--PPPPPP 415 K P P PPPP P P P PPP PP Sbjct: 329 KPPRPPPPSPQPPPPSPPPPPSSPSSPPPSPP 360 Score = 34.3 bits (75), Expect = 4.0 Identities = 24/72 (33%), Positives = 25/72 (34%), Gaps = 7/72 (9%) Frame = +2 Query: 629 PPPPPXXXPGPP----PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA--GPPXPAAPX 790 PP P PG PP PP P P + P P PP A GPP P Sbjct: 510 PPEPADTPPGAQAPEGPPTPPQALRPPPPTPPQALSPPEPADTPPGAQAPEGPPTPPQAL 569 Query: 791 XXP-PXXGXGGA 823 P P GA Sbjct: 570 RPPDPANAAPGA 581 Score = 33.1 bits (72), Expect = 9.3 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP-XXXAXPPPPPXP 748 P P G PP P P PP P G P A PP P Sbjct: 406 PESPPLPGSAVASPPRAPPPGAPLPQLPSPPDPANAAPGAQPPEGPPTPPQALSPPEPAN 465 Query: 749 PXPXAGPP-XPAAP 787 P A PP P P Sbjct: 466 AAPGAQPPEGPPTP 479 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 58.0 bits (134), Expect = 3e-07 Identities = 26/57 (45%), Positives = 26/57 (45%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPP PPPP PP G P P PPPPP P P PP P A P Sbjct: 82 PPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPPGPGAP---PPPPGAKKAAP 135 Score = 51.2 bits (117), Expect = 3e-05 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPPPPP PPPP PP GG P P PPPPP Sbjct: 82 PPPPPPP---------RMAPPPPPPPAGGMPPPPPPPMGGG--APPPPPGPGAPPPPP 128 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPPP G P P PPPPP P P PPPP Sbjct: 92 PPPPPPPAGGMPPPPPPPMGGGAPPPPPGPGAP--PPPP 128 Score = 44.4 bits (100), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T P PPP P P PPPPP P PPPPP P Sbjct: 76 TSSKPAPPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPPGP 121 Score = 42.3 bits (95), Expect = 0.015 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP-XPXXPXXPP----PPPPP 415 PPPPP P P PPPPPP P PP PPPPP Sbjct: 82 PPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPPGPGAPPPPP 128 Score = 41.1 bits (92), Expect = 0.035 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P P PPPPP P PPPPPPP G G PP Sbjct: 83 PPPPPPRMAPPPPPPPAG-GMPPPPPPPMGGGAPPPPPGPGAPPPPP 128 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PPPP P PPPPPP GGG PP Sbjct: 80 PAPPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPP 118 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPP P PPPPP GGG PP Sbjct: 82 PPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGGAPPPPP 119 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPP P P PPPPP PPPPP P Sbjct: 80 PAPPPPPPPRMAPPPPPPPAGGMPPPPPPPMGGG-APPPPPGP 121 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPPPP P PPP P GG PP Sbjct: 80 PAPPPPPPPRMAPPPPP---PPAGGMPPPPPPP 109 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP GG PPPPPP PPP PP G PPG Sbjct: 88 PRMAPPPPPPPAGG-------MPPPPPPPMGGGAPPP--PPGPGA---PPPPPG 129 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPP 420 APPPPP G P PPPP PPPPP Sbjct: 91 APPPPPPPAGGMPPPPPPPMGGGAPPPP---PGPGAPPPPP 128 Score = 34.3 bits (75), Expect = 4.0 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPPXXXXXXXXXXGGGGXXX 363 APPPPP P P PPPPP PPPPPP G G Sbjct: 81 APPPPPP----------PRMAPPPPPPPAG-----GMPPPPPPPMGGGAPPPPPGPGAPP 125 Query: 362 P 360 P Sbjct: 126 P 126 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 PPPPP P PP PA PP GG Sbjct: 82 PPPPPPPRMAPPPPPPPAGGMPPPPPPPMGG 112 >UniRef50_Q9SXE7 Cluster: T3P18.6; n=2; core eudicotyledons|Rep: T3P18.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 297 Score = 58.0 bits (134), Expect = 3e-07 Identities = 50/148 (33%), Positives = 50/148 (33%), Gaps = 5/148 (3%) Frame = +2 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 P PP P GGGGGGG GG GGG G G P GGGGG Sbjct: 33 PHPPVPKPPQH---GGGGGGGSKPPPHHGGKGGGKPPPHG-GKGGGPPHHGGGGGGGGKS 88 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPP---PPPXXXPGPPPPXPPXXGGXXXPXAPXXXA 724 PPP PPP PPP P PP PP P P Sbjct: 89 PPVVRPPPVVVRP------PPIIRPPPVVYPPPIVRP-PPITRPPI---IIPPIQPPPVT 138 Query: 725 XPPP--PPXPPXPXAGPPXPAAPXXXPP 802 PP PP P PP P PP Sbjct: 139 TPPGLLPPITTPPGLLPPVTTPPGLLPP 166 Score = 55.2 bits (127), Expect = 2e-06 Identities = 37/117 (31%), Positives = 38/117 (32%) Frame = -2 Query: 765 PAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPX 586 P GG GGG G G PP GG GGG P GGGGGG + PP Sbjct: 40 PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPP--- 96 Query: 585 XGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P PP P PPP P Sbjct: 97 -------------VVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPPVTTP 140 Score = 46.4 bits (105), Expect = 0.001 Identities = 31/101 (30%), Positives = 32/101 (31%) Frame = -1 Query: 715 GGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPP 536 GG PP G GGG GG GGG PP GGGG PP Sbjct: 45 GGGGGGSKPPPHHGGKGGGKPPPHGGKGGG---------PPHHGGGGGGGGKSPPVVRPP 95 Query: 535 PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P + P PPP PP PPP Sbjct: 96 PVVVRPPPIIRPPPVVYPPPIVRPPPITRPPIIIPPIQPPP 136 Score = 37.9 bits (84), Expect = 0.33 Identities = 32/101 (31%), Positives = 32/101 (31%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GGGGGGG G GGG P GG GG PP G Sbjct: 44 GGGGGGGSKPPPHHGGKGGG-------------KPPPHGGKGGG----------PPHHGG 80 Query: 594 GGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 GGG P PPP P P PP PP Sbjct: 81 GGGGGGKSPPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPP 121 >UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 450 Score = 58.0 bits (134), Expect = 3e-07 Identities = 33/86 (38%), Positives = 33/86 (38%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP-----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G PP PP P P PP P P P A P Sbjct: 278 PPPPPAPGAAPPPPKPAAAPPAAKPAPPKPAARPPPPAAKPTPPPPAAKPAPPPPRAAAP 337 Query: 734 PPPXPPXPXAGPPXP---AAPXXXPP 802 PPP PP A PP P AAP PP Sbjct: 338 PPPPPPAAAAPPPPPPPMAAPPPPPP 363 Score = 57.6 bits (133), Expect = 4e-07 Identities = 33/83 (39%), Positives = 33/83 (39%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP--- 739 PPPPP PPPPP PPPP P P P A PPPP Sbjct: 268 PPPPPVAAAA----------PPPPPAPGAAPPPPKPAAAPPAAKPAPPKPAARPPPPAAK 317 Query: 740 PXPPXPXA--GPPXPAAPXXXPP 802 P PP P A PP P A PP Sbjct: 318 PTPPPPAAKPAPPPPRAAAPPPP 340 Score = 53.2 bits (122), Expect = 8e-06 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 7/79 (8%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP---PPPPXXXPGPPP----PXPPXXGGXXXPXAPXXXAXP 730 PPPP P PPPP P PPP P PP P P A Sbjct: 288 PPPPKPAAAPPAAKPAPPKPAARPPPPAAKPTPPPPAAKPAPPPPRAAAPPPPPPPAAAA 347 Query: 731 PPPPXPPXPXAGPPXPAAP 787 PPP PP P A PP P P Sbjct: 348 PPP--PPPPMAAPPPPPPP 364 Score = 46.0 bits (104), Expect = 0.001 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG 766 P PPP PPPP PP P P A PPPPP P +G Sbjct: 327 PAPPPPRAAAPPPPPPP--AAAAPPPPPPPMAAPPPPPPPSKSKSG 370 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP----XXP 433 PPPP G P P + P P PPPP P P P Sbjct: 278 PPPPPAPGAAPPPPKPAAAPPAAKPAPPKPAARPPPPAAKPTPPPPAAKPAPPPPRAAAP 337 Query: 432 PPPPPP 415 PPPPPP Sbjct: 338 PPPPPP 343 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PPPPPP PPPPPPP Sbjct: 327 PAPPPPRAAAPPPPPPPAAAAPPPPPPPM----AAPPPPPPP 364 Score = 41.9 bits (94), Expect = 0.020 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX---PXXPXXPP 430 PPPP PPPP P P PPPP P P P Sbjct: 268 PPPPPVAAAAPPPPPAPGAAPPPPKPAAAPPAAKPAPPKPAARPPPPAAKPTPPPPAAKP 327 Query: 429 PPPPP 415 PPPP Sbjct: 328 APPPP 332 Score = 40.3 bits (90), Expect = 0.061 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 6/68 (8%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP------PPPPXPXXPX 439 PP P PPPP P P PP PPPP P Sbjct: 290 PPKPAAAPPAAKPAPPKPAARPPPP---AAKPTPPPPAAKPAPPPPRAAAPPPPPPPAAA 346 Query: 438 XPPPPPPP 415 PPPPPPP Sbjct: 347 APPPPPPP 354 Score = 38.3 bits (85), Expect = 0.25 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPP-XPXXPXXPPP---PPPPXXXXXXXXGXG 382 PPPP P P PPPPPP P PPP PPPP G G Sbjct: 320 PPPP---AAKPAPPPPRAAAPPPPPPPAAAAPPPPPPPMAAPPPPPPPSKSKSGGG 372 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG 691 PPPPP PPPPP P PPPP GG Sbjct: 337 PPPPPPPAAAAPP------PPPPPMAAPPPPPPPSKSKSGG 371 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP PPPPPP PPP PP Sbjct: 314 PAAKPTPPPPAAKPAPPPPRAAAPPPPPPPAAAAPPPPPPP 354 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPP---PPXXXXXX 440 A PPPP G P P + P PPP P Sbjct: 275 AAAPPPPPAPGAAPPPPKPAAAPPAAKPAPPKPAARPPPPAAKPTPPPPAAKPAPPPPRA 334 Query: 439 XTPPPPPPP 413 PPPPPPP Sbjct: 335 AAPPPPPPP 343 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 3/69 (4%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP---PXXXXXX 440 A PPP G PP + P P PPPP P Sbjct: 274 AAAAPPPPPAPGAAPPPPKPAAAPPAAKPAPPKPAARPPPPAAKPTPPPPAAKPAPPPPR 333 Query: 439 XTPPPPPPP 413 PPPPPP Sbjct: 334 AAAPPPPPP 342 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 P PP PPPPP P P PPPPP Sbjct: 318 PTPPPPAAKPAPPPPRAAAPPPPPPPAAAAPPPPPPPMAAPPPPPPP 364 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 5/61 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP-----PPPXXXPXPPPXXPPXXGGXXXXXXPPGX 722 P P PP A P PPP PPP PPP PP P Sbjct: 298 PAAKPAPPKPAARPPPPAAKPTPPPPAAKPAPPPPRAAAPPPPPPPAAAAPPPPPPPMAA 357 Query: 723 P 725 P Sbjct: 358 P 358 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPP-----PPXPPXPXAGPPXPAAPXXXPP 802 PG P AP PPP PP PP P A PP P P PP Sbjct: 245 PGALPQPSSFNTSELNDIAPTTLPPPPPVAAAAPPPPPAPGAAPP-PPKPAAAPP 298 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPP--PPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P P PPPP P PPP PP P Sbjct: 284 PGAAPPPPKPAAAPPAAKPAPPKPAARPPPPAAKPTPPPPAAKPAPPPPRAAAPPPPP 341 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 58.0 bits (134), Expect = 3e-07 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 6/79 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP------GPPPPXPPXXGGXXXPXAPXXXAXP 730 PPPPP PPPPPP P PPPP PP P A P Sbjct: 596 PPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPP-----PPGGKTGAPP 650 Query: 731 PPPPXPPXPXAGPPXPAAP 787 PPPP P GPP P P Sbjct: 651 PPPPPPGAKAGGPPPPPPP 669 Score = 58.0 bits (134), Expect = 3e-07 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 7/84 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP PPPPPP PG PPPP PP P P PP Sbjct: 614 PPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPP-----PP 668 Query: 734 PP--PXPPXPXAGPPXPAAPXXXP 799 PP PP P A P P P P Sbjct: 669 PPGGKAPPLPNAKPAVPTKPKCQP 692 Score = 56.8 bits (131), Expect = 7e-07 Identities = 34/92 (36%), Positives = 35/92 (38%), Gaps = 8/92 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP------XPPXXGGXXXPXAPXXXAXP 730 PPP P PPPPP P PPPP PP P + A P Sbjct: 574 PPPNPTDNITTVQAAPQKAAPPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPP 633 Query: 731 PPPPXPPXP--XAGPPXPAAPXXXPPXXGXGG 820 PPPP PP P G P P P PP GG Sbjct: 634 PPPPPPPPPGGKTGAPPPPPP---PPGAKAGG 662 Score = 48.8 bits (111), Expect = 2e-04 Identities = 28/75 (37%), Positives = 28/75 (37%), Gaps = 13/75 (17%) Frame = +2 Query: 626 PPPPPPXXXPG------PPPPXPPXXGGXXXPXAPXXXAXPPPPPX-------PPXPXAG 766 PPPPPP P PPPP PP AP PPPPP PP P G Sbjct: 598 PPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPG 657 Query: 767 PPXPAAPXXXPPXXG 811 P PP G Sbjct: 658 AKAGGPPPPPPPPGG 672 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP G P PPPPPP PPPPP Sbjct: 616 PPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPP-------PPPPPPGAKAGGPPPPPP 668 Query: 420 PP 415 PP Sbjct: 669 PP 670 Score = 47.6 bits (108), Expect = 4e-04 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP A P PPPPPP PP PP G PP P Sbjct: 614 PPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPP 669 Score = 47.6 bits (108), Expect = 4e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP G P PPPPPP PPPPP Sbjct: 615 PPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAP-------PPPPPPPGAKAGGPPPPP 667 Query: 420 PP 415 PP Sbjct: 668 PP 669 Score = 47.2 bits (107), Expect = 5e-04 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 7/80 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP-------XXXAX 727 PPPPP PPPPPP PP P P P Sbjct: 595 PPPPPPPPPPPPPSAKSQVPPPPPP------PPSVPKSTNNSAPPPPPPPPPPPGGKTGA 648 Query: 728 PPPPPXPPXPXAGPPXPAAP 787 PPPPP PP AG P P P Sbjct: 649 PPPPPPPPGAKAGGPPPPPP 668 Score = 47.2 bits (107), Expect = 5e-04 Identities = 30/85 (35%), Positives = 31/85 (36%), Gaps = 4/85 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP----XXP 433 PPPP + PPPPP P PPPPPP P P P Sbjct: 595 PPPPPPPPPPPPPSAKSQVPPPPPPPP-----SVPKSTNNSAPPPPPPPPPPPGGKTGAP 649 Query: 432 PPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPPP G GG PP Sbjct: 650 PPPPPP-------PGAKAGGPPPPP 667 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PPPPP P PPPPP P Sbjct: 592 AAPPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPP 651 Query: 430 PPPPP 416 PPPPP Sbjct: 652 PPPPP 656 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP PPPPP PPPP Sbjct: 594 PPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPP 653 Query: 421 PPP 413 PPP Sbjct: 654 PPP 656 Score = 45.2 bits (102), Expect = 0.002 Identities = 23/62 (37%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPPPP P PPPPPP P PPPP Sbjct: 614 PPPPPPPPSVPKSTNNSAPPPPPPPPP-------PPGGKTGAPPPPPPPPGAKAGGPPPP 666 Query: 420 PP 415 PP Sbjct: 667 PP 668 Score = 44.8 bits (101), Expect = 0.003 Identities = 23/66 (34%), Positives = 24/66 (36%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PPPPP + P PPPPP P Sbjct: 593 APPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPP---PPPPPPPGGKTGAP 649 Query: 430 PPPPPP 413 PPPPPP Sbjct: 650 PPPPPP 655 Score = 44.8 bits (101), Expect = 0.003 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 PPPPP P P PPPPP PPPPPP Sbjct: 616 PPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPP 656 Score = 44.4 bits (100), Expect = 0.004 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP P PPPPP PPPPPPP Sbjct: 614 PPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPP 655 Score = 43.6 bits (98), Expect = 0.007 Identities = 34/119 (28%), Positives = 34/119 (28%), Gaps = 6/119 (5%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXX----PPPPPPPXXXXXXXXGXGGGG 373 PP P P PPPPPP P P PPPPPPP Sbjct: 575 PPNPTDNITTVQAAPQKAAPPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPP 634 Query: 372 XXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXX--XXPPRXPXTPXXPGGP 202 PP P PG G PPPP PP P P P Sbjct: 635 PPPPPP-----PPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGGKAPPLPNAKPAVPTKP 688 Score = 43.2 bits (97), Expect = 0.009 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PP P PPPPPPP Sbjct: 598 PPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPP 639 Score = 42.7 bits (96), Expect = 0.011 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 6/62 (9%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXX------PXPPPXXPPXXGGXXXXXXPPG 719 P PPPP + P PPPPP P PPP PP GG PP Sbjct: 594 PPPPPPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPP 653 Query: 720 XP 725 P Sbjct: 654 PP 655 Score = 39.5 bits (88), Expect = 0.11 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP---XXGGXXXXXXPPG 719 P PPP P PPPPP PPP PP GG PPG Sbjct: 615 PPPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPG 671 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 G PP P AP A PPPPP PP PP P+A PP Sbjct: 571 GSEPPPNPTDNITTVQAAPQKAAPPPPPPPPPP----PPPPSAKSQVPP 615 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 P PPPP GG P PPPPPP PP PP GG Sbjct: 635 PPPPPPPP-----GGKTGAPP--PPPPPPGAKAGGPPPPPPPPGG 672 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPP P P PP Sbjct: 618 PPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGGKAPPL 677 Query: 420 P 418 P Sbjct: 678 P 678 Score = 37.5 bits (83), Expect = 0.43 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG G PPPP G P P PP P P P P P Sbjct: 637 PPPPPPGGKTGAPPPP----PPPPGAKAGGPPPPPPPPGGKAPPLPNAKPAVPTKPKCQP 692 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 541 PPPPPXXX-----GEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P K P PPPPP PPPPPPP Sbjct: 574 PPPNPTDNITTVQAAPQKAAPPPPPPPPPPPPPPSAKSQVPPPPPPPP 621 >UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2; Aspergillus|Rep: Contig An08c0110, complete genome - Aspergillus niger Length = 384 Score = 58.0 bits (134), Expect = 3e-07 Identities = 29/70 (41%), Positives = 29/70 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PPP PP P AP PPPPP Sbjct: 175 PPPPPV---STRKPSAPAPPPPPPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPPP-- 229 Query: 749 PXPXAGPPXP 778 P A P P Sbjct: 230 --PGASAPQP 237 Score = 55.6 bits (128), Expect = 2e-06 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA--PXXXAXPPPPP 742 PPPPP PPPPPP P PP A A PPPPP Sbjct: 205 PPPPPASAPRPPPAPSRSTPPPPPPPGASAPQPPNGTAAASIAVQAARNALGHAPPPPPP 264 Query: 743 XPPXPXA-GPPXPAAPXXXPP 802 P A PP P+AP PP Sbjct: 265 AASAPAAPPPPPPSAPPVAPP 285 Score = 51.6 bits (118), Expect = 2e-05 Identities = 31/91 (34%), Positives = 32/91 (35%), Gaps = 6/91 (6%) Frame = +2 Query: 569 PP--PPPXXGGGGXXCXXXXXPPPPP----PXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 PP PPP G PPPPP P PPPP PP P P + P Sbjct: 161 PPRAPPPLPGSA-------KGPPPPPVSTRKPSAPAPPPPPPPSASPAAPPPPPPPASAP 213 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PPP P PP P P G A Sbjct: 214 RPPPAPSRSTPPPPPPPGASAPQPPNGTAAA 244 Score = 50.4 bits (115), Expect = 6e-05 Identities = 28/86 (32%), Positives = 29/86 (33%), Gaps = 1/86 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PP P P PPP P P A P PP P Sbjct: 147 PPPRPPATESAPDAPPRAPPPLPGSAKGPPPPPVSTRKPSAPAPPPPPPPSASPAAPPPP 206 Query: 749 PXPXAGP-PXPAAPXXXPPXXGXGGA 823 P P + P P PA PP GA Sbjct: 207 PPPASAPRPPPAPSRSTPPPPPPPGA 232 Score = 47.6 bits (108), Expect = 4e-04 Identities = 23/63 (36%), Positives = 24/63 (38%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 K PPPP + PPPPP P P P PPP P PPP Sbjct: 173 KGPPPPPVS-----TRKPSAPAPPPPPPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPP 227 Query: 426 PPP 418 PPP Sbjct: 228 PPP 230 Score = 46.4 bits (105), Expect = 0.001 Identities = 36/132 (27%), Positives = 36/132 (27%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP G G PPPPP K P PPPPPP P PPPPPP Sbjct: 165 PPPLPGSAKG---------PPPPPVST---RKPSAPA----PPPPPPPSASPAAPPPPPP 208 Query: 417 PXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP 238 P PP G PPPP Sbjct: 209 PASAPRPPPAPSRSTPPPPPPPGASAPQPPNGTAAASIAVQAARNALGHAPPPPPPAASA 268 Query: 237 RXPXTPXXPGGP 202 P P P Sbjct: 269 PAAPPPPPPSAP 280 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP----PPXPPXPXAGPPXPAA 784 PPPPP P PPP PP P P P P PP P P P+A Sbjct: 260 PPPPPAASAPAAPPPPPPSAPPVAPPSEPLSRPSPLPSAIAPPPPHQPDRSTLDPSA 316 Score = 40.7 bits (91), Expect = 0.046 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 PPPPPP P PPPPPPP Sbjct: 4 PPPPPPPPGGMGGPPPPPPP 23 Score = 39.1 bits (87), Expect = 0.14 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 10/69 (14%) Frame = +2 Query: 626 PPPPPPXXXPGPP--------PP--XPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPX 775 P PP P PP PP PP G P P P P PP P Sbjct: 140 PKPPGARPPPRPPATESAPDAPPRAPPPLPGSAKGPPPPPVSTRKPSAPAPPPPPPPSAS 199 Query: 776 PAAPXXXPP 802 PAAP PP Sbjct: 200 PAAPPPPPP 208 Score = 38.3 bits (85), Expect = 0.25 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 8/67 (11%) Frame = +2 Query: 626 PPPPPPXXXPGP---PPPXPPXXGGXXXPXAPXXXAXPPP-----PPXPPXPXAGPPXPA 781 PPPP P PPP PP P AP P P PP PP P PA Sbjct: 132 PPPPAMSAPKPPGARPPPRPP--ATESAPDAPPRAPPPLPGSAKGPPPPPVSTRKPSAPA 189 Query: 782 APXXXPP 802 P PP Sbjct: 190 PPPPPPP 196 Score = 37.9 bits (84), Expect = 0.33 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPP 679 PPPPPP GPPPP PP Sbjct: 6 PPPPPPGGMGGPPPPPPP 23 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP 433 PPPP + PPPPP P P PPPPPP P P Sbjct: 191 PPPPPPSA--------SPAAPPPPPPPASAPRPPPAPSRSTPPPPPPPGASAPQPP 238 Score = 37.1 bits (82), Expect = 0.57 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 PPPPPP P PPPPPP Sbjct: 3 PPPPPPPPPGGMGGPPPPPP 22 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP P PP P +P A PPPP Sbjct: 260 PPPPPAASA-------PAAPPPPPPSAPPVAPPSEP------LSRPSPLPSAIAPPPPHQ 306 Query: 749 P 751 P Sbjct: 307 P 307 Score = 36.7 bits (81), Expect = 0.75 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PPPPP PP GPP P P P G A Sbjct: 4 PPPPPPPPGGMGGPPPPPPPAGNLPSRPSGSA 35 Score = 35.9 bits (79), Expect = 1.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXG 688 PPPPPP G PPP PP G Sbjct: 5 PPPPPPPGGMGGPPPPPPPAG 25 Score = 34.7 bits (76), Expect = 3.0 Identities = 31/115 (26%), Positives = 31/115 (26%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP P P PP PP P PP PPP G PP Sbjct: 132 PPPPAMSA-----PKPPGARPPPRPPATESAPDAPPRAPPPLP---------GSAKGPPP 177 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P PPPP PR P P P P Sbjct: 178 P----PVSTRKPSAPAPPPPPPPSASPAAPPPPPPPASAPRPPPAPSRSTPPPPP 228 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 472 PPPPPXXXXXXXTPPPPPPP 413 PPPPP PPPPPPP Sbjct: 4 PPPPPPPPGGMGGPPPPPPP 23 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP----PPPP 415 PPPPP P P P PP P P P PPPP Sbjct: 259 PPPPPPAASAPAAPPPPPPSAPPVAPPSEPLSRPSPLPSAIAPPPP 304 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 PPPP A P PPPPPP P PP P Sbjct: 259 PPPPPPA------ASAPAAPPPPPPSAPPVAPPSEP 288 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P PPPP A PPPPPP P PPP Sbjct: 188 PAPPPPPP-------PSASPAAPPPPPPPASAPRPPP 217 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 57.6 bits (133), Expect = 4e-07 Identities = 27/65 (41%), Positives = 27/65 (41%), Gaps = 6/65 (9%) Frame = +2 Query: 626 PPPPPPXXXPGP------PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPP PP P P PPP P P P PPPPP PP P PP P P Sbjct: 447 PPPSPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPP 506 Query: 788 XXXPP 802 PP Sbjct: 507 SQPPP 511 Score = 56.8 bits (131), Expect = 7e-07 Identities = 25/59 (42%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA-GPPXPAAPXXXP 799 PPPPPP P PPPP P P + PPPPP PP P P P P P Sbjct: 492 PPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPPPPSLP 550 Score = 52.4 bits (120), Expect = 1e-05 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 5/82 (6%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXX----PGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPP PPPPP P PPPP PP P P PP Sbjct: 525 PPPPPPPPPPPVTYNYPSPPPPPSLPVTYNYPSPPPPPPPPSYNYPAPTYYYPSPSPRPP 584 Query: 740 PXPPXPXAGPPXP-AAPXXXPP 802 P PP P P P P PP Sbjct: 585 PPPPRPRPSRPRPIITPKPIPP 606 Score = 49.6 bits (113), Expect = 1e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPX--PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P P PPPPPP P P PPPPPPP Sbjct: 463 PSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPP 506 Score = 48.4 bits (110), Expect = 2e-04 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P P PPPP PP P P PPPPP PP P AP PP G Sbjct: 57 PSHQPPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPR--VSTPAPTYLPPYTG 112 Score = 48.0 bits (109), Expect = 3e-04 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P PPPPPP P P PPPPPPP Sbjct: 64 PPPPPP--------PVTYNYPAPPPPPPPPPPPPPPPPPPPP 97 Score = 47.6 bits (108), Expect = 4e-04 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPP PPP P P PP PP P P P PPP PP Sbjct: 447 PPPSPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRPP--SSPSPPPPPPPPPPPRPPPPPP 504 Query: 752 XPXAGPPXPAAP 787 P PP P Sbjct: 505 PPSQPPPTSLTP 516 Score = 47.6 bits (108), Expect = 4e-04 Identities = 29/83 (34%), Positives = 31/83 (37%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPP--PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA---PXXXAXPP 733 PPP PP PPPPP P P PP PP P + P + P Sbjct: 465 PPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPS 524 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PP Sbjct: 525 PPPPPPPP---PPPVTYNYPSPP 544 Score = 45.6 bits (103), Expect = 0.002 Identities = 29/84 (34%), Positives = 30/84 (35%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPP--PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPP PP PPPPPP P PPP P P P PPP Sbjct: 504 PPPSQPPPTSLTPPVTYSYPSPPPPPP---PPPPPVTYNYPSPPPPPSLPVTYNYPSPPP 560 Query: 743 XPPXPXAGPPXPA----APXXXPP 802 PP P P P +P PP Sbjct: 561 PPPPPSYNYPAPTYYYPSPSPRPP 584 Score = 45.2 bits (102), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P P PPPP P P PPPPPPP Sbjct: 61 PPSPPPP-------PPPVTYNYPAPPPPPPPPPPPPPPPPPP 95 Score = 45.2 bits (102), Expect = 0.002 Identities = 24/65 (36%), Positives = 25/65 (38%), Gaps = 4/65 (6%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPP--PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPP T PP PP + P PPPPPP P P PPPP Sbjct: 447 PPPSPPSSTPSPSPSTPSPPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPP 506 Query: 423 --PPP 415 PPP Sbjct: 507 SQPPP 511 Score = 44.0 bits (99), Expect = 0.005 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXP---XXPXXPP 430 PPPP T P PPP P PPPPP P P PP Sbjct: 503 PPPPSQPPPTSLTPPVTYSYPSPPPPPP--PPPPPVTYNYPSPPPPPSLPVTYNYPSPPP 560 Query: 429 PPPPP 415 PPPPP Sbjct: 561 PPPPP 565 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPP P P PPPPPP P PPPPPP Sbjct: 62 PSPPPPPPPVTYNYPAPPPPPPPPPPPPPP-----PPPPPP 97 Score = 43.2 bits (97), Expect = 0.009 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP----PPPXPXXPXXPPPPPPP 415 PPPPP P P PPP PP P PPPPPPP Sbjct: 487 PPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPP 532 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPP P P PPPPPP P P PPP Sbjct: 489 PPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPP---PPPPPPPPVTYNYPSPPP 545 Query: 420 PP 415 PP Sbjct: 546 PP 547 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P P PPPPPP P P P P Sbjct: 65 PPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPPRVSTPAP 104 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P PPPPP PPPPPPP Sbjct: 465 PPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPP 506 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/49 (40%), Positives = 20/49 (40%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP A P PPPPPP P PPP PP PP Sbjct: 64 PPPPPPPVTYNYPAPPPPPPPPPPP---PPPPPPPPPRVSTPAPTYLPP 109 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/60 (35%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP--PPPXPPXPXAGPPXPAAPXXXPP 802 P P P PPP PP P P + PP PP P P + PP +P PP Sbjct: 436 PLPLPSTSTPSPPPSPPSSTPSPSPSTP---SPPPSRPPSTPSLPPSRPPSSPSPPPPPP 492 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/67 (31%), Positives = 23/67 (34%), Gaps = 4/67 (5%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXP-PPPPXXXGEXXKXPXXPXXXXXPPPP---PXXXXXXXT 434 PPP P PPPP + P P PPP P + Sbjct: 465 PPPSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPS 524 Query: 433 PPPPPPP 413 PPPPPPP Sbjct: 525 PPPPPPP 531 Score = 37.5 bits (83), Expect = 0.43 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 13/59 (22%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP-------------XXPPPPPPP 415 T PP P P P PPPPPP P P PPPPPPP Sbjct: 473 TPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPP 531 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PP PPPPPPP Sbjct: 492 PPPPPPRPPPPPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPP 534 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT---PPPPPPP 413 PPPPP P PPPPP T P PPPPP Sbjct: 502 PPPPPSQPPPTSLTPPVTYSYPSPPPPPPPPPPPVTYNYPSPPPPP 547 Score = 36.3 bits (80), Expect = 1.00 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P P P + P PPPPPP P PPP P Sbjct: 467 PSRPPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPP 506 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 3/29 (10%) Frame = -2 Query: 492 PXXXXXPPPPPPXP---XXPXXPPPPPPP 415 P PPPPP P P PPPPPPP Sbjct: 57 PSHQPPSPPPPPPPVTYNYPAPPPPPPPP 85 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXP----XXPXXPPPPPPP 415 PPPPP P PPPPPP P P P P PP Sbjct: 561 PPPPPSYNYPAPTYYYPSPSPRPPPPPPRPRPSRPRPIITPKPIPP 606 Score = 35.1 bits (77), Expect = 2.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 472 PPPPPXXXXXXXTPPPPPPP 413 PPPPP PPPPPPP Sbjct: 65 PPPPPPVTYNYPAPPPPPPP 84 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PP P PPPPPPP Sbjct: 527 PPPPPPPPPVTYNYPSPPP----PPSLPVTYNYPSPPPPPPPP 565 Score = 34.7 bits (76), Expect = 3.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 472 PPPPPXXXXXXXTPPPPPPP 413 PPPPP PPPPPPP Sbjct: 66 PPPPPVTYNYPAPPPPPPPP 85 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P P P PPPPP P PPP PP Sbjct: 470 PPSTPSLPPSRPPSSPSPPPPPPPPPPPRPPPPPPPPSQPP 510 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPP PPPPPPP Sbjct: 500 PPPPPPPSQPPPTSLTPPVTYSYPSPPPP-------PPPPPPP 535 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +3 Query: 600 GXXAXXPXXPPPPPP---XXXPXPPPXXPPXXGGXXXXXXPP 716 G + P PPPPPP P PPP PP PP Sbjct: 55 GLPSHQPPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPP 96 Score = 33.5 bits (73), Expect = 7.0 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPX 745 PPPPP P P PP PPP P P P PP Sbjct: 583 PPPPPPRPRPSRP-RPIITPKPIPPRATYLPPPRLTPQPRTYLPPPTPTPQTFTYSQPPA 641 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P PP PA P PP Sbjct: 642 PQSRLYLPPRPA-PMYLPP 659 >UniRef50_UPI0000584992 Cluster: PREDICTED: similar to actin binding protein, putative isoform 1; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to actin binding protein, putative isoform 1 - Strongylocentrotus purpuratus Length = 456 Score = 57.6 bits (133), Expect = 4e-07 Identities = 30/83 (36%), Positives = 32/83 (38%), Gaps = 6/83 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP------PPPXPPXXGGXXXPXAPXXXAXP 730 PPP P GG PPPPPP P PP PP G P + A P Sbjct: 274 PPPAPISKGGVQNSSEMSLPPPPPPLDYDNPYSEVGDMPPPPPVSGYVAPPSSGIPGAPP 333 Query: 731 PPPPXPPXPXAGPPXPAAPXXXP 799 P P PP P + P P P P Sbjct: 334 VPAPPPPLPTSAGPTPPPPPPLP 356 Score = 52.8 bits (121), Expect = 1e-05 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 2/83 (2%) Frame = +2 Query: 536 GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPX 715 GG PPPPP PPPPP PP P P P Sbjct: 282 GGVQNSSEMSLPPPPPPLDYDNPYSEVGDMPPPPPVSGYVAPPSSGIPGAPPVPAPPPPL 341 Query: 716 XX-AXPPPPPXPPXPXAG-PPXP 778 A P PPP PP P AG PP P Sbjct: 342 PTSAGPTPPPPPPLPAAGAPPLP 364 Score = 45.2 bits (102), Expect = 0.002 Identities = 25/82 (30%), Positives = 25/82 (30%) Frame = -2 Query: 660 GPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXX 481 GP GG PPPP PPPP P Sbjct: 273 GPPPAPISKGGVQNSSEMSLPPPPPPLDYDNPYSEVGDMPPPPPVSGYVAPPSSGIPGAP 332 Query: 480 XXPPPPPPXPXXPXXPPPPPPP 415 P PPPP P PPPPPP Sbjct: 333 PVPAPPPPLPTSAGPTPPPPPP 354 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G P PP P PPPP P G P P A PP P P Sbjct: 312 PPPPPV---SGYVAPPSSGIPGAPPV--PAPPPPLPTSAGPTPPPPPPLPAAGAPPLPPP 366 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP P P PPP PPP Sbjct: 295 PPPPLDYDNPYSEVGDM---PPPPPVSGYVAPPSSGIPGAPPVPAPPPPLPTSAGPTPPP 351 Query: 421 PPP 413 PPP Sbjct: 352 PPP 354 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 4/70 (5%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPP----XXXGEXXKXPXXPXXXXXPPPPPXXXXX 443 A PPP GG PPPPP E P P PP Sbjct: 271 APGPPPAPISKGGVQNSSEMSLPPPPPPLDYDNPYSEVGDMPPPPPVSGYVAPPSSGIPG 330 Query: 442 XXTPPPPPPP 413 P PPPP Sbjct: 331 APPVPAPPPP 340 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX-PPPPPPXPXXPXXPPPP 424 PPPP G PP P P P PPPPPP P P PP Sbjct: 312 PPPPPVSGYVAPPSSGIPGAPPVPAPPP------PLPTSAGPTPPPPPPLPAAGAPPLPP 365 Query: 423 P 421 P Sbjct: 366 P 366 >UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative uncharacterized protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 373 Score = 57.6 bits (133), Expect = 4e-07 Identities = 26/60 (43%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP P P P PP P P PP P P PP Sbjct: 266 PPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPPAADPPPAPSPPPPEPPPADPP 325 Score = 56.4 bits (130), Expect = 9e-07 Identities = 31/80 (38%), Positives = 32/80 (40%), Gaps = 5/80 (6%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP---PXP 748 PP C PPPPPP PPPP P P P A PPPP P P Sbjct: 246 PPMANSDAAGCLAAVPPPPPPP-----PPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVP 300 Query: 749 PXPXAG--PPXPAAPXXXPP 802 P A PP P+ P PP Sbjct: 301 GVPPAADPPPAPSPPPPEPP 320 Score = 55.2 bits (127), Expect = 2e-06 Identities = 26/73 (35%), Positives = 27/73 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PPP P G P + PPP P P Sbjct: 262 PPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPPAADPPPAPSPPPPEPPP 321 Query: 749 PXPXAGPPXPAAP 787 P P P P Sbjct: 322 ADPPTAPDRPLRP 334 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP--PP 415 PPPPP P P PPPP P P P P P P PP Sbjct: 261 PPPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPP 304 Score = 40.7 bits (91), Expect = 0.046 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP---PPPPPXPXXPXXPP 430 PPPP PPPPP P P P PPP P P P PP Sbjct: 262 PPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPPAADPPPAPSPPPPE-PP 320 Query: 429 PPPPP 415 P PP Sbjct: 321 PADPP 325 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP- 424 PP G PPPPP P P P PPPP P PP Sbjct: 246 PPMANSDAAGCLAAVPPPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPPA 305 Query: 423 --PPP 415 PPP Sbjct: 306 ADPPP 310 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 G PPPPP P P P PPP P PPPPPE Sbjct: 255 GCLAAVPPPPP---------PPPPPPTPEPVPPPPIPPPPPVPAPPPPPE 295 Score = 36.3 bits (80), Expect = 1.00 Identities = 23/73 (31%), Positives = 23/73 (31%), Gaps = 10/73 (13%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXP--PPPPXXXXXXXTPPP 425 PP G PPPPP E P P P PPPP PP Sbjct: 246 PPMANSDAAGCLAAVPPPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPPA 305 Query: 424 --------PPPPE 410 PPPPE Sbjct: 306 ADPPPAPSPPPPE 318 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 GPP G P PPP P P P PP P P PP Sbjct: 245 GPPMANSDAAGCLAAVPPPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPP 293 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P P PPPP P P PP P Sbjct: 290 PPPPPEPAPVPGVPPAADPPPAPSPPPPEP-PPADPPTAP 328 Score = 33.5 bits (73), Expect = 7.0 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 1/67 (1%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXX-PXXXXXPPPPPXXXXXXXT 434 A PPPP PPPPP P P PPP Sbjct: 259 AVPPPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPPEPAPVPGVPPAADPPPAPSPPPPE 318 Query: 433 PPPPPPP 413 PPP PP Sbjct: 319 PPPADPP 325 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 57.6 bits (133), Expect = 4e-07 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXG-GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP PPPP PP G P P PPP PP GPP P P Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPT 443 Query: 803 XXG 811 G Sbjct: 444 KSG 446 Score = 54.0 bits (124), Expect = 5e-06 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAP-XXXAXPPPPPXPPXPXAGPPXP 778 P PP P PPPP PP P P A PPPPP P AGPP P Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX-PXXPPPPPPPXXXXXXXXGXGGG 376 T PP PP P P PPPPP P P PPPPPPP G G Sbjct: 368 TANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP--------GKKGA 419 Query: 375 GXXXPP 358 G PP Sbjct: 420 GPPPPP 425 Score = 48.4 bits (110), Expect = 2e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P PPPPPP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 46.0 bits (104), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 T PPPPP P PPPPPP PPPPPP Sbjct: 382 TSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 41.9 bits (94), Expect = 0.020 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPP PPPPPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P P PPPP P PP PP Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP 442 PPPP G PPPPP G P P PP PP P P Sbjct: 398 PPPPKKGPAA--------PPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGP 442 Score = 35.9 bits (79), Expect = 1.3 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXP-XPPPXXPPXXGGXXXXXXPP 716 PPPP A P PPPPPP P PPP PP G PP Sbjct: 384 PPPPPPPS-----AAAP--PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 34.3 bits (75), Expect(2) = 0.14 Identities = 34/121 (28%), Positives = 35/121 (28%), Gaps = 6/121 (4%) Frame = +2 Query: 458 GGGGGGXXXXX-----GXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXX 622 GGGGGG G G F P GGG P PP G Sbjct: 208 GGGGGGKQSQSKFQAPGGGSFPSSPSQIHSGGGRSP----PLPLPPGQFTAGNASFPSST 263 Query: 623 XPPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPP P PP G AP + P PP P A A P Sbjct: 264 QPPPGQYMAGNASFPSSTPPPPGQYMAGNAPFSSSTPLPPGQYPAVNAQLSTSAPSVPLP 323 Query: 800 P 802 P Sbjct: 324 P 324 Score = 33.9 bits (74), Expect = 5.3 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPP 679 PPPP G G PPPPPP GPP PP P Sbjct: 411 PPPPGKKGAG---------PPPPPPMSKKGPPKPPGNP 439 Score = 23.8 bits (49), Expect(2) = 0.14 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGG 475 GGGGGG GGGGGG Sbjct: 160 GGGGGG-------GGGGGG 171 >UniRef50_Q013M1 Cluster: Chromosome 08 contig 1, DNA sequence; n=1; Ostreococcus tauri|Rep: Chromosome 08 contig 1, DNA sequence - Ostreococcus tauri Length = 442 Score = 57.6 bits (133), Expect = 4e-07 Identities = 25/59 (42%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP P PPP PP P P + P PPP P P PP P+ P PP Sbjct: 165 PPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPP-PSPPPSPPP 222 Score = 56.0 bits (129), Expect = 1e-06 Identities = 25/59 (42%), Positives = 27/59 (45%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP P PPP PP P +P PP PP PP P P P +P PP Sbjct: 164 PPPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPP-PPSPSPPPSPPPSPPPSPP 221 Score = 54.0 bits (124), Expect = 5e-06 Identities = 24/59 (40%), Positives = 25/59 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP P PPP PP P PP P PP P PP P+ P PP Sbjct: 169 PPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPP-PSPPPSLPP 226 Score = 50.4 bits (115), Expect = 6e-05 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P PP P P PPP PP P P P PPP P PP P+ P PP Sbjct: 155 PCPSPPLSPPPPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPP 214 Score = 49.6 bits (113), Expect = 1e-04 Identities = 27/72 (37%), Positives = 29/72 (40%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PP PPP P PPP PP P P + PPP PP Sbjct: 163 PPPPSP----PPSPPPNPPPNPPPNPPPNPPPSPPPSLS----PPNPPPPSPSPPPSPPP 214 Query: 752 XPXAGPPXPAAP 787 P PP P+ P Sbjct: 215 SPPPSPP-PSLP 225 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPP-PPPPXPXXPXXPPPPPPP 415 PPP P P P PP PPPP P P PPP PPP Sbjct: 176 PPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPP 218 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPP-PPPXPXXPXXPPPPPPP 415 PPPP P P PPP PPP P PP PPPP Sbjct: 163 PPPPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPP 204 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PP P PP PP P P PPP P P P PPP Sbjct: 165 PPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPPPSL 224 Query: 420 PP 415 PP Sbjct: 225 PP 226 Score = 40.7 bits (91), Expect = 0.046 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P PPPP P P P PPP PPP Sbjct: 155 PCPSPPLSPPPPSPPPSPPPNPPPNPPP 182 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP P PP PPP P PPP PP Sbjct: 186 PNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPPPSLPP 226 Score = 38.7 bits (86), Expect = 0.19 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = +3 Query: 528 GGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPP-PPPXXXPXPPPXXPPXXGGXXXX 704 G G G P PPPP P PPP PPP P PPP PP Sbjct: 149 GLGCGVPCPSPPLSPPPP------SPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPP 202 Query: 705 XXPPGXP 725 P P Sbjct: 203 PPSPSPP 209 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P P PP + P PPPP P P PPP PP Sbjct: 178 PNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPP 218 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP P P P P PPP P P PPPP Sbjct: 164 PPPSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPP 204 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P P PP + P PP PP P PPP PP PP Sbjct: 174 PNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPPPSLPP 226 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP P PP PPP P PP P PP P Sbjct: 166 PSPPPSPPPNPPPNPPPNPPPNPPPSPPPSLSPPNPPPPSPSPPPSPPPSPPPSPP 221 >UniRef50_Q54TI7 Cluster: WH2 domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: WH2 domain-containing protein - Dictyostelium discoideum AX4 Length = 459 Score = 57.6 bits (133), Expect = 4e-07 Identities = 36/94 (38%), Positives = 36/94 (38%), Gaps = 10/94 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPP-- 736 PPPP GGG PPPP P P PP P PP G P P PPP Sbjct: 286 PPPPGP-NGGGPPQPPISRPPPPNPGGPPQPPISRPPPPNPGTGGGPTQPPMNRPPPPGP 344 Query: 737 ------PPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P GPP P PP GG Sbjct: 345 NGGPMNRPPPPGPNGGPPQPM--NRPPPPGSNGG 376 Score = 55.6 bits (128), Expect = 2e-06 Identities = 35/92 (38%), Positives = 36/92 (39%), Gaps = 7/92 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX- 745 PPPP GGG PPPP P P PP P GG P PPPP Sbjct: 320 PPPPNPGTGGGPTQPPMNRPPPPGPNGGPMNRPPPPGPNGGPPQPMN-----RPPPPGSN 374 Query: 746 --PPXPXAGPPXPAAPXXXP----PXXGXGGA 823 PP P + PP P P P G GGA Sbjct: 375 GGPPQPMSRPPPPGQPNMPPRPVSTINGVGGA 406 Score = 53.6 bits (123), Expect = 6e-06 Identities = 35/105 (33%), Positives = 36/105 (34%), Gaps = 10/105 (9%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-------PPPX 673 P G GG PPPP GG PPPP P GP PPP Sbjct: 286 PPPPGPNGGGPPQPPISRPPPP---NPGGPPQPPISRPPPPNPGTGGGPTQPPMNRPPPP 342 Query: 674 PPXXGGXXXPXAPXXXAXPPPP---PXPPXPXAGPPXPAAPXXXP 799 P G P P PP P P PP GPP P + P Sbjct: 343 GPNGGPMNRPPPPGPNGGPPQPMNRPPPPGSNGGPPQPMSRPPPP 387 Score = 52.0 bits (119), Expect = 2e-05 Identities = 35/102 (34%), Positives = 36/102 (35%), Gaps = 10/102 (9%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGG----GGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPX 523 PP G GGG P GG PPPP G GG PPPP Sbjct: 286 PPPPGPNGGGPPQPPISRPPPPNPGGPPQPPISRPPPPNP-GTGGGPTQPPMNRPPPPGP 344 Query: 522 XXGXXXKXPXPXXXXXPPPP---PPXPXXPXXPPPP---PPP 415 G + P P PP P PP P PP P PPP Sbjct: 345 NGGPMNRPPPPGPNGGPPQPMNRPPPPGSNGGPPQPMSRPPP 386 Score = 44.8 bits (101), Expect = 0.003 Identities = 31/108 (28%), Positives = 31/108 (28%), Gaps = 9/108 (8%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPP---------PPXXGGGGXXCXXXXXPPPPPPXXXPGPPP 667 P G GGG PPP PP G G PPPP P P Sbjct: 322 PPNPGTGGGPTQPPMNRPPPPGPNGGPMNRPPPPGPNGGPPQPMNRPPPPGSNGGPPQPM 381 Query: 668 PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PP G P P P P GPP PP G Sbjct: 382 SRPPPPGQPNMPPRPVSTINGVGGAPPTQPNGGPPPKPQRPGPPPVPG 429 Score = 44.4 bits (100), Expect = 0.004 Identities = 40/139 (28%), Positives = 41/139 (29%), Gaps = 3/139 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP G PPPP G P P PP P P P PPPP Sbjct: 265 PPPVPTGNSPQRPPTQPPMNRPPPPGPNGGGPPQP-PISRPPPPNPGGPPQPPISRPPPP 323 Query: 420 PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXP--GXXXXGXXPPPP-XX 250 P GGG PP P P G PPPP Sbjct: 324 NPGT---------GGGPTQPPMNRPPPPGPNGGPMNRPPPPGPNGGPPQPMNRPPPPGSN 374 Query: 249 XXPPRXPXTPXXPGGPGXP 193 PP+ P PG P P Sbjct: 375 GGPPQPMSRPPPPGQPNMP 393 Score = 43.2 bits (97), Expect = 0.009 Identities = 30/96 (31%), Positives = 30/96 (31%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P G GG PPPP PP G PPP P G Sbjct: 368 PPPPGSNGGPPQ--PMSRPPPPGQPNMPPRPVSTINGVGGAPPTQPNGGPPPKPQRPGPP 425 Query: 695 XXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P AP PP PP P PAAP PP Sbjct: 426 PVPGAPRPMTTPPNGMTPPPK---PQRPAAPPALPP 458 Score = 42.7 bits (96), Expect = 0.011 Identities = 31/98 (31%), Positives = 32/98 (32%), Gaps = 6/98 (6%) Frame = -2 Query: 690 PPXXGGXGG---GGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXX 520 PP GG P G GGG PPPP GG PPPP Sbjct: 306 PPNPGGPPQPPISRPPPPNPGTGGGPTQPPMNRPPPPGPNGG-------PMNRPPPPGPN 358 Query: 519 XG---XXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 G + P P PP P P P P PP P Sbjct: 359 GGPPQPMNRPPPPGSNGGPPQPMSRPPPPGQPNMPPRP 396 Score = 41.5 bits (93), Expect = 0.026 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 4/86 (4%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXP-GPPPPXPPXXGGXXXPXAPXXXAXPPPP---P 742 PPP G P PP P G PP PP P P P PP P Sbjct: 265 PPPVPTGNSPQRPPTQPPMNRPPPPGPNGGGPPQPPIS----RPPPPNPGGPPQPPISRP 320 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 PP P G P PP G G Sbjct: 321 PPPNPGTGGGPTQPPMNRPPPPGPNG 346 Score = 39.9 bits (89), Expect = 0.081 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGX 695 P G GG P PPPP GG PPPP P P P PP G Sbjct: 321 PPPNPGTGGGPTQPPMNRPPPPGPNGG------PMNRPPPPGPNGGPPQPMNRPPPPGSN 374 Query: 696 XXXXXPPGXP 725 P P Sbjct: 375 GGPPQPMSRP 384 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P G P PPP GGG PPPP P P PP PP Sbjct: 267 PVPTGNSPQRPPTQPPMNRPPPPGPNGGGPPQPPISRPPPPNPGGPPQPPISRPP 321 Score = 39.1 bits (87), Expect = 0.14 Identities = 38/134 (28%), Positives = 39/134 (29%), Gaps = 2/134 (1%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP- 430 + PPP GGG PPPP G P P PPP P P PP Sbjct: 285 RPPPPGPNGGG----PPQPPISRPPPPNPGG----PPQPPISRPPPPNPGTGGGPTQPPM 336 Query: 429 -PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPX 253 PPPP G GG PP P G P P Sbjct: 337 NRPPPP--------GPNGGPMNRPP------PPGPNGGPPQPMNRPPPPGSNGGPPQPMS 382 Query: 252 XXXPPRXPXTPXXP 211 PP P P P Sbjct: 383 RPPPPGQPNMPPRP 396 Score = 36.3 bits (80), Expect = 1.00 Identities = 40/155 (25%), Positives = 42/155 (27%), Gaps = 1/155 (0%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P GG P G GGG PP G GG Sbjct: 304 PPPPNPGGPPQPPISRPPPP----NPGTGGGPTQPP----MNRPPPPGPNGGPMNRPPPP 355 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G GG + PPP G GG + PPPP PP Sbjct: 356 GPNGGPPQPMNRPPPP---GSNGGPPQPMSR--PPPPGQPNMPPRPVSTINGVGGAPPTQ 410 Query: 459 PXPXXPXXPP-PPPPPXXXXXXXXGXGGGGXXXPP 358 P P P P PPP G PP Sbjct: 411 PNGGPPPKPQRPGPPPVPGAPRPMTTPPNGMTPPP 445 Score = 33.9 bits (74), Expect = 5.3 Identities = 35/139 (25%), Positives = 35/139 (25%), Gaps = 4/139 (2%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P GG P G G G G G P G G Sbjct: 322 PPNPGTGGGPTQPPMNRPPPPGPNG--GPMNRPPPPGPNGGPPQPMNRPPPPGSNGGPPQ 379 Query: 639 GGGGGXXXXXXKXPPPPXX--GGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP 466 PP P G GG PPP P G P PP Sbjct: 380 PMSRPPPPGQPNMPPRPVSTINGVGGAPPTQPNGGPPPKPQRPGPPPVPGAPRPMTTPPN 439 Query: 465 PPPXPXXPXXPPPPP--PP 415 P P P PP PP Sbjct: 440 GMTPPPKPQRPAAPPALPP 458 >UniRef50_A2FA50 Cluster: Proline-rich protein MP-2-related protein; n=5; Trichomonas vaginalis G3|Rep: Proline-rich protein MP-2-related protein - Trichomonas vaginalis G3 Length = 128 Score = 57.6 bits (133), Expect = 4e-07 Identities = 32/79 (40%), Positives = 33/79 (41%), Gaps = 6/79 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA--PXXXAXPPPP- 739 PPPPP G PP PP PPPP PP G P + P A PP P Sbjct: 27 PPPPPQGYGQQPPQNHYGAPPAYPPPAYGQPPPPPPPQGYGQQPPPSYMPPPQAVPPAPQ 86 Query: 740 ---PXPPXPXAGPPXPAAP 787 PP P PP PAAP Sbjct: 87 PQQQTPPPPPPAPPQPAAP 105 Score = 45.2 bits (102), Expect = 0.002 Identities = 31/99 (31%), Positives = 32/99 (32%), Gaps = 1/99 (1%) Frame = -2 Query: 708 AXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPP 529 A G PP G G P G + PPPP G G PPP Sbjct: 22 AYGQQPPPPPQGYGQQPPQNHYGAPPAYPPPAYGQPPPPPPPQGYG---------QQPPP 72 Query: 528 PXXXGXXXKXPXPXXXXX-PPPPPPXPXXPXXPPPPPPP 415 P P PPPPPP P P P PP P Sbjct: 73 SYMPPPQAVPPAPQPQQQTPPPPPPAPPQPAAPQPPSEP 111 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGX 814 PPP P P P P G P PP P PP P PP G Sbjct: 7 PPPYGYPPYPYPQPQAYGQQPPPPPQGYGQQPPQNHYGAPPAYPPPAYGQPPPPPPPQGY 66 Query: 815 G 817 G Sbjct: 67 G 67 Score = 33.1 bits (72), Expect = 9.3 Identities = 24/70 (34%), Positives = 25/70 (35%), Gaps = 11/70 (15%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXP----XAPXXXAXP----PPPPXPPXPXAGPPXPA 781 P P P G PP PP G P AP P PPPP PP P P+ Sbjct: 14 PYPYPQPQAYGQQPPPPPQGYGQQPPQNHYGAPPAYPPPAYGQPPPPPPPQGYGQQPPPS 73 Query: 782 ---APXXXPP 802 P PP Sbjct: 74 YMPPPQAVPP 83 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 57.6 bits (133), Expect = 4e-07 Identities = 33/80 (41%), Positives = 33/80 (41%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G G PPPP P P PPPP PP G PPPPP PP Sbjct: 537 PPPPSAPGAGIP------PPPPVPGNAPPPPPPPPPPPGA----------GAPPPPP-PP 579 Query: 752 XPXAGPPXPAAPXXXPPXXG 811 P PP P A P G Sbjct: 580 GPGLAPPPPKAGGSSSPPAG 599 Score = 54.8 bits (126), Expect = 3e-06 Identities = 25/61 (40%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP--XXPPPPPPPXXXXXXXXGXGGGGXXX 364 PPPP G P P PPPPPP P P PPPPPPP GG Sbjct: 537 PPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPGLAPPPPKAGGSSSP 596 Query: 363 P 361 P Sbjct: 597 P 597 Score = 49.2 bits (112), Expect = 1e-04 Identities = 25/60 (41%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPPP-XPPXPXAG---PPXPAAPXXXPPXXGXGGA 823 G PP P G P P PPPPP PP P AG PP P P PP GG+ Sbjct: 534 GEAPPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPGLAPPPPKAGGS 593 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P PPPPP PPPPPPP Sbjct: 537 PPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPP 579 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Frame = +2 Query: 629 PPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP--PXPAAPXXXP 799 P P P P P P P P P AP PPP PP + P P PA P P Sbjct: 88 PEPAPQPAPEPAPAPAAPEPAPKPQPAAPPPAQPAPPPSLPPPQASQPLAPPPAKPPIPP 147 Query: 800 P 802 P Sbjct: 148 P 148 Score = 42.7 bits (96), Expect = 0.011 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 5/82 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 P P P P PPP P PPP PP P AP P PPP Sbjct: 94 PAPEPAPAPAAPEPAPKPQPAAPPPAQ-PAPPPSLPPPQAS--QPLAPPPAKPPIPPPKS 150 Query: 743 ---XPPXPXAGPPXPAAPXXXP 799 PP P P P P P Sbjct: 151 NNHVPPPPAIPPSPPIRPPESP 172 Score = 41.5 bits (93), Expect = 0.026 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA 709 PPPPP G G PPPPP PG PP PP GG P A Sbjct: 562 PPPPPPPGAGA---------PPPPPPPGPGLAPP-PPKAGGSSSPPA 598 Score = 40.7 bits (91), Expect = 0.046 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 20/68 (29%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPP------XXGGXXXP--------------XAPXXXAXPPPPPX 745 PPPPPP P PPPP PP GG P A A PPP Sbjct: 4 PPPPPPPSLPAPPPPPPPGTPNHGGGGGLVKPTDDALQAMIAKRKANAAKKPANPPPEKP 63 Query: 746 PPXPXAGP 769 PP AGP Sbjct: 64 PPKKAAGP 71 Score = 39.5 bits (88), Expect = 0.11 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP GGGG P Sbjct: 4 PPPPPPPSLPAPPPPPPP-----GTPNHGGGGGLVKP 35 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 G P PPPPP P PPPPPPP Sbjct: 534 GEAPPPPSAPGAGIPPPPPVPGNAPPPPPPPPPP 567 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 P PPP G P PPPPPP PPP PP G Sbjct: 543 PGAGIPPPPPVPGNA----PPPPPPPPPPPGAGAPPPPPPPGPG 582 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPP P PP PPP PPP PP Sbjct: 121 PAPPPSLPPPQASQPLAPPPAKPPIPPPKSNNHVPPPPAIPP 162 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP 665 P G G P PPPP A P PPPP P P PP Sbjct: 540 PSAPGAGIPPPPPVPGNAPPPPPPP-PPPPGAGAPPPPPPPGPGLAPPPP 588 >UniRef50_A0CFX0 Cluster: Chromosome undetermined scaffold_177, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_177, whole genome shotgun sequence - Paramecium tetraurelia Length = 1328 Score = 57.6 bits (133), Expect = 4e-07 Identities = 31/70 (44%), Positives = 31/70 (44%), Gaps = 3/70 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---PPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP G PPPPP G P PP PP GG P P A PPPP Sbjct: 788 PPPPPPPG---TISVSALAPPPPPLGAKTGASSPAPPPPP--GGPKPPGPPPGGAPPPPP 842 Query: 740 PXPPXPXAGP 769 P P P GP Sbjct: 843 PPGPRPPGGP 852 Score = 46.8 bits (106), Expect = 7e-04 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPPPPP PPPP G P AP P PP PP P PP P P Sbjct: 789 PPPPPPGTISVSALAPPPPPLGAKTGASSP-APPPPPGGPKPPGPP-PGGAPPPPPPPGP 846 Query: 794 XPP 802 PP Sbjct: 847 RPP 849 Score = 45.2 bits (102), Expect = 0.002 Identities = 24/61 (39%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPP--XXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPPPP P PP G +P PPPPP P P PP A P P Sbjct: 788 PPPPPPPGTISVSALAPPPPPLGAKTGASSP----APPPPPGGPKPPGPPPGGAPPPPPP 843 Query: 800 P 802 P Sbjct: 844 P 844 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/61 (36%), Positives = 23/61 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G + PPPPP P P P PP P PPPPP Sbjct: 789 PPPPPPG-----TISVSALAPPPPPLGAKTGASSPAPPPPPGGPKPPGPPPGGAPPPPPP 843 Query: 420 P 418 P Sbjct: 844 P 844 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G PPPPP P P P PP PPPP Sbjct: 788 PPPPPPPG----TISVSALAPPPPPLGAKTGASSPAPPPPPGGPKPPGPPPGGAPPPPPP 843 Query: 421 PPP 413 P P Sbjct: 844 PGP 846 Score = 39.9 bits (89), Expect = 0.081 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 P PP GG P PPPPP P PP P GG Sbjct: 818 PAPPPPPGGPKPPGPPPGGAPPPPPPPGPRPPGGPDPQFGG 858 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P PPPP P PPPPP GG P Sbjct: 790 PPPPPGTISVSALAP-------PPPPLGAKTGASSPAPPPPPGGPKPPGPPPGGAPPPPP 842 Query: 360 P 358 P Sbjct: 843 P 843 >UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 205 Score = 57.6 bits (133), Expect = 4e-07 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 4/72 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX----PGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP PPPPPP P PPPP PP AP PPP Sbjct: 105 PPPPPPP----PTTVVPPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPPP 160 Query: 737 PPXPPXPXAGPP 772 PP PP PP Sbjct: 161 PPPPPPVVTSPP 172 Score = 54.0 bits (124), Expect = 5e-06 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP PPPP PP P P PPP A PP P P PP Sbjct: 106 PPPPPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPPPPPPP 164 Score = 50.4 bits (115), Expect = 6e-05 Identities = 24/59 (40%), Positives = 25/59 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP PPP PP P PPPPP PP P + AP PP Sbjct: 105 PPPPPPPPTTVVPPPPPP------PPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPP 157 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T PPPPP P P PPPP PPPPPPP Sbjct: 113 TTVVPPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPP 158 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXP---XXPXXPPPPPPP 415 PPPPP P P PPPPPP P P PPPPPPP Sbjct: 105 PPPPP---------PPPTTVVPPPPPPPPPTHTTHPHPPPPPPPP 140 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPP PPPPPPP Sbjct: 117 PPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPP 159 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/59 (35%), Positives = 22/59 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP PPPPP + P P PPPPPP P P PP Sbjct: 118 PPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPP----PPPPPPPPPPPVVTSPP 172 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 APPPPP P PPPPP +PPPPPPP Sbjct: 104 APPPPP-------PPPTTVVPPPPPPPPPTHTTHPHPPPPPPP 139 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP K PPPPPP P PPPPPPP Sbjct: 135 PPPPPPPPASSTKSAEA-----PPPPPPPP-----PPPPPPP 166 Score = 38.7 bits (86), Expect = 0.19 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPPP P PPPPPPP Sbjct: 98 PVTETEAPPPPPPPPTTVVPPPPPPP 123 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP + PPPPPP P PP P Sbjct: 131 PHPPPPPPPPPPASSTKSAEAPPPPPPPPPPPPPPPVVTSP 171 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 9/51 (17%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP---------PPPPPP 415 PPPPP P P P PP P P P PPPPPP Sbjct: 107 PPPPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPP 157 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = -1 Query: 529 PXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT---PPPPPPP 413 P E P P PPPPP T PPPPPPP Sbjct: 98 PVTETEAPPPPPPPPTTVVPPPPPPPPPTHTTHPHPPPPPPP 139 >UniRef50_Q6P0D5 Cluster: WW domain-binding protein 11; n=7; Euteleostomi|Rep: WW domain-binding protein 11 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 640 Score = 57.6 bits (133), Expect = 4e-07 Identities = 27/58 (46%), Positives = 27/58 (46%), Gaps = 4/58 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX----PPXPXAGPPXPAAP 787 PP PPP PGPPP PP P P PP PP PP P AGPP A P Sbjct: 425 PPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPPRAGPPRMAPP 482 Score = 52.8 bits (121), Expect = 1e-05 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PPP PGPPP PP P AP PPPPP P PP P P Sbjct: 437 PPGPPPGLPPGPPPRGPPPR---LPPPAPPGMPPPPPPPRAGPPRMAPPLSLFPPPLNP 492 Score = 46.4 bits (105), Expect = 0.001 Identities = 31/96 (32%), Positives = 31/96 (32%), Gaps = 13/96 (13%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPP-----------PPXPPXXGGXXXPXA 709 PPP P G PPP PP PG P PP PP P Sbjct: 380 PPPAPPMRPPGPPSGPPPGPPPGAPPFLRPPGLPSALRGPMPRLLPPGPPPGRPPGPPPG 439 Query: 710 PXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 P P PPP P P PP P PP G Sbjct: 440 PPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPPRAG 475 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP---PP--PXPXXPXXPPPPPPP 415 P PPP P P PPP PP P P P PPPPPPP Sbjct: 426 PGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPP 472 Score = 39.9 bits (89), Expect = 0.081 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-- 427 PP P G G PP PP P PPPPPP P PP Sbjct: 425 PPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPPRAGPPRMAPPLS 484 Query: 426 --PPP 418 PPP Sbjct: 485 LFPPP 489 Score = 38.7 bits (86), Expect = 0.19 Identities = 28/100 (28%), Positives = 29/100 (29%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXX 313 P PP PP P P PPP PP G P + Sbjct: 375 PPPLGPPPAPPMRPPGPPSGPPPGPPPGAPPFLRPPGLPSALRGP----MPRLLPPGPPP 430 Query: 312 XXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P G P PP PPR P P PG P P Sbjct: 431 GRPPGPPPGPPPGLPPGPPPRGPPPRLP-PPAPPGMPPPP 469 Score = 37.5 bits (83), Expect = 0.43 Identities = 23/55 (41%), Positives = 23/55 (41%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP PP G P AP PP PP P P GPP A P PP Sbjct: 363 PPSLMQAPPITGPPPLG---PPPAPPMR--PPGPPSGPPP--GPPPGAPPFLRPP 410 Score = 37.5 bits (83), Expect = 0.43 Identities = 27/76 (35%), Positives = 27/76 (35%), Gaps = 17/76 (22%) Frame = +2 Query: 626 PPPPPPXXX------------PGPPPPXPPXXGGXXXPXA-----PXXXAXPPPPPXPPX 754 PP PP PGPPP PP P A P PPP PP Sbjct: 376 PPLGPPPAPPMRPPGPPSGPPPGPPPGAPPFLRPPGLPSALRGPMPRLLPPGPPPGRPPG 435 Query: 755 PXAGPPXPAAPXXXPP 802 P GPP P P PP Sbjct: 436 PPPGPP-PGLPPGPPP 450 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP-XXGGXXXXXXPPGXP 725 P PP P PPP PP P PP PP G PPG P Sbjct: 357 PMAAQQPPSLMQAPPITGPPPLGPPPAPPMRPPGPPSGPPPGPPPGAPPFLRPPGLP 413 Score = 36.3 bits (80), Expect = 1.00 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP- 424 PP P G G PP P G + P P PPPPPP P PP Sbjct: 433 PPGPPPGPPPGL---------PPGPPPRGPPPRLPPPAPPGMPPPPPPPRAGPPRMAPPL 483 Query: 423 ---PPP 415 PPP Sbjct: 484 SLFPPP 489 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPP--PPPXXXPXPPPXXPPXXG 689 P P PP G P PPP PPP PPP PP G Sbjct: 430 PGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPPRAG 475 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGX 814 PPP P PP PP P P PP P GP P PP Sbjct: 375 PPPLGPPPAPPMRPPGPPSGPPPGPPPGAPPFLRPPGLPSALRGPMPRLLPPGPPPGRPP 434 Query: 815 G 817 G Sbjct: 435 G 435 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP--PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PP P G G PP P G + P PP PP P PP Sbjct: 388 PPGPPSGPPPGPPPGAPPFLRPPGLPSALRGPMPRLLPPGPPPGRPPGPPPGPPPGLPPG 447 Query: 426 PPP 418 PPP Sbjct: 448 PPP 450 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PP P P P P PPP P P PPP PP G PP Sbjct: 425 PPGPPPGRPPGPPPGPPPGLPPGPPPRGP--PPRLPPPAPPGMPPPPPPPRAGPPRMAPP 482 Query: 357 XFFF 346 F Sbjct: 483 LSLF 486 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPPPPPPXXX-PXPPP-XXPPXXGGXXXXXXPPGXP 725 PPP G P PPP PP P PPP PP PP P Sbjct: 440 PPPGLPPGPPPRGPPPRLPPPAPPGMPPPPPPPRAGPPRMAPPLSLFPPPLNP 492 >UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 972 Score = 57.2 bits (132), Expect = 5e-07 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPP PP P PPPPP P P P P P PP Sbjct: 848 PPPPPPTRPPPPPPTRPPPPPPTRPPVTQKPYTRPPPPP-PTFPPVAPSTPRPPPYLPP 905 Score = 54.8 bits (126), Expect = 3e-06 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PP P PPP PP P PPPPP Sbjct: 493 PPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTR 552 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P P Sbjct: 553 P-PTRPPPPPTQPSTYLP 569 Score = 52.4 bits (120), Expect = 1e-05 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP--PP 742 PPPPP PPPPP P PPP P P P PP PP Sbjct: 707 PPPPPTRP---PVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPP 763 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP PP P P PP Sbjct: 764 QPPVTRPPPPPPTRPPPPPP 783 Score = 52.0 bits (119), Expect = 2e-05 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPP---XXGGXXXPXAPXXXAXPPPP 739 PPPPP PPPPP P PPP P P P PPPP Sbjct: 593 PPPPPTRP---PVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPP 649 Query: 740 P--XPPXPXAGPPXPAAPXXXPP 802 P PP P PP P PP Sbjct: 650 PTRPPPPPPTRPPVTQTPYTRPP 672 Score = 52.0 bits (119), Expect = 2e-05 Identities = 28/80 (35%), Positives = 28/80 (35%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPP PP P PP PP P P P PP Sbjct: 779 PPPPPTRPPVTQTPYTRPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPT 838 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P P P P PP Sbjct: 839 RPPQPPVTRPPPPPPTRPPP 858 Score = 51.6 bits (118), Expect = 2e-05 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 4/81 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP----PXXGGXXXPXAPXXXAXPPP 736 PPPPP PPPPP P PPP P P P P PPP Sbjct: 796 PPPPPTRP---PVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPP 852 Query: 737 PPXPPXPXAGPPXPAAPXXXP 799 P PP P P P P P Sbjct: 853 PTRPPPPPPTRPPPPPPTRPP 873 Score = 51.2 bits (117), Expect = 3e-05 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P PPP P P P PP P Sbjct: 529 PPPPPTRP---PVTQTPYTRPPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPP 585 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 586 PPPPTRPPPP--PPTRPP 601 Score = 50.8 bits (116), Expect = 4e-05 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PP P PP PP P P PPPP P Sbjct: 813 PPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPPPPPTRP 872 Query: 749 P---XPXAGPPXPAAPXXXPP 802 P P PP P P PP Sbjct: 873 PVTQKPYTRPPPP--PPTFPP 891 Score = 50.0 bits (114), Expect = 8e-05 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP P PPP P P AP P PP PP P P P P PP Sbjct: 477 PPPPPTRPPTRPPPTRPPP----PPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPP 530 Score = 50.0 bits (114), Expect = 8e-05 Identities = 30/83 (36%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP-XPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PP PP P PPPP PP P PPPPP Sbjct: 671 PPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTR 730 Query: 749 PXPXAGPPXPA-----APXXXPP 802 P P PP P+ AP PP Sbjct: 731 P-PTRPPPQPSTYLPPAPPTRPP 752 Score = 49.6 bits (113), Expect = 1e-04 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-X 745 PPPPP PPPPPP P PPP PP PPPPP Sbjct: 751 PPPPPTRPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPV--------TQTPYTRPPPPPTR 802 Query: 746 PPXPXA----GPPXPAAPXXXPP 802 PP PP P P PP Sbjct: 803 PPVTQTPYTRPPPPPTRPPTRPP 825 Score = 49.2 bits (112), Expect = 1e-04 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 9/68 (13%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXG---GXXXPXAPXXXAXPPPPP------XPPXPXAGPPXP 778 PPPPPP P PPP PP P PPPPP PP P PP P Sbjct: 520 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQP 579 Query: 779 AAPXXXPP 802 PP Sbjct: 580 PVTRPPPP 587 Score = 49.2 bits (112), Expect = 1e-04 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP PPP PP P PP PP P P P PP Sbjct: 576 PPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPT 635 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P P P P PP Sbjct: 636 RPPQPPVTRPPPPPPTRPPP 655 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 6/65 (9%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP------XPPXPXAGPPXPAAP 787 PP PP P PPP PP P PPPPP PP P PP P Sbjct: 637 PPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVT 696 Query: 788 XXXPP 802 PP Sbjct: 697 RPPPP 701 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/62 (38%), Positives = 24/62 (38%), Gaps = 3/62 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXG---GXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 PPPPPP P PPP PP P PPP P P A P P P Sbjct: 698 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTR 757 Query: 797 PP 802 PP Sbjct: 758 PP 759 Score = 48.0 bits (109), Expect = 3e-04 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP---PPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PP PP P PP P PP P P PPPP Sbjct: 724 PPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPPQPPVTRPPPPPPTRPPPPPP 783 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 PP P P PP Sbjct: 784 TRPPVTQTPYTRPPPPPTRPP 804 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = +2 Query: 626 PPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPP PP P PP PP P AP PP PP P P P P P Sbjct: 478 PPPPTRPPTRPPPTRPPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPP 537 Score = 46.4 bits (105), Expect = 0.001 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPPP P P PP PP P P PPPP Sbjct: 546 PPPPPTR-------PPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPT 598 Query: 743 XPPXPXA----GPPXPAAPXXXPP 802 PP PP P P PP Sbjct: 599 RPPVTQTPYTRPPPPPTRPPTRPP 622 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 5/64 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPP---XXGGXXXPXAPXXXAXPPPPP--XPPXPXAGPPXPAAPX 790 PP PP P PPP P P P PPPPP PP P PP P Sbjct: 484 PPTRPPPTRPPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPY 543 Query: 791 XXPP 802 PP Sbjct: 544 TRPP 547 Score = 45.6 bits (103), Expect = 0.002 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-----PPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP PPPPPP P PP PP P AP P Sbjct: 645 PPPPPPT-----------RPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAP-----PT 688 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PP PP PP P P PP Sbjct: 689 RPPKPPVTRPPPPPPTRPPPPPP 711 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP PPP PP P PP PP P AP PP Sbjct: 637 PPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVT 696 Query: 743 XPPXPXAGPPXPAAPXXXP 799 PP P P P P P Sbjct: 697 RPPPPPPTRPPPPPPTRPP 715 Score = 43.6 bits (98), Expect = 0.007 Identities = 29/86 (33%), Positives = 30/86 (34%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP---PPP 739 PPPPP PP PP PPP PP P P P PPP Sbjct: 557 PPPPPTQPS----TYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPP 612 Query: 740 PXPPXPXAGPPXPA-----APXXXPP 802 P P PP P+ AP PP Sbjct: 613 PPTRPPTRPPPQPSTYLPPAPPTRPP 638 Score = 43.6 bits (98), Expect = 0.007 Identities = 22/62 (35%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PP PP + P P PPPPP P P PPP Sbjct: 813 PPPPPTRPPTRPPPQPSTYLPPAPPT------RPPQPPVTRPPPPPPTRPPPPPPTRPPP 866 Query: 420 PP 415 PP Sbjct: 867 PP 868 Score = 42.7 bits (96), Expect = 0.011 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP---PPPPXPXXPXXPP 430 PPPP T PPPPP P PP PPPP P P PP Sbjct: 653 PPPPPPTRPPVTQTPYTR--PPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPPPPP 710 Query: 429 PPPPP 415 P PP Sbjct: 711 PTRPP 715 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPP---PPPPXPXXPXXPPPPPPP 415 PPPPP P PP PPPP P P PPP PP Sbjct: 493 PPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPP 537 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPP---PPPPXPXXPXXPPPPPPP 415 PPPPP P PP PPPP P P PPP PP Sbjct: 557 PPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPP 601 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 + PPPP T PPPP P P P PP P P PP Sbjct: 591 RPPPPPPTR----PPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPP 646 Query: 426 PPPP 415 PPPP Sbjct: 647 PPPP 650 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 + PPPP T PPPP P P P PP P P PP Sbjct: 795 RPPPPPTR-----PPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPP 849 Query: 426 PPPP 415 PPPP Sbjct: 850 PPPP 853 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 + PPPP T P PP P P PPPPPP P PPP Sbjct: 812 RPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPP--TRPPPPPP 869 Query: 426 PPPP 415 PP Sbjct: 870 TRPP 873 Score = 41.5 bits (93), Expect = 0.026 Identities = 25/68 (36%), Positives = 25/68 (36%), Gaps = 6/68 (8%) Frame = +2 Query: 626 PPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPP---PXPPXP-XAGPPXPAAP 787 PP PP PG P P PP P PP P P PP P PP P P Sbjct: 178 PPTRPPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPPPPIQTRPPPPTTP 237 Query: 788 XXXPPXXG 811 PP G Sbjct: 238 RPRPPTSG 245 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP---PPPPPP 415 PPPPP + P P PPPPP P P PPPPPP Sbjct: 848 PPPPPPT-----RPPPPPPTRPPPPPPTRPPVTQKPYTRPPPPPP 887 Score = 40.7 bits (91), Expect = 0.046 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PP PP P P PP P P P PPPPP Sbjct: 724 PPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRP-PTRPPQPPVTRPPPPPPTRPPPPP 782 Query: 420 P 418 P Sbjct: 783 P 783 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PP PP PPP PP G P PP P PP PP P P Sbjct: 165 PPSPPQTTRTFLPPPTRPPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPP 224 Query: 800 P 802 P Sbjct: 225 P 225 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXP-GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPPPPP P P P PP P PPPP P Sbjct: 864 PPPPPPTRPPVTQKPYTRPPPPPPTFPPVAPSTPRPPPYLPPSSPRPTYVTVTAPPPPSP 923 Score = 39.5 bits (88), Expect = 0.11 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 10/52 (19%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPP--PXPXXPXXPP--------PPPPP 415 PPPPP + P P PPPPP P P P PP PPPPP Sbjct: 751 PPPPPTRP--PTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPP 800 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP--PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP T PPP PP P PP PP P P PP Sbjct: 528 PPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQP--PVTRPP 585 Query: 426 PPPP 415 PPPP Sbjct: 586 PPPP 589 Score = 38.7 bits (86), Expect = 0.19 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 9/71 (12%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP------PPXXXGXXXKXPXPXXXXXPP---PPPPXPX 448 PPPP T PPP PP P PP PPPP P Sbjct: 592 PPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPT 651 Query: 447 XPXXPPPPPPP 415 P PPP PP Sbjct: 652 RPPPPPPTRPP 662 Score = 38.7 bits (86), Expect = 0.19 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 7/69 (10%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPP--PPXXXGXXXKXPXPXXXXXPPPPPPX--PXXPXXP 433 PPPP T PPP PP P PPPPP P P P Sbjct: 706 PPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPPQP 765 Query: 432 P---PPPPP 415 P PPPPP Sbjct: 766 PVTRPPPPP 774 Score = 38.3 bits (85), Expect = 0.25 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 + PPPP T PPPP P P PP P P PP Sbjct: 652 RPPPPPPTR----PPVTQTPYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPP 707 Query: 426 PPPP 415 PPPP Sbjct: 708 PPPP 711 Score = 37.9 bits (84), Expect = 0.33 Identities = 25/79 (31%), Positives = 26/79 (32%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP P G PP P P P PPP PP P PP P Sbjct: 132 PPAPKTPGYSYPQPSPPFVQPPKTPAPQPRPTPPPSPPQTTRTFLP--------PPTRPP 183 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P P P P+ P PP Sbjct: 184 PQQPGYSYPQPSPPFVQPP 202 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PP PP P PPP PP Sbjct: 489 PPTRPPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPPPTRPP 529 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PP PP P PPP PP Sbjct: 553 PPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPP 593 Score = 37.5 bits (83), Expect = 0.43 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP--- 431 PPPP P PP P P PPPPP TP Sbjct: 611 PPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTR 670 Query: 430 PPPPP 416 PPPPP Sbjct: 671 PPPPP 675 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP P PP PP P PPP PP Sbjct: 667 PYTRPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPPTRPP 707 Score = 37.5 bits (83), Expect = 0.43 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 2/66 (3%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP- 430 + PPPP T PPPP P P P PP P P PP Sbjct: 705 RPPPPPPTR----PPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPT 760 Query: 429 -PPPPP 415 PP PP Sbjct: 761 RPPQPP 766 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP P P P PP T PPPPPP Sbjct: 547 PPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPPP 589 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP + P P P PP T PPPPPP Sbjct: 610 PPPPPTRP--PTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPP 650 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP + P P P PP T PPPPPP Sbjct: 813 PPPPPTRP--PTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPP 853 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/78 (26%), Positives = 22/78 (28%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP PP P P PPPP P P P P P Sbjct: 182 PPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPPPPIQTRPPPPTTPRPRP 241 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P+ P P Sbjct: 242 PTSGYSYPQPSIPYNPAP 259 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPPPPP 421 PPPPP P P PPPP P PPPPP Sbjct: 520 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPP 561 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 5/67 (7%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXX--KXPXXPXXXXXPPPPPXXXXXXXTP- 431 PPPP PPPPP + P PPPPP TP Sbjct: 751 PPPPPTRPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPVTQTPY 810 Query: 430 --PPPPP 416 PPPPP Sbjct: 811 TRPPPPP 817 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPP--PXXXXXXXTPPPPPPP 413 PPPPP + P P PPPP P T PPPPPP Sbjct: 849 PPPPPT------RPPPPPPTRPPPPPPTRPPVTQKPYTRPPPPPP 887 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = -2 Query: 552 TXXXPPPP--PXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPP--PPPPP 415 T PPPP P P P P PPP P P PP PPPPP Sbjct: 704 TRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPP 755 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 2/65 (3%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPX--PXXXXXPPPPPPXPXXPXXP 433 + PPPP T P PP + P P PPPPP P P Sbjct: 723 RPPPPPTRPPTRPPPQPSTYLPPAPPTRPPPPPTRPPTRPPQPPVTRPPPPPPTRPPPPP 782 Query: 432 PPPPP 418 P PP Sbjct: 783 PTRPP 787 Score = 35.9 bits (79), Expect = 1.3 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 4/65 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP----PPXPXXPXXP 433 PPPP T P PP P P PPPP PP P Sbjct: 493 PPPPPTAPS-------TYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTR 545 Query: 432 PPPPP 418 PPPPP Sbjct: 546 PPPPP 550 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP--XPXXPXXPPPPP--PP 415 PPPPP + P PPPPPP P P P PPP PP Sbjct: 864 PPPPPPTRPPVTQKP----YTRPPPPPPTFPPVAPSTPRPPPYLPP 905 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPP----PPXPXXPXXPPPPPP 418 T P PP P P PPPP PP P PPPPP Sbjct: 566 TYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPP 614 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPP----PPXPXXPXXPPPPPP 418 T P PP P P PPPP PP P PPPPP Sbjct: 680 TYLPPAPPTRPPKPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPP 728 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 7/53 (13%) Frame = -2 Query: 552 TXXXPP--PPPXXXGXXXKXPXPXXXXXPPPPPP-----XPXXPXXPPPPPPP 415 T PP PPP G P P P P PP P P P PPPP Sbjct: 174 TFLPPPTRPPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPPPP 226 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -2 Query: 552 TXXXPPPP--PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 T PPPP P P P P PPP P P PP PP Sbjct: 526 TRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPPTQPSTYLPPAPP 573 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP-- 428 PPPP PP PP + P PPPPP P Sbjct: 610 PPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYT 669 Query: 427 -PPPPP 413 PPPPP Sbjct: 670 RPPPPP 675 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP---PPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPP P P P PP Sbjct: 856 PPPPPPTRPPPPPPTRPPVTQKPYTRPPPPPPTFPPVAPSTPRPP 900 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP T PPPPP P P P P P PPPP Sbjct: 864 PPPPPPTRPPVTQKPYTRP-PPPPPTFPPVAPSTPRPPPYLPPSSPRPTYVTVTAPPPPS 922 Query: 420 P 418 P Sbjct: 923 P 923 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP---PPPPP 416 P PP P P PPPPP TP PPPPP Sbjct: 506 PAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPP 550 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P PP PP PPPPP Sbjct: 546 PPPPPTRPPTRPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPP 588 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP---PPPPP 416 P PP P P PPPPP TP PPPPP Sbjct: 570 PAPPTRPPQPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPP 614 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP---PPPPP 416 P PP P P PPPPP TP PPPPP Sbjct: 684 PAPPTRPPKPPVTRPPPPPPTRPPPPPPTRPPVTQTPYTRPPPPP 728 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PP--PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PPP P PP PP P P PPPPPP Sbjct: 484 PPTRPPPTRPPPPPTAPSTYLPPAPPTRPPQP--PVTRPPPPPP 525 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P K P P PPP PP PPP PP Sbjct: 143 PQPSPPFVQPPKTPAPQPRPTPPPSPPQTTRTFLPPPTRPP 183 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = -2 Query: 552 TXXXPPPP--PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP---PPPPP 415 T PPPP P + P P PP P P PP PPPPP Sbjct: 474 TRTPPPPPTRPPTRPPPTRPPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPP 524 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPPPPP 421 PPPPP P P PPPP P PPP P Sbjct: 584 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQP 625 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPPPPP 421 PPPPP P P PPPP P PPP P Sbjct: 698 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQP 739 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 1/61 (1%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP-PPXPXXPXXPPPPP 421 PPP G PP P P P PPPP P P P P P Sbjct: 182 PPPQQPGYSYPQPSPPFVQPPRPTPPPQTRPPPPRPQTTPRPPPPIQTRPPPPTTPRPRP 241 Query: 420 P 418 P Sbjct: 242 P 242 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P P G P PP PP P PP P PP Sbjct: 444 PPPPVTPKPQSPFQ----GYTYPKPDTPFTLPPATRTPPPPPTRPPTRPPPTRPPP 495 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = -2 Query: 552 TXXXPPPP--PXXXGXXXKXPXPXXXXXP--PPPPPXPXXPXXPP--PPPPP 415 T PPPP P P P P PPP P P PP PP PP Sbjct: 590 TRPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPQPSTYLPPAPPTRPPQPP 641 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXP---PPPPPXPXXPXXPPPPP--PP 415 PPPPP P P PPPPP PP PP PP Sbjct: 645 PPPPPPTRPPPPPPTRPPVTQTPYTRPPPPPTRPSTYLPPAPPTRPP 691 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -1 Query: 541 PPPPPXXXGEXXKX-----PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP T PPPPPP Sbjct: 671 PPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPPP-------TRPPPPPP 711 Score = 33.1 bits (72), Expect = 9.3 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 5/78 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPP----XXXPGPPPPXPPXXGGXXXPXAPXXXA-XPP 733 PPPPP PPPPP P PP PP P P PP Sbjct: 849 PPPPPTRP---PPPPPTRPPPPPPTRPPVTQKPYTRPPPPPPTFPPVAPSTPRPPPYLPP 905 Query: 734 PPPXPPXPXAGPPXPAAP 787 P P P P +P Sbjct: 906 SSPRPTYVTVTAPPPPSP 923 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 57.2 bits (132), Expect = 5e-07 Identities = 28/78 (35%), Positives = 29/78 (37%) Frame = +2 Query: 536 GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPX 715 GG + PPPP PPPPPP GP PP PP P AP Sbjct: 1055 GGGQQLQSPEFPPPPADTSAA----FIAAPPPPPPPAPVTGPTPPPPPPPPPPPPPPAPV 1110 Query: 716 XXAXPPPPPXPPXPXAGP 769 PP PP PP P Sbjct: 1111 TGPTPPAPPLPPGSLGSP 1128 Score = 54.8 bits (126), Expect = 3e-06 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 5/75 (6%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXX-----PGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 P GGG PPPP P PPPP P G P P PPPPP Sbjct: 1050 PRWQPGGGQQLQSPEFPPPPADTSAAFIAAPPPPPPPAPVTGPTPPPPPP-----PPPPP 1104 Query: 743 XPPXPXAGPPXPAAP 787 PP P GP PA P Sbjct: 1105 PPPAPVTGPTPPAPP 1119 Score = 50.8 bits (116), Expect = 4e-05 Identities = 26/73 (35%), Positives = 27/73 (36%) Frame = -2 Query: 633 GGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX 454 GGG + PPPP PPPPP P P PPPPPP Sbjct: 1055 GGGQQLQSPEFPPPPADTSAA------FIAAPPPPPPPAPVTGPTPPPPPPPPPPPPPPA 1108 Query: 453 PXXPXXPPPPPPP 415 P PP PP P Sbjct: 1109 PVTGPTPPAPPLP 1121 Score = 44.8 bits (101), Expect = 0.003 Identities = 31/99 (31%), Positives = 31/99 (31%), Gaps = 23/99 (23%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP------------------PXPPXX---- 685 PPPP PPPPPP P P P P PP Sbjct: 876 PPPPTSAHALQVNGGSFPPPPPPPPPPPAPVPMSQAVHCSGLKQALKERFPSPPRDLLCL 935 Query: 686 -GGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 GG P PPPPP PP P PP P P Sbjct: 936 NGGLEESPPPAPTPSPPPPPPPPPPPPPPPPPQQQFQLP 974 Score = 44.4 bits (100), Expect = 0.004 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP C PPP P PPPP PP AP P P P Sbjct: 1235 PSPPPE-------CACFPPPPPASELFPPPPPPPPPPAGSEAHNRGAPKVAVVNPQPQAP 1287 Query: 749 PXPXAGPPXP 778 P P PP P Sbjct: 1288 PPPP--PPVP 1295 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/67 (34%), Positives = 26/67 (38%), Gaps = 8/67 (11%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXA--------PXXXAXPPPPPXPPXPXAGPPXPA 781 PPPP P PPPP PP G P A PPPPP P + P + Sbjct: 1246 PPPPASELFPPPPPPPPPPAGSEAHNRGAPKVAVVNPQPQAPPPPPPPVPLVSSSPWGKS 1305 Query: 782 APXXXPP 802 + PP Sbjct: 1306 SLKKTPP 1312 Score = 42.3 bits (95), Expect = 0.015 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = -2 Query: 573 GGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXX 394 GG + PPPP P P PPP P P PPPPPPP Sbjct: 1055 GGGQQLQSPEFPPPPADTSAAFIAAPPPP----PPPAPVTGPTPPPPPPPPPPPPPPAPV 1110 Query: 393 XGXGGGGXXXPP 358 G PP Sbjct: 1111 TGPTPPAPPLPP 1122 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 G + P P PPPPPP P P PPPPPP Sbjct: 937 GGLEESPPPAPTPSPPPPPPPP--PPPPPPPPP 967 Score = 41.5 bits (93), Expect = 0.026 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 G P P PPPPP P PPPPPPP Sbjct: 1231 GGDFPSPPPECACFPPPPPASELFPPPPPPPPPP 1264 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 6/59 (10%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXP------PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAA 784 P PP P PP P G P + PPPPP PP P PP P+A Sbjct: 719 PLPPQPEPLHAPPAPHLLQQQQLTSSGSNHIPPQQQQTSPPPPPPPPPPPPPPPPPPSA 777 Score = 39.9 bits (89), Expect = 0.081 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 PPPPPP P P PPPPPPP Sbjct: 758 PPPPPPPPPPP--PPPPPPP 775 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPP P P PPPP PP P PPP P P P P Sbjct: 943 PPPAPTPSPPPPPPPPPPPPPPPPPQQQFQLPSQFPPPPPTARIFLRPPPTLP 995 Score = 39.1 bits (87), Expect = 0.14 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPPPP P P PPPPPP Sbjct: 751 PQQQQTSPPPPPPPPPPPPPPPPPP 775 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P P G P AP PPP G P P PP Sbjct: 843 PPPPPPPSMPTPGSAMAVLRLGPPSPAAPPAFIPPPPTSAHALQVNGGSFPPPPPPPPP 901 Score = 38.3 bits (85), Expect = 0.25 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPP 415 PPP P P P PPPPPPP Sbjct: 943 PPPAPTPSPPPPPPPPPPP 961 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXP---PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PP GG P P PPPPP P PPP PP PP P Sbjct: 928 PPRDLLCLNGGLEESPPPAPTPSPPPPPPPPPPPPPPPPPQQQFQLPSQFPPPPP 982 Score = 37.5 bits (83), Expect = 0.43 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP G PP P PPPP + PPPPP P Sbjct: 846 PPPPSMPTPGSAMAVLRLGPPSPAAPPAFIPPPPTSAHA------LQVNGGSFPPPPPPP 899 Query: 749 PXPXAGPPXPAA 784 P P A P A Sbjct: 900 PPPPAPVPMSQA 911 Score = 37.1 bits (82), Expect = 0.57 Identities = 25/86 (29%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP-GPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP G P P PPPP PP P PPP Sbjct: 1256 PPPPPPPPPAGSEAHNRGAPKVAVVNPQPQAPPPPPPPVPLVSSSPWGKSSLKKTPPPTL 1315 Query: 746 PPXPXAGP-PXPAAPXXXPPXXGXGG 820 A P P P +P G G Sbjct: 1316 GRRSNATPEPPPLSPPPATSPKGGSG 1341 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX----PXXPPPPPP 418 PPP P P P PPPPPP P P PPPPP Sbjct: 943 PPPAPTP-----SPPPPPPPPPPPPPPPPPQQQFQLPSQFPPPPP 982 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP 769 PPPPPP P PPP P P PPP P + P Sbjct: 954 PPPPPPPPPPPPPPQQQFQLPSQFPPPPPTARIFLRPPPTLPKQHSLP 1001 Score = 35.5 bits (78), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 490 PXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPPPP PPPPPPP Sbjct: 1239 PECACFPPPPPASELFPPPPPPPPPP 1264 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 533 PPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPP P P PPPPP + PPPPP Sbjct: 943 PPPAPTPSPPPPPPPPPPPPPPPPPQQQFQLPSQFPPPPP 982 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 559 GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 G PPP P P P PPPPP + PPPPP Sbjct: 937 GGLEESPPPAPTPS---PPPPPPPPPPPPPPPPPQQQFQLPSQFPPPPP 982 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 6/59 (10%) Frame = +2 Query: 629 PPPPPXXXP---GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP---PXPAAP 787 PPP P P PP P PP P PP P P P P P P P Sbjct: 666 PPPQPQSQPVQQPPPQPQPPVIQQQPLQAPPQLQRHHPPQPSQPPPAPQPEQYPLPPQP 724 Score = 33.1 bits (72), Expect = 9.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPP PPPPPPP Sbjct: 1235 PSPPPECACFPPPPPASELFPPPPPPPPP 1263 Score = 30.3 bits (65), Expect(2) = 0.88 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 P PP P P PPP PPPPPP + Sbjct: 926 PSPPRDLLCLNGGLEESPPPAPTPSPPPPPPPPPPPPPPPPPQQ 969 Score = 25.0 bits (52), Expect(2) = 0.88 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPP 527 A PPPP G PPPPP Sbjct: 873 AFIPPPPTSAHALQVNGGSFPPPPPPPP 900 >UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza sativa|Rep: Diaphanous homologue-like - Oryza sativa subsp. japonica (Rice) Length = 1391 Score = 57.2 bits (132), Expect = 5e-07 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-----PPPPXPPXXGGXXXPXAPXXXAXPP 733 PP PP G PPPPPP PG PPP PP G P P PP Sbjct: 752 PPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPPTPPPPPPAAPGQQAPAVP-----PP 806 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 PPP PP G P PP Sbjct: 807 PPPPPPPMVPGMQTRPIPPPPPP 829 Score = 52.4 bits (120), Expect = 1e-05 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP PP PP P PPPPP PP G P P PP Sbjct: 735 PPPPPPFPVSSFSPPQPPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPPTPPPPPP 793 Score = 52.0 bits (119), Expect = 2e-05 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 5/66 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-----PPPXPPXXGGXXXPXAPXXXAXPP 733 PPPPP G PPPPPP PG PPP PP P P Sbjct: 788 PPPPPPAAPGQQAPAVPPPPPPPPPPMVPGMQTRPIPPPPPPSQTNSLVSSFPSTSKRIP 847 Query: 734 PPPXPP 751 PPP PP Sbjct: 848 PPPPPP 853 Score = 51.6 bits (118), Expect = 2e-05 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPX 745 P PPP PPPPPP P P P P AP A PPPP Sbjct: 749 PQPPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPPTPPPPPPAAPGQQAPAVPPPPP 808 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P P P PP Sbjct: 809 PPPPPMVPGMQTRPIPPPP 827 Score = 51.2 bits (117), Expect = 3e-05 Identities = 32/89 (35%), Positives = 32/89 (35%), Gaps = 11/89 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---------PPPPXPPXXGGXXXPXAPXXX 721 PPPPP PPP PP PG PPPP PP G P P Sbjct: 732 PPPPPPPPPFPVSSFSPPQPPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPPTPP-- 789 Query: 722 AXPPPPPXP--PXPXAGPPXPAAPXXXPP 802 PPPP P P PP P P P Sbjct: 790 --PPPPAAPGQQAPAVPPPPPPPPPPMVP 816 Score = 48.0 bits (109), Expect = 3e-04 Identities = 28/65 (43%), Positives = 28/65 (43%), Gaps = 6/65 (9%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXP-----PXXGGXXXPXA-PXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPPP P PPPP P P P A P A P PPP PP P P P Sbjct: 729 PPPPPP---PPPPPPFPVSSFSPPQPPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTP 785 Query: 788 XXXPP 802 PP Sbjct: 786 PTPPP 790 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/64 (39%), Positives = 25/64 (39%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX--PXXPPP 427 PPP G PPPPP K P PPPPP P P PPP Sbjct: 751 PPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPPTP----PPPPPAAPGQQAPAVPPP 806 Query: 426 PPPP 415 PPPP Sbjct: 807 PPPP 810 Score = 43.6 bits (98), Expect = 0.007 Identities = 29/103 (28%), Positives = 30/103 (29%), Gaps = 1/103 (0%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPP-PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXX 322 P P PPPPPP P PP PPP P PP + Sbjct: 727 PAPPPPPPPPPPPPFPVSSFSPPQPPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPP 786 Query: 321 XXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 PG PPPP PP P P P P Sbjct: 787 TPPPPPPAAPGQQAPA-VPPPPPPPPPPMVPGMQTRPIPPPPP 828 Score = 43.2 bits (97), Expect = 0.009 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP P PPP P PPPPP TPP P Sbjct: 729 PPPPPPPPPPPPFPVSSFSPPQPPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPPTP 788 Query: 421 PPP 413 PPP Sbjct: 789 PPP 791 Score = 43.2 bits (97), Expect = 0.009 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G A PPP G PPPP + P P PPPP Sbjct: 761 GLQASPVPPPPPPPPPPMIPGMKTPPTPPPPPPAAPGQQAPAVPPPPPPPPPPMVPGMQT 820 Query: 439 XTPPPPPPP 413 PPPPPP Sbjct: 821 RPIPPPPPP 829 Score = 39.9 bits (89), Expect = 0.081 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 8/50 (16%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXP--------XXPXXPPPPPPP 415 PPPPP P P PP PPP P P PPPPPPP Sbjct: 729 PPPPPPPP---PPPPFPVSSFSPPQPPPQPPSAVPGLQASPVPPPPPPPP 775 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 7/63 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP-------PXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP G P PPPPP P P PPP PP G PP Sbjct: 769 PPPPPPPPPMIPG---MKTPPTPPPPPPAAPGQQAPAVPPPPPPPPPPMVPGMQTRPIPP 825 Query: 717 GXP 725 P Sbjct: 826 PPP 828 Score = 39.1 bits (87), Expect = 0.14 Identities = 21/50 (42%), Positives = 22/50 (44%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP PP P P PP PP P P A P A+P PP Sbjct: 727 PAPPPPPPPPP----PPPFPVSSFSPPQPP-PQPPSAVPGLQASPVPPPP 771 Score = 39.1 bits (87), Expect = 0.14 Identities = 24/71 (33%), Positives = 24/71 (33%), Gaps = 9/71 (12%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX-------- 445 PPPP G PPPPP P P PPPPP Sbjct: 788 PPPPPPAAPGQQAPAVPPPPPPPPPPMVPGMQTRPIP-----PPPPPSQTNSLVSSFPST 842 Query: 444 -PXXPPPPPPP 415 PPPPPPP Sbjct: 843 SKRIPPPPPPP 853 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P PP G P PPPPPP P PP PP G PP P Sbjct: 749 PQPPPQPPSAVPGLQASPVPPPPPPPPPPMIPGMKTPPTPPPPPPAAPGQQAPAVPPPPP 808 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-----XXXPXPPPXXP 677 P PPPP G A P PPPPPP P PPP P Sbjct: 785 PPTPPPPPPAAPGQQAPAVPPPPPPPPPPMVPGMQTRPIPPPPPP 829 Score = 38.7 bits (86), Expect = 0.19 Identities = 31/99 (31%), Positives = 32/99 (32%), Gaps = 21/99 (21%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP----------PPXXXPGPPPPXPPXXGGXXXPXAPXX 718 PPPPP G PPPP P PPPP PP P Sbjct: 807 PPPPPPPMVPGMQTRPIPPPPPPSQTNSLVSSFPSTSKRIPPPPPPPSQTSSLVSSLPSS 866 Query: 719 X-----AXPPPPPXPP------XPXAGPPXPAAPXXXPP 802 A P PPP PP + P P AP PP Sbjct: 867 RKGNDVAAPRPPPPPPLYSRSSHVTSAPSAPPAPPLPPP 905 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/71 (29%), Positives = 23/71 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PPPP P AP + PP PP P Sbjct: 847 PPPPPPPSQTSSLVSSLPSSRKGNDVAAPRPPPPPPLYSRSSHVTSAP---SAPPAPPLP 903 Query: 749 PXPXAGPPXPA 781 P G P+ Sbjct: 904 PPKLVGASKPS 914 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 8/50 (16%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNP--------PPPPPP 414 PPPPP P P PP PP L P PPPPPP Sbjct: 878 PPPPPLYSRSSHVTSAPSAPPAPPLPPPKLVGASKPSQEQMITWPPPPPP 927 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 11/63 (17%) Frame = +2 Query: 626 PPPPP-----------PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP 772 PPPPP P P PP P P G PPPPP PP + Sbjct: 878 PPPPPLYSRSSHVTSAPSAPPAPPLPPPKLVGASKPSQEQMITWPPPPPPGPPPKNSSNS 937 Query: 773 XPA 781 P+ Sbjct: 938 LPS 940 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 7/64 (10%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXX-------GGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 P PP P PPPP P AP P PP PP P PP P + Sbjct: 688 PTQPPL--PPPPPPIQPTLISNSIYSSTSSVVSAPLKRGQSPAPPPPPPPPPPPPFPVSS 745 Query: 788 XXXP 799 P Sbjct: 746 FSPP 749 >UniRef50_Q9VC23 Cluster: CG7016-PA; n=2; Sophophora|Rep: CG7016-PA - Drosophila melanogaster (Fruit fly) Length = 362 Score = 57.2 bits (132), Expect = 5e-07 Identities = 41/124 (33%), Positives = 41/124 (33%), Gaps = 1/124 (0%) Frame = +2 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXGGG-GGGXXXXXGXGXFXXFPXXXGGGGGXXXVX 556 P P G GG G G G G G P GGGG Sbjct: 109 PTPPGWPPGWQWGAGGNQNQPGFDWVQTGFAPGWNGGGGQGPGWNGPGWNGGGG------ 162 Query: 557 XXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPP P GGG PPP P GPPPP P GG P P PP Sbjct: 163 --RGPPPRPGFNGGGP-------PPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPP 213 Query: 737 PPXP 748 PP P Sbjct: 214 PPRP 217 Score = 56.8 bits (131), Expect = 7e-07 Identities = 41/132 (31%), Positives = 43/132 (32%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGG G G G GGGG G G P G GG PPP P G Sbjct: 145 GGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGP-------PPPMPGWNG 197 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPX 775 GG PPP P GPPPP P GG P P P P Sbjct: 198 GGP-------PPPRPGWNGGGPPPPRPGWNGGMEQEWDNYPRLPDQPDPNDPNTNWNPDN 250 Query: 776 PAAPXXXPPXXG 811 ++ P G Sbjct: 251 ESSTTPQTPIPG 262 Score = 52.0 bits (119), Expect = 2e-05 Identities = 39/133 (29%), Positives = 39/133 (29%), Gaps = 2/133 (1%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 P G G GP G GGG G PP G GGG P G G Sbjct: 150 PGWNGPGWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNG 209 Query: 630 GGXXXXXXKXPPPPXXGGGGGXXXXXT--XXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP 457 GG PPPP G GG P P P P P P Sbjct: 210 GG--------PPPPRPGWNGGMEQEWDNYPRLPDQPDPNDPNTNWNPDNESSTTPQTPIP 261 Query: 456 XPXXPXXPPPPPP 418 P P P P P Sbjct: 262 GPIFPTTTPKPEP 274 Score = 51.6 bits (118), Expect = 2e-05 Identities = 38/118 (32%), Positives = 39/118 (33%) Frame = -2 Query: 771 GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPP 592 G P G GG P GG GG GPG G GG + PPP Sbjct: 113 GWPPGWQWGAGGNQNQPGFDWVQTGFAPGWNGG-GGQGPGWNGPGWNGG----GGRGPPP 167 Query: 591 PXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 GGG PPP P G P P PPPP PPPP P Sbjct: 168 RPGFNGGG--------PPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPPRP 217 Score = 48.4 bits (110), Expect = 2e-04 Identities = 32/99 (32%), Positives = 32/99 (32%) Frame = -1 Query: 712 GXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPP 533 G W G GGG G G G G G PPP GGG PPP Sbjct: 130 GFDWVQTGFAPGWNGGGGQGP--GWNGPGWNGGGGRGPPPRPGFNGGG---------PPP 178 Query: 532 PPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 P P P PPPP PPPP P Sbjct: 179 PRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPPRP 217 Score = 46.0 bits (104), Expect = 0.001 Identities = 40/128 (31%), Positives = 40/128 (31%), Gaps = 1/128 (0%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G GG G G G GG G PP G GGGP G GG Sbjct: 137 GFAPGWNGGGGQGPGWNGPGWNGG--------GGRGPPPRPGFNGGGPPPPRPGWNGG-- 186 Query: 618 XXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP-PPXPXXP 442 PPPP G GG PPP P G P P P P Sbjct: 187 -----GPPPPMPGWNGG-------GPPPPRPGWNGGGPPPPRPGWNGGMEQEWDNYPRLP 234 Query: 441 XXPPPPPP 418 P P P Sbjct: 235 DQPDPNDP 242 Score = 39.5 bits (88), Expect = 0.11 Identities = 30/116 (25%), Positives = 31/116 (26%) Frame = -2 Query: 771 GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPP 592 GGP G GGG G G PP G GGGP G GG P Sbjct: 174 GGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPPRPGWNGGMEQEWDNYPRL 233 Query: 591 PXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 P P + P P P P P P P P Sbjct: 234 PDQPDPNDPNTNWN------PDNESSTTPQTPIPGPIFPTTTPKPEPTFPTIQPRP 283 Score = 35.1 bits (77), Expect = 2.3 Identities = 34/129 (26%), Positives = 34/129 (26%), Gaps = 6/129 (4%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXX---PPPPPXX 589 GGGG G G GGG G P GGG PPPP Sbjct: 159 GGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPPRPG 218 Query: 590 GGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP---PPPXPPXPX 760 GG P P P P P P P P P P P Sbjct: 219 WNGGMEQEWDNYPRLPDQPDPNDPNTNWNPDNESSTTPQTPIPGPIFPTTTPKPEPTFPT 278 Query: 761 AGPPXPAAP 787 P A P Sbjct: 279 IQPRPTAQP 287 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 57.2 bits (132), Expect = 5e-07 Identities = 25/54 (46%), Positives = 26/54 (48%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPPP P PPPP PP G P PPPPP PP P P+ P Sbjct: 1088 PPPPPPPPPPPPPPPPPPPPGAIGLTAPP----PPPPPPPPPPPLTTLHHPSGP 1137 Score = 44.4 bits (100), Expect(2) = 3e-05 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 PPPPPP P P PPPPPPP Sbjct: 1088 PPPPPPPPPPPPPPPPPPPP 1107 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP PPPPPPP Sbjct: 1088 PPPPPP--------PPPPPPPPPPPPPPGAIGLTAPPPPPPP 1121 Score = 43.6 bits (98), Expect = 0.007 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGG 379 PPPPP P P PPPP P PPPPPPP G G Sbjct: 1091 PPPPPPPPPPPPPPPPPGAIGLTAPPPPPP-----PPPPPPPLTTLHHPSGPSG 1139 Score = 43.2 bits (97), Expect = 0.009 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 641 PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP 772 P P PPPP PP P P PPP PP P PP Sbjct: 1084 PLPHPPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPP 1127 Score = 41.1 bits (92), Expect = 0.035 Identities = 27/85 (31%), Positives = 28/85 (32%), Gaps = 8/85 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX-----PGPPPPXPPXXG---GXXXPXAPXXXA 724 PPPPP G G PPPPPP P P G G + Sbjct: 1101 PPPPPPPGAIGLTAPPPPPPPPPPPPPLTTLHHPSGPSGAHDLSGVLAGIKGGVSLKKTL 1160 Query: 725 XPPPPPXPPXPXAGPPXPAAPXXXP 799 P PP PP P PP P P Sbjct: 1161 GPSIPPPPPPPALPPPSIHTPARAP 1185 Score = 40.7 bits (91), Expect = 0.046 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 600 GXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 G P PPPPPP P PPP PP G PP P Sbjct: 1080 GETTPLPHPPPPPPP-PPPPPPPPPPPPPGAIGLTAPPPPPP 1120 Score = 40.7 bits (91), Expect = 0.046 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 P PPPP P P PPPPPPP Sbjct: 1086 PHPPPPPPPPPPPPPPPPPP 1105 Score = 39.5 bits (88), Expect = 0.11 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXA---XPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P PPPP PP P P A PPPP PP P PP P P G GA Sbjct: 1086 PHPPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPPPPP---PPPPLTTLHHP--SGPSGA 1140 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 7/41 (17%) Frame = -2 Query: 516 GXXXKXPXPXXXXXPPPPPPXPXXPXXP-------PPPPPP 415 G P P PPPPPP P P P PPPPPP Sbjct: 1080 GETTPLPHPPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPP 1120 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP 644 P PPPP G G A P PPPPPP Sbjct: 1097 PPPPPPPPPPPGAIGLTAPPPPPPPPPPP 1125 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P PP P P PPPPPPP Sbjct: 1078 PKGETTPLPHPPPPPPPPPPPPPPPP 1103 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P PPPPP PPPPPPP Sbjct: 1089 PPPPPP----------PPPPPPPPPPPPPGAIGLTAPPPPPPP 1121 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +2 Query: 710 PXXXAXPPPPPXPPXPXAGPPXP------AAPXXXPP 802 P PPPPP PP P PP P AP PP Sbjct: 1084 PLPHPPPPPPPPPPPPPPPPPPPPGAIGLTAPPPPPP 1120 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 PPPPP G P P PPPPPP P P G GG Sbjct: 1103 PPPPPGAIGLTAPPPPPP----PPPPPPPLTTLHHPSGPSGAHDLSGVLAGIKGG 1153 Score = 26.6 bits (56), Expect(2) = 3e-05 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -2 Query: 294 PGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 PG PPPP PP T P GP Sbjct: 1107 PGAIGLTAPPPPPPPPPPPPPLTTLHHPSGP 1137 >UniRef50_Q0D0J9 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 516 Score = 57.2 bits (132), Expect = 5e-07 Identities = 34/82 (41%), Positives = 34/82 (41%), Gaps = 1/82 (1%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXG-XXXPPXXGGXGGGGPGXXXGGG 634 P GG G G GGP G GG G GG A GA G P GG G GGPG GG Sbjct: 224 PGAGGPGAGGPGAGGP--GAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGPTGG 281 Query: 633 GGGXXXXXXKXPPPPXXGGGGG 568 G G GG GG Sbjct: 282 GPGGVSTDLSTGGTSGAGGPGG 303 Score = 54.8 bits (126), Expect = 3e-06 Identities = 34/80 (42%), Positives = 35/80 (43%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXG-XXXPPXXGGXGGGGPG-XXXGGGGG 628 GG G +G GGP G GG G GG A GA G P GG G GGPG G GG Sbjct: 207 GGSGGGGSGAGGP--GAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGP 264 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G P GGG G Sbjct: 265 GAGGPGAGGPGAGPTGGGPG 284 Score = 52.4 bits (120), Expect = 1e-05 Identities = 33/89 (37%), Positives = 34/89 (38%), Gaps = 1/89 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXG-XXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G +G GG G GG G GG A GA G P GG G GGPG G GG Sbjct: 197 GGSGGGGSGGGG--SGGGGSGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGP 254 Query: 624 XXXXXXKXPPPPXXGGGGGXXXXXTXXXP 538 P G GG T P Sbjct: 255 GAGGPGAGGPGAGGPGAGGPGAGPTGGGP 283 Score = 52.4 bits (120), Expect = 1e-05 Identities = 27/63 (42%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGG-XGGGGPGXXXGGG 634 P GG G G GGP G G GG G G G GG G GGPG GGG Sbjct: 249 PGAGGPGAGGPGAGGPGAGGPGAGGPGAGPTGGGPGGVSTDLSTGGTSGAGGPGGGSGGG 308 Query: 633 GGG 625 GG Sbjct: 309 SGG 311 Score = 49.2 bits (112), Expect = 1e-04 Identities = 27/63 (42%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGG-GGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 P GG G G GGP G G GGG GG + G GG GGG G GGG Sbjct: 259 PGAGGPGAGGPGAGGP--GAGPTGGGPGGVSTDLSTGGTSGAGGPGGGSGGGSGGGSGGG 316 Query: 633 GGG 625 GG Sbjct: 317 SGG 319 Score = 45.2 bits (102), Expect = 0.002 Identities = 30/71 (42%), Positives = 30/71 (42%), Gaps = 9/71 (12%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-------GGPG 652 P GG G G GGP G GG G GG A GA G P GG GG GG Sbjct: 239 PGAGGPGAGGPGAGGP--GAGGPGAGGPGAGGPGAGGPGAGPTGGGPGGVSTDLSTGGTS 296 Query: 651 XXXG--GGGGG 625 G GG GG Sbjct: 297 GAGGPGGGSGG 307 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/55 (41%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -2 Query: 786 GAAGXGGPAXGXGGX-GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G +G GGP G GG GGG G G+ G GG GG G GG GG Sbjct: 294 GTSGAGGPGGGSGGGSGGGSGGGSGGGSTGGG---STGGSTGGSTGGSTGGSTGG 345 Score = 41.1 bits (92), Expect = 0.035 Identities = 25/78 (32%), Positives = 26/78 (33%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G + GG GGGG G P GG G GGPG G GG Sbjct: 184 GGDPPGVSTDLSTGGSGGGGSGGGGSGGGGSGAGG---PGAGGPGAGGPGAGGPGAGGPG 240 Query: 621 XXXXXKXPPPPXXGGGGG 568 P G GG Sbjct: 241 AGGPGAGGPGAGGPGAGG 258 Score = 39.1 bits (87), Expect = 0.14 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 4/82 (4%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGX----GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 GG +AG P GG GGGG G G GG G GGPG G Sbjct: 176 GGATGSSAGGDPPGVSTDLSTGGSGGGGSGGGGSGGGGSGA----GGPGAGGPGAGGPGA 231 Query: 633 GGGXXXXXXKXPPPPXXGGGGG 568 GG P G GG Sbjct: 232 GGPGAGGPGAGGPGAGGPGAGG 253 Score = 38.3 bits (85), Expect = 0.25 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 1/76 (1%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXG-GGGGXXXXXPXXXPPPPXX 587 SGGGG GG G GG G G P G G GG P P Sbjct: 199 SGGGGSGGGGSGGGGSGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGG 258 Query: 588 XGGGGXXAXXPXXPPP 635 G GG A P P Sbjct: 259 PGAGGPGAGGPGAGGP 274 Score = 37.5 bits (83), Expect = 0.43 Identities = 26/84 (30%), Positives = 26/84 (30%), Gaps = 3/84 (3%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPP---PPX 586 GGG GGG G G G GG G G P G G G P P Sbjct: 201 GGGSGGGGSGGGGSGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPG 260 Query: 587 XGGGGXXCXXXXXPPPPPPXXXPG 658 GG G P P PG Sbjct: 261 AGGPGAGGPGAGGPGAGPTGGGPG 284 Score = 36.7 bits (81), Expect = 0.75 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 1/87 (1%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXG-GGGGXXXVXXXXXPPPPPXXGG 595 GG GGG G G GGGG G G P G G GG P G Sbjct: 197 GGSGGGGSGGGGSGGGGSGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGA 256 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPPPXP 676 GG P GP P Sbjct: 257 GGPGAGGPGAGGPGAGGPGAGPTGGGP 283 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 GG G+ G G G G GG G G+ G GG GG G G Sbjct: 299 GGPGGGSGGGSGGGSGGGSGGGSTGGGSTGGSTGGSTGGSTGGSTGGSTGDSIG 352 Score = 35.1 bits (77), Expect = 2.3 Identities = 28/94 (29%), Positives = 29/94 (30%), Gaps = 1/94 (1%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXG-GGGGXXXXXPXXXPPPPXX 587 +GG GGGG GGGG G G P G G GG P P Sbjct: 196 TGGSGGGG-------SGGGGSGGGGSGAGGPGAGGPGAGGPGAGGPGAGGPGAGGPGAGG 248 Query: 588 XGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 G GG A P P P P G Sbjct: 249 PGAGGPGAGGPGAGGPGAGGPGAGGPGAGPTGGG 282 Score = 34.3 bits (75), Expect = 4.0 Identities = 26/83 (31%), Positives = 28/83 (33%), Gaps = 5/83 (6%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXG-----GXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 GG +AG P G GG G + G GG GGGG G G Sbjct: 151 GGGASTSAGGDPPGVSTGFSTGSSTGGATGSSAGGDPPGVSTDLSTGGSGGGGSGGG-GS 209 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGGG P G G G Sbjct: 210 GGGGSGAGGPGAGGPGAGGPGAG 232 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/77 (27%), Positives = 22/77 (28%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G + GG G G GG G GG G GG G G Sbjct: 159 GGDPPGVSTGFSTGSSTGGATGSSAGGDPPGVSTDLSTGGSGGGGSGGGGSGGGGSGAGG 218 Query: 621 XXXXXKXPPPPXXGGGG 571 P GG G Sbjct: 219 PGAGGPGAGGPGAGGPG 235 Score = 33.9 bits (74), Expect = 5.3 Identities = 24/67 (35%), Positives = 25/67 (37%), Gaps = 5/67 (7%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAX-----GXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXX 646 P GG G G GGP GG G GG G+ G GG GGG G Sbjct: 269 PGAGGPGAGPTG-GGPGGVSTDLSTGGTSGAGGPG--GGSGGGSGGGSGGGSGGGSTGGG 325 Query: 645 XGGGGGG 625 GG G Sbjct: 326 STGGSTG 332 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 G GGGG G G GG G G G G G GG Sbjct: 198 GSGGGGSGGGGSGGGGSGAGGPGAGGPGAGGPGAGGPGAGG 238 >UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1648 Score = 57.2 bits (132), Expect = 5e-07 Identities = 26/53 (49%), Positives = 26/53 (49%), Gaps = 9/53 (16%) Frame = +2 Query: 626 PPPPPPXXXPG---------PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 PPPPPP PG PPPP PP G P AP PPPPP PP P Sbjct: 986 PPPPPPPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPPPPPPPP 1038 Score = 50.0 bits (114), Expect = 8e-05 Identities = 26/64 (40%), Positives = 26/64 (40%), Gaps = 5/64 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXP--XAPXXXAXPPPPP---XPPXPXAGPPXPAAPX 790 PP P P PPPP PP G P P PPPPP P P G P P P Sbjct: 975 PPQAPGFNGPPPPPPPPPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPPPP 1034 Query: 791 XXPP 802 PP Sbjct: 1035 PPPP 1038 Score = 43.6 bits (98), Expect = 0.007 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G G PPPPP G P PPPPPP PPPPP Sbjct: 988 PPPPPPMPGQGPPGFNGPPPPPPPPPPPGM--NAPVAPGFGGPPPPPP-------PPPPP 1038 Score = 43.2 bits (97), Expect = 0.009 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -1 Query: 628 GXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXX 449 G G PPPP G G PPPPP P P PPPPP Sbjct: 980 GFNGPPPPPPPPPPMPGQGPPGFNGPPPPPPPPPP---PGMNAPVAPGFGGPPPPPP--- 1033 Query: 448 XXXXTPPPPP 419 PPPPP Sbjct: 1034 -----PPPPP 1038 Score = 42.3 bits (95), Expect = 0.015 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 11/53 (20%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX-----------PXXPPPPPPP 415 PPPPP + P PPPPPP P P PPPPPPP Sbjct: 985 PPPPPPPPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPPPPPPP 1037 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 9/54 (16%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXX---------PPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PPPPPP P P PPPPPPP G GG PP Sbjct: 979 PGFNGPPPPPPPPPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPP 1032 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 8/47 (17%) Frame = -2 Query: 474 PPPPPPXPXX--------PXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPPP P P PPPPPPP G GG PP Sbjct: 988 PPPPPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPPPP 1034 Score = 38.7 bits (86), Expect = 0.19 Identities = 22/58 (37%), Positives = 22/58 (37%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP--PXXGGXXXXXXPPGXP 725 P PPPP G G PPPPPP P P P P GG PP P Sbjct: 984 PPPPPPPPPPMPGQGPPGFNGPPPPPPPP---PPPGMNAPVAPGFGGPPPPPPPPPPP 1038 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPP 668 P G G P PPPP G A PPPPPP P PPP Sbjct: 991 PPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPPP---PPPPP 1038 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP--XPPXPXAGPPXPAAPXXXPP 802 P P GP P P PPPPP PP P GPP P PP Sbjct: 951 PSHPSLESDGPKTPHDQNSSKTNGPPQAPGFNGPPPPPPPPPPMPGQGPPGFNGPPPPPP 1010 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 10/55 (18%) Frame = +3 Query: 558 PXXXPPPPXXXGGG--GXXAXXPXXPPPPPPXXXPX--------PPPXXPPXXGG 692 P PPPP G G G P PPPPPP PPP PP G Sbjct: 985 PPPPPPPPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPGFGGPPPPPPPPPPPG 1039 Score = 33.5 bits (73), Expect = 7.0 Identities = 27/100 (27%), Positives = 27/100 (27%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P P K P PP P PPPPPPP G G G PP Sbjct: 951 PSHPSLESDGPKTPHDQNSSKTNGPPQAPGFNGPPPPPPPP----PPMPGQGPPGFNGPP 1006 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP 238 P G PPPP PP Sbjct: 1007 --------PPPPPPPPPGMNAPVAPGFGGPPPPPPPPPPP 1038 >UniRef50_A1CEV2 Cluster: Extracellular threonine rich protein, putative; n=1; Aspergillus clavatus|Rep: Extracellular threonine rich protein, putative - Aspergillus clavatus Length = 893 Score = 57.2 bits (132), Expect = 5e-07 Identities = 45/160 (28%), Positives = 45/160 (28%), Gaps = 5/160 (3%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXX----GGXGG-GG 658 APP G G GGP GGGG G P GG GG GG Sbjct: 440 APPGNTGPPGGPGGPGPGGPGVPEAPSGGGGACTVPTAPPGGPGSPPQATGPGGPGGPGG 499 Query: 657 PGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXX 478 PG G G PP G G PPP P Sbjct: 500 PGAPPQATGPGGPEGPKGPGTPPQATGPSGPSGPGPVQPGGPPPAPVSTCVTATVP-ASG 558 Query: 477 XPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PP P P PP GGGG PP Sbjct: 559 GPAPPETQPPGGGATGPAKPPAGTETAPPKPGGGGETTPP 598 Score = 46.0 bits (104), Expect = 0.001 Identities = 44/163 (26%), Positives = 44/163 (26%), Gaps = 9/163 (5%) Frame = +2 Query: 359 GGXXXPPPPXP--XXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGG 532 G P PP P GG G GG GGGG P G Sbjct: 431 GPTGPPAPPAPPGNTGPPGGPGGPGPGGPGVPEAPSGGGGACTVPTAPPGGPGSPPQATG 490 Query: 533 GGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-----PXPPXXGGXX 697 GG PP GG P P GP P P P Sbjct: 491 PGGPGGPGGPGAPPQATGPGGPEGPKGPGTPPQATGPSGPSGPGPVQPGGPPPAPVSTCV 550 Query: 698 XPXAPXXXAXPPPPPXPPXPXA-GP-PXPAAPXXXPPXXGXGG 820 P PP PP A GP PA PP G GG Sbjct: 551 TATVPASGGPAPPETQPPGGGATGPAKPPAGTETAPPKPGGGG 593 Score = 44.8 bits (101), Expect = 0.003 Identities = 45/154 (29%), Positives = 45/154 (29%), Gaps = 7/154 (4%) Frame = +2 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXX-GXGXFXXFPXXXGGGGGXXXVX 556 PP P G G G G G GG G G G P GG G Sbjct: 429 PPGPTGPPAPPAPPGNTGPPGGPGGPGPGGPGVPEAPSGGGGACTVPTAPPGGPGS---- 484 Query: 557 XXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-PPXXGGXXXPXAPXXX--AX 727 PP GG G P P GP P PP G P P Sbjct: 485 ----PPQATGPGGPGGPGGPGAPPQATGPGGPEGPKGPGTPPQATGPSGPSGPGPVQPGG 540 Query: 728 PPPPPXPPXPXAGPP---XPAAPXXXPPXXGXGG 820 PPP P A P PA P PP G G Sbjct: 541 PPPAPVSTCVTATVPASGGPAPPETQPPGGGATG 574 Score = 41.1 bits (92), Expect = 0.035 Identities = 36/143 (25%), Positives = 36/143 (25%), Gaps = 1/143 (0%) Frame = +2 Query: 362 GXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G PPP G G G G G G G P G G Sbjct: 228 GATGPPPETGPPAATGPPGATGPPAATGPPGATGPPGATGPPPETG-----PPAATGPPG 282 Query: 542 XXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-PPXXGGXXXPXAPXX 718 PP G PP P GPP PP G P Sbjct: 283 ATGPPAATGPPAATGPPGATGPPGATGPPPETGPPAATGPPAATGPPGATGPPPETGPPA 342 Query: 719 XAXPPPPPXPPXPXAGPPXPAAP 787 PPP P GPP P P Sbjct: 343 ATGPPPGATGPPGATGPPAPTGP 365 Score = 38.7 bits (86), Expect = 0.19 Identities = 41/165 (24%), Positives = 41/165 (24%), Gaps = 11/165 (6%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP G G GP G G G P G G GP G Sbjct: 196 PPPETGPPAATGPPGATGPPAATGPPGATGPPGATGPPPETGPPAATGPPGATGPPAATG 255 Query: 639 GGGGGXXXXXXKXPP---PPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXX 478 G PP PP G G PP PP G P Sbjct: 256 PPGATGPPGATGPPPETGPPAATGPPGATGPPAATGPPAATGPPGATGPPGATGPPPETG 315 Query: 477 XP----PPPPPXPXXPXXPPPPP-PPXXXXXXXXGXGGGGXXXPP 358 P PP P PPP PP G G PP Sbjct: 316 PPAATGPPAATGPPGATGPPPETGPPAATGPPPGATGPPGATGPP 360 Score = 37.9 bits (84), Expect = 0.33 Identities = 48/198 (24%), Positives = 49/198 (24%), Gaps = 6/198 (3%) Frame = -2 Query: 768 GPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPP-- 595 GP G G G G A P G G GP G G PP Sbjct: 177 GPPAGTGPPGATGPPAATGPPPETGPPAATGPPGATGPPAATGPPGATGPPGATGPPPET 236 Query: 594 -PPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PP G G PP PP G + P PP P PP Sbjct: 237 GPPAATGPPGATGPPAATGPPGATGPPGATGPPPETGPPAATG--PPGATGPPAATGPPA 294 Query: 426 PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 P G PP P P PPP Sbjct: 295 ATGPPGATGPPGATGPPPETGPPA---ATGPPAATGPPGATGPPPETGPPAATGPPPGAT 351 Query: 246 XPPRXPXTPXXPGGPGXP 193 PP P P GPG P Sbjct: 352 GPPGATGPPA-PTGPGAP 368 Score = 37.5 bits (83), Expect = 0.43 Identities = 53/209 (25%), Positives = 53/209 (25%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G P PP G G GG G GG PG GG Sbjct: 434 GPPAPPAPPGNTGPPGGPGGPGPGG-------PG--VPEAPSGGGGACTVPTAPPGGPGS 484 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 PP GG GG G G G GG G G P G G Sbjct: 485 PPQATG-------PGGPGGPGGPGAPPQATGPGGPEGPKGPGT----PPQATGPSGPSG- 532 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 P P GG P P PP PP G P P Sbjct: 533 ------PGPVQPGGPPPAPVSTCVTATVPASGGPAPPETQPPGGGATGPAKPPAGTETAP 586 Query: 734 PPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P G P AP G GG Sbjct: 587 PKPG----GGGETTPPAPPGTKVPQGPGG 611 Score = 37.1 bits (82), Expect = 0.57 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 3/86 (3%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPP--PXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP G G PPP P GPP PP G P PP Sbjct: 250 PPAATGPPGATGPPGATGPPPETGPPAATGPPGATGPPAATGPPAATGPPGATGPPGATG 309 Query: 746 PPXPXAGPPXPAAPXXXPPXXGXGGA 823 PP P GPP P P G GA Sbjct: 310 PP-PETGPPAATGP---PAATGPPGA 331 Score = 37.1 bits (82), Expect = 0.57 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 8/76 (10%) Frame = +2 Query: 569 PPP---PPXXGGGGXXCXXXXXPPPPPPXXXP---GPPP--PXPPXXGGXXXPXAPXXXA 724 PPP PP G PPP P GPPP PP G P P Sbjct: 310 PPPETGPPAATGPPAATGPPGATGPPPETGPPAATGPPPGATGPPGATGPPAPTGPGAPT 369 Query: 725 XPPPPPXPPXPXAGPP 772 PP PP P P Sbjct: 370 CPPAAVCPPCPATEAP 385 Score = 35.9 bits (79), Expect = 1.3 Identities = 44/171 (25%), Positives = 45/171 (26%), Gaps = 16/171 (9%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGG------GGGXXGXXGXGGGGGGXXXXXGXGXFXXFPX 520 GG P P P GGG G G G GG G G P Sbjct: 449 GGPGGPGPGGPGVPEAPSGGGGACTVPTAPPGGPGSPPQATGPGGPGGPGGPGA----PP 504 Query: 521 XXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXX---------PGPPPPX 673 G GG PP G PPP P GP PP Sbjct: 505 QATGPGGPEGPKGPGTPPQATGPSGPSGPGPVQPGGPPPAPVSTCVTATVPASGGPAPPE 564 Query: 674 -PPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P GG P P PP PP P P P GG+ Sbjct: 565 TQPPGGGATGPAKPPAGTETAPPKPGGGGETTPPAP--PGTKVPQGPGGGS 613 Score = 35.9 bits (79), Expect = 1.3 Identities = 34/148 (22%), Positives = 35/148 (23%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G A G GP+ G G GG P GG G Sbjct: 512 PEGPKGPGTPPQATGPSGPS-GPGPVQPGGPPPAPVSTCVTATVPASGGPAPPETQPPGG 570 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G G PP GGGG P G P P P Sbjct: 571 GATGPAKPPAGTETAPPKPGGGGETTPPAPPGTKVPQGPGGGSMTGFPNTTVPAVPTKPS 630 Query: 459 PXPXXPXXPPPPPPPXXXXXXXXGXGGG 376 P P P GGG Sbjct: 631 VAPNITSSVTKPSAPPVSNLTTTAPGGG 658 Score = 35.5 bits (78), Expect = 1.7 Identities = 29/107 (27%), Positives = 29/107 (27%), Gaps = 6/107 (5%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPP---PPPXXGGGGXXCXXXXXPPPPP--PXXXPGPPP-PXP 676 P G G PP PP G G PP P GPPP P Sbjct: 179 PAGTGPPGATGPPAATGPPPETGPPAATGPPGATGPPAATGPPGATGPPGATGPPPETGP 238 Query: 677 PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 P G P PP PP PP P P G Sbjct: 239 PAATGPPGATGPPAATGPPGATGPPGATGPPPETGPPAATGPPGATG 285 Score = 35.5 bits (78), Expect = 1.7 Identities = 30/98 (30%), Positives = 30/98 (30%), Gaps = 3/98 (3%) Frame = -2 Query: 810 PXXGGXXXGAAGX-GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGG--XGGGGPGXXXG 640 P G G GG A G GGGGG P G G P G Sbjct: 760 PVPGSTPGSTPGAPGGTARPTGPPGGGGGAGTTLTPVPGSTPGSTPGAPSGTARPTGPPG 819 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPP 526 GGGGG PP G G T P PP Sbjct: 820 GGGGGGGGGGNTGAPPLATGPSG--THTTTQGPPGQPP 855 Score = 35.1 bits (77), Expect = 2.3 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 3/86 (3%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPP--PXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP G G PPP P GPP PP G P A PPP Sbjct: 178 PPAGTGPPGATGPPAATGPPPETGPPAATGPPGATGPPAATGPPGATGPPG-ATGPPPET 236 Query: 746 PPXPXAGPPXPAAPXXXPPXXGXGGA 823 P GPP P P G GA Sbjct: 237 GPPAATGPPGATGP---PAATGPPGA 259 Score = 35.1 bits (77), Expect = 2.3 Identities = 29/89 (32%), Positives = 29/89 (32%), Gaps = 6/89 (6%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPP--PXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP G G PPP P GPP PP G P A PPP Sbjct: 214 PPAATGPPGATGPPGATGPPPETGPPAATGPPGATGPPAATGPPGATGPPG-ATGPPPET 272 Query: 746 PPXPXAGPP---XPAAPXXXPPXXGXGGA 823 P GPP P A P G GA Sbjct: 273 GPPAATGPPGATGPPAATGPPAATGPPGA 301 Score = 35.1 bits (77), Expect = 2.3 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 3/85 (3%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPP--PXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPP G PP P GPP PP G P PP Sbjct: 268 PPPETGPPAATGPPGATGPPAATGPPAATGPPGATGPPGATGPPPETGPPAATGPPAATG 327 Query: 746 PPXPXAGPPXPAAPXXXPPXXGXGG 820 PP PP P P G G Sbjct: 328 PPGATGPPPETGPPAATGPPPGATG 352 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 G PGG PP GG G G G G + P GGGG G Sbjct: 771 GAPGGTARPTGPPGGGGGAGTTLTPVPGSTPGSTPGAPSGTARPTGPPGGGGGGGGGGGN 830 Query: 544 XPPPP 530 PP Sbjct: 831 TGAPP 835 Score = 34.3 bits (75), Expect = 4.0 Identities = 33/109 (30%), Positives = 33/109 (30%), Gaps = 6/109 (5%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPP---PPPXXGGGGXXCXXXXXPPPPP--PXXXPGPP-PPXP 676 P G G PP PP G G PP P GPP P Sbjct: 251 PAATGPPGATGPPGATGPPPETGPPAATGPPGATGPPAATGPPAATGPPGATGPPGATGP 310 Query: 677 PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P G P PP PP P GP PAA P G GA Sbjct: 311 PPETGPPAATGPPAATGPPGATGPP-PETGP--PAATGPPPGATGPPGA 356 Score = 33.9 bits (74), Expect = 5.3 Identities = 24/90 (26%), Positives = 24/90 (26%) Frame = -2 Query: 462 PPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXX 283 PP P P PP PP G G GG P PG Sbjct: 429 PPGPTGPPAPPAPPGNTGPPGGPGGPGPGGPGVPEA---PSGGGGACTVPTAPPGGPGSP 485 Query: 282 XXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P P PGGP P Sbjct: 486 PQATGPGGPGGPGGPGAPPQATGPGGPEGP 515 Score = 33.5 bits (73), Expect = 7.0 Identities = 40/158 (25%), Positives = 40/158 (25%), Gaps = 4/158 (2%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGP--GXX 646 PP G GP G G G A G G PP G G P G Sbjct: 220 PPGATGPPGATGPPPETGPPAATGPPGATGPPA-ATGPPGATGPP---GATGPPPETGPP 275 Query: 645 XGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPP--PPXXXGXXXKXPXPXXXXXP 472 G G PP G G PP PP G P P Sbjct: 276 AATGPPGATGPPAATGPPAATGPPGATGPPGATGPPPETGPPAATG-PPAATGPPGATGP 334 Query: 471 PPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 PP P PP P G G PP Sbjct: 335 PPETGPPAATGPPPGATGPPGATGPPAPTGPGAPTCPP 372 Score = 33.1 bits (72), Expect = 9.3 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 6/81 (7%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPP----PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPP G PP PPP P PP G P P P Sbjct: 310 PPPETGPPAATGPPAATGPPGATGPPPETGPPAATGPPPGATGPPGATGPPAPTGPGAPT 369 Query: 743 XPPXPXAGPPXPA--APXXXP 799 PP PP PA AP P Sbjct: 370 CPPAAVC-PPCPATEAPSCPP 389 >UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated protein 1 precursor; n=4; Murinae|Rep: Submaxillary gland androgen-regulated protein 1 precursor - Mus musculus (Mouse) Length = 147 Score = 57.2 bits (132), Expect = 5e-07 Identities = 31/78 (39%), Positives = 33/78 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G G P PPP G PPP PP G P P PP P P Sbjct: 36 PPPPPPHGPG------IGRPHPPPFGPGIGRPPP-PPFGPGIGRPPPPPPCPPVPPHPRP 88 Query: 749 PXPXAGPPXPAAPXXXPP 802 P + PP P+ P PP Sbjct: 89 PSNPSPPPTPSIPPTGPP 106 Score = 47.2 bits (107), Expect = 5e-04 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXX----PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP 433 PPPP G G G PPPPP G P P PP PP P P P Sbjct: 37 PPPPPHGPGIGRPHPPPFGPGIGRPPPPPFGPGIGRPPPPPPC----PPVPPHPRPPSNP 92 Query: 432 PPPPPP 415 PPP P Sbjct: 93 SPPPTP 98 Score = 43.2 bits (97), Expect = 0.009 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P P PPPP P G P PPPPP P PP P P P Sbjct: 31 PRGPFPPPPPPHGPGIGRPHPPPFGPGIGRPPPPPFGPGIGRPPPPPPCPPVPP 84 Score = 37.9 bits (84), Expect = 0.33 Identities = 25/69 (36%), Positives = 25/69 (36%), Gaps = 6/69 (8%) Frame = -1 Query: 601 PPPPXXXGGGGXXX---GXXXXXPPPPPXXXGEXXKXPXXPXXXXXP-PPPPXXXXXXXT 434 PPPP G G G PPPPP G P P P P PP T Sbjct: 38 PPPPHGPGIGRPHPPPFGPGIGRPPPPPFGPGIGRPPPPPPCPPVPPHPRPPSNPSPPPT 97 Query: 433 P--PPPPPP 413 P PP PP Sbjct: 98 PSIPPTGPP 106 Score = 37.5 bits (83), Expect = 0.43 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXP---XXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP G P P PPPPP PPPPP P Sbjct: 36 PPPPPPHGPGIGRPHPPPFGPGIGRPPPPPFGPGIGRPPPPPPCP 80 Score = 35.5 bits (78), Expect = 1.7 Identities = 29/87 (33%), Positives = 30/87 (34%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G G G P G G G + PPPP G G PPPPP Sbjct: 38 PPPPHGPGIGRPHPPPFGPGIG------RPPPPPFGPGIG--------RPPPPPP----C 79 Query: 510 XXKXPXPXXXXXPPPPPPXPXXPXXPP 430 P P P PPP P PP Sbjct: 80 PPVPPHPRPPSNPSPPPTPSIPPTGPP 106 >UniRef50_P23246 Cluster: Splicing factor, proline- and glutamine-rich; n=81; Eumetazoa|Rep: Splicing factor, proline- and glutamine-rich - Homo sapiens (Human) Length = 707 Score = 57.2 bits (132), Expect = 5e-07 Identities = 50/172 (29%), Positives = 50/172 (29%), Gaps = 13/172 (7%) Frame = -2 Query: 669 GGGGPGXXXGGGGGGXXXXXXKXPPPPXXG--------GGGGXXXXXTXXXPPPPPXXXG 514 GGGG G GGGGG PPP G G G PPPPP Sbjct: 10 GGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQ 69 Query: 513 XXXKXPXPXXXXXPP-PPPPXPXXPXXPPPPPPPXXXXXXXXGXGGG---GXXXPPXFFF 346 P PP PPP P PPPPP G G G P Sbjct: 70 QQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSAPPASS 129 Query: 345 LXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP-RXPXTPXXPGGPGXP 193 PG PPP PP P TP G P P Sbjct: 130 SAPPATPPTSGAPPGSGPGPT---PTPPPAVTSAPPGAPPPTPPSSGVPTTP 178 Score = 51.2 bits (117), Expect = 3e-05 Identities = 43/142 (30%), Positives = 45/142 (31%), Gaps = 8/142 (5%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXG--GGGGXXXVXXXXXPPPPP 583 F GGGGG G GGG GG G G G PPPPP Sbjct: 6 FRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPP 65 Query: 584 XXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP----PPPPX 745 PP PPP P PPP P P P + P P P Sbjct: 66 HQ-------QQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPA 118 Query: 746 PPXPXAGPPXPAAPXXXPPXXG 811 P A P +AP PP G Sbjct: 119 PGVGSAPPASSSAPPATPPTSG 140 Score = 51.2 bits (117), Expect = 3e-05 Identities = 29/78 (37%), Positives = 29/78 (37%), Gaps = 5/78 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXX--PGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP P G P PPP PG PPP PP G P P PPPP Sbjct: 132 PPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTP--PQAGGPPPPPA 189 Query: 743 XPPXPXAGP---PXPAAP 787 P P GP P P P Sbjct: 190 AVPGPGPGPKQGPGPGGP 207 Score = 46.4 bits (105), Expect = 0.001 Identities = 32/107 (29%), Positives = 33/107 (30%), Gaps = 8/107 (7%) Frame = +2 Query: 527 GGGGGXXXVXXXXXPPPP--------PXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPX 682 GGGGG + PPP P G G PPPPP PPP PP Sbjct: 20 GGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPP 79 Query: 683 XGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P P P PP P P P G G A Sbjct: 80 Q--QPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSA 124 Score = 44.4 bits (100), Expect = 0.004 Identities = 29/96 (30%), Positives = 32/96 (33%), Gaps = 6/96 (6%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXP----PPPPXXXGE 512 GG GG GGG GG + P G G P PPPP + Sbjct: 10 GGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQ 69 Query: 511 XXKXPXXPXXXXXPP--PPPXXXXXXXTPPPPPPPE 410 P P PP PPP PPPPP + Sbjct: 70 QQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQD 105 Score = 40.3 bits (90), Expect = 0.061 Identities = 52/205 (25%), Positives = 53/205 (25%), Gaps = 12/205 (5%) Frame = -2 Query: 771 GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPP 592 GG G GGGGG PP G GP G G G PPP Sbjct: 10 GGGGGGFHRRGGGGGRGGLHDFRSP--PPGMGLNQNRGP---MGPGPGQSGPKPPIPPPP 64 Query: 591 PXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPP-----PPPXPXXPXX 436 P PPP PP + P P P P P P Sbjct: 65 PHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSA 124 Query: 435 PPP----PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXX 268 PP PP G G G PP P Sbjct: 125 PPASSSAPPATPPTSGAPPGSGPGPTPTPPPAV-TSAPPGAPPPTPPSSGVPTTPPQAGG 183 Query: 267 PPPPXXXXPPRXPXTPXXPGGPGXP 193 PPPP P P P GPG P Sbjct: 184 PPPPPAAVPGPGPGPKQGP-GPGGP 207 Score = 39.9 bits (89), Expect = 0.081 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 6/89 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP----PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 P P P G PP PP PGP P PP P Sbjct: 115 PGPAPGVGSAPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGV 174 Query: 737 PPXPPXPXAGPPXPAA-PXXXP-PXXGXG 817 P PP PP PAA P P P G G Sbjct: 175 PTTPPQAGGPPPPPAAVPGPGPGPKQGPG 203 Score = 34.3 bits (75), Expect = 4.0 Identities = 23/77 (29%), Positives = 24/77 (31%), Gaps = 9/77 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP---------PXXXPGPPPPXPPXXGGXXXPXAPXXX 721 PPP P G PPPPP P PGP P G P Sbjct: 165 PPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGL 224 Query: 722 AXPPPPPXPPXPXAGPP 772 + P P PP G P Sbjct: 225 STPGGHPKPPHRGGGEP 241 Score = 33.1 bits (72), Expect = 9.3 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXG 514 PP G GPG G G GG K P P GGG G T P PP G Sbjct: 185 PPPPAAVPGPGPGPKQGPGPGG--PKGGKMPGGPKPGGGPG---LSTPGGHPKPPHRGG 238 >UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 454 Score = 56.8 bits (131), Expect = 7e-07 Identities = 30/73 (41%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP--P 742 PPPP G PPPPPP PPPP PP P AP PPP P Sbjct: 159 PPPPAHPAAYGAP------PPPPPPASYAAPPPPPPPPASYAAPPPAPPASYAAPPPARP 212 Query: 743 XPPXPXAGPPXPA 781 PP PP PA Sbjct: 213 SPPASYNQPPPPA 225 Score = 50.8 bits (116), Expect = 4e-05 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG-PPXPAAPXXXPP 802 P P PPP P G P P A PPPPP PP A PP P A PP Sbjct: 152 PQPSYGAPPPPAHPAAYGAPPPPPPPASYAAPPPPPPPPASYAAPPPAPPASYAAPP 208 Score = 49.6 bits (113), Expect = 1e-04 Identities = 28/78 (35%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP PPP PP P P A PP P Sbjct: 171 PPPPPPPAS------YAAPPPPPPPPASYAAPPPAPPASYAAPPPARPSPPASYNQPP-P 223 Query: 749 PXPXAGPPXPAAPXXXPP 802 P + P PA+ PP Sbjct: 224 PATYSQPSPPASYNQSPP 241 Score = 45.6 bits (103), Expect = 0.002 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -2 Query: 540 PPPP--PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPP P G P P PPPPPP P PPP PP Sbjct: 159 PPPPAHPAAYGAPPPPPPPASYAAPPPPPPPPASYAAPPPAPP 201 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 531 PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P G P PPPPPP PPPPPPP Sbjct: 152 PQPSYGAPPPPAHPAAYGAPPPPPPPASYAAPPPPPPPP 190 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 P P P P P G P P PPPPP PP A PP P P Sbjct: 141 PSPPVRPAYAVPQPSY-GAPPPPAHPAAYGAPPPPP-PPASYAAPPPPPPP 189 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G PPPP P P PPP PP P P Sbjct: 159 PPPPAHPAAYG-----APPPPPPPASYAAPPPPPPPPASYAAPPPAPPASYAAPPPARPS 213 Query: 420 PP 415 PP Sbjct: 214 PP 215 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPPP PPPPPPP Sbjct: 162 PAHPAAYGAPPPPPPPASYAAPPPPPPPP 190 Score = 36.7 bits (81), Expect = 0.75 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 11/88 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP---------PPP--XXXPGPPPPXPPXXGGXXXPXAPX 715 PPPP PPP PPP P PPP PP Sbjct: 221 PPPPATYSQPSPPASYNQSPPPASYNPPSLTPPPASYNPPSRPPPPPPPPVTEKPLKITL 280 Query: 716 XXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPP P PP PA P P Sbjct: 281 SRPSPPPSTKSSYPNKLPPPPAIPNEPP 308 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PPP P PP P PPP P Sbjct: 263 PPPPPPPPVTEKPLKITLSRPSPPPSTKSSYPNKLPPPPAIPNEPPLSDKPCFKQPPPPP 322 Query: 749 PXPXAGPPXP 778 P P P Sbjct: 323 SKPKTYDPLP 332 Score = 35.9 bits (79), Expect = 1.3 Identities = 25/84 (29%), Positives = 28/84 (33%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP--PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP--- 733 PPPPP PPP P P PP P A + PP Sbjct: 186 PPPPPASYAAPPPAPPASYAAPPPARPSPPASYNQPPPPATYSQPSPPASYNQSPPPASY 245 Query: 734 -PPPXPPXPXAGPPXPAAPXXXPP 802 PP P P + P P+ P PP Sbjct: 246 NPPSLTPPPASYNP-PSRPPPPPP 268 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 7/49 (14%) Frame = -2 Query: 540 PPPP-----PXXXGXXXKXPXPXXXXXPP--PPPPXPXXPXXPPPPPPP 415 PPPP P + P P P PPP P PPPPPPP Sbjct: 221 PPPPATYSQPSPPASYNQSPPPASYNPPSLTPPPASYNPPSRPPPPPPP 269 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P P PPP P P PPPP Sbjct: 186 PPPPPASYAAPPPAP-PASYAAPPPARPSPPASYNQPPPP 224 Score = 35.1 bits (77), Expect = 2.3 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPP P PP P P PPPPP Sbjct: 266 PPPPPVTEKPLKITLSRPSPPPSTKSSYPNKLPPPPAIPNEPPLSDKPCFKQ-PPPPPSK 324 Query: 749 PXPXAGPPXP 778 P P P Sbjct: 325 PKTYDPLPMP 334 Score = 34.7 bits (76), Expect = 3.0 Identities = 30/94 (31%), Positives = 30/94 (31%), Gaps = 17/94 (18%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP--PXPPXXGGXXXPXAPXXXAXPP--- 733 PPPPP PPP PP PPP P PP P A PP Sbjct: 184 PPPPPPPAS-------YAAPPPAPPASYAAPPPARPSPPASYNQPPPPATYSQPSPPASY 236 Query: 734 ---PPPX--------PPXPXAGPPX-PAAPXXXP 799 PPP PP PP P P P Sbjct: 237 NQSPPPASYNPPSLTPPPASYNPPSRPPPPPPPP 270 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXX-KXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP T P PPP K P P PP P PPPP Sbjct: 263 PPPPPPPPVTEKPLKITLSRPSPPPSTKSSYPNKLPPPPAIPNEPPLSDKPCFKQPPPPP 322 Query: 423 PPP 415 P Sbjct: 323 SKP 325 >UniRef50_UPI0000DA4780 Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 296 Score = 56.8 bits (131), Expect = 7e-07 Identities = 30/73 (41%), Positives = 30/73 (41%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G GG G GG GGGGG G G GG G GG G GGGGGG Sbjct: 35 GDGGGGGWGDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGGDGGGGDGGGGGGGGDDGDGG 94 Query: 606 KXPPPPXXGGGGG 568 G GGG Sbjct: 95 GGDGGGGGGDGGG 107 Score = 52.0 bits (119), Expect = 2e-05 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G G GG GG G G GG GGG G GGG GG Sbjct: 53 GGDGDGGGGDGGSGDGGDGGGGDGGGGDGGGGGGGGDDGDGGGGDGGGGGGDGGGGDGG 111 Score = 50.8 bits (116), Expect = 4e-05 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G GG G GG GGGGG G G GG GGGG G GGG GG Sbjct: 61 GDGGSGDGGDGGGGDGGGGDGGGGGGGGDDGDGGGGDGGGGGGDGGGGDG---GGGDGG 116 Score = 50.4 bits (115), Expect = 6e-05 Identities = 28/72 (38%), Positives = 28/72 (38%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G GG G GG G GGG G G GG GGGG G GGGGG Sbjct: 33 GGGDGGGGGWGDGGGGDGGGGGDGDGGGGDGG-SGDGGDGGGGDGGGGDGGGGGGGGDDG 91 Query: 606 KXPPPPXXGGGG 571 GGGG Sbjct: 92 DGGGGDGGGGGG 103 Score = 49.6 bits (113), Expect = 1e-04 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G G G G GGGG G G G GGGG G G GGGG Sbjct: 38 GGGGWGDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGGDGGGGDGGGGGGGGDDGDGGGGD 97 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 98 GGGGGGDGGGGDGGGGDG 115 Score = 39.9 bits (89), Expect = 0.081 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GG GGGG G G G GG G G G GGGGG GG Sbjct: 47 GGDGGGGGDGDGGGGDGGSGDGGDGGGGDGGGGDGGGGGGGGDDGDGGGGDGGGGGGDGG 106 Query: 596 GG 601 GG Sbjct: 107 GG 108 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG GGGG G G G GGGG G G GGGG Sbjct: 34 GGDGGGGGWGDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGG 74 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG G G G GGGG G G G GGGGG Sbjct: 45 GGGGDGGGGGDGDGGGGDGGSGDGGDGGGGDGGGGDGGGGG 85 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGG G G GGGGGG G G GGG G Sbjct: 69 GDGGGGDGGGGDGGGGGGGGDDGDGGGGDGGGGGGDGGGGDG 110 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 + GGG GGG G GG GGG G G GGGG Sbjct: 31 YNGGGDGGGGGWGDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGG 74 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGG G G GGGGG G G GG GG Sbjct: 37 GGGGGWGDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGGDGG 77 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 G GGGG G G G GGGG G G GGG GGG Sbjct: 43 GDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGGDGGGGDGGGGGGGGDDGDGGGGDGGGGG 102 Query: 599 G 601 G Sbjct: 103 G 103 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG W GG GGG G GG GG G GGGG G Sbjct: 35 GDGGGGGWGDGGGGDGG--GGGDGDGGGGDGGSGDGGDGGGGDGGGGDGGGGGGGG 88 Score = 33.9 bits (74), Expect = 5.3 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGG--GGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 GG GGGG G G GG G GG G G GG GG V Sbjct: 73 GGDGGGGDGGGGGGGGDDGDGGGGDGGGGGGDGGGGDGGGGDGGYVDV 120 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 G GGGGG GGGGG G G GGG G Sbjct: 35 GDGGGGGWGDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGGDG 76 Score = 33.5 bits (73), Expect = 7.0 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G G GGG G G G GGG G G GG GG GG Sbjct: 41 GWGDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGGDGGGGDGGGGGGGGDDGDGGGGDGGG 100 Query: 596 GG 601 GG Sbjct: 101 GG 102 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GGG G G G G GG G G G G GGGG Sbjct: 39 GGGWGDGGGGDGGGGGDGDGGGGDGGSGDGGDGGGGDGGGG 79 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GG G GGGGGG G GGG G Sbjct: 56 GDGGGGDGGSGDGGDGGGGDGGGGDGGGGGGGGDDGDGGGGDGGGGGGDGGGGDGG 111 >UniRef50_Q8QKX8 Cluster: EsV-1-144; n=1; Ectocarpus siliculosus virus 1|Rep: EsV-1-144 - Ectocarpus siliculosus virus 1 Length = 698 Score = 56.8 bits (131), Expect = 7e-07 Identities = 27/59 (45%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG GA+G G GG GG G A G G GG GGGG G GGGGGG Sbjct: 442 GGGTGGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGG 500 Score = 53.6 bits (123), Expect = 6e-06 Identities = 28/58 (48%), Positives = 29/58 (50%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G G A G GG GG GG + GA G GG GGGG G GGGGGG Sbjct: 440 GTGGGTGGASGGASGGGGGGGTGGAS--GGASGGGGGGGTGGAGGGGGGGGGGGGGGG 495 Score = 50.8 bits (116), Expect = 4e-05 Identities = 25/59 (42%), Positives = 26/59 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG GA+G GG G GG G G G GG GGGG G GGGG G Sbjct: 446 GGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGGGRG 504 Score = 49.2 bits (112), Expect = 1e-04 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G G G GG GG GGGG GA G GG GGGG G G G G Sbjct: 450 GGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGGGRGSG 506 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -2 Query: 780 AGXGGPAXGX-GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 AG GG G GG GGGG GA G GG GG G GGGGGG Sbjct: 439 AGTGGGTGGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGG 491 Score = 45.2 bits (102), Expect = 0.002 Identities = 24/57 (42%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = -2 Query: 801 GGXXXGAAGXG-GPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 GG G G G G A G GGGGG G G GG GGGG G G G Sbjct: 450 GGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGGGRGSG 506 Score = 43.2 bits (97), Expect = 0.009 Identities = 24/58 (41%), Positives = 24/58 (41%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G G G A G GG GG GG G G GG GGGG G G G Sbjct: 455 GGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGG--GGGGGGGGGGGRGSGNVRG 510 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGG G G GGGGG Sbjct: 454 GGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGG 495 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G GGGGGG G G GGGGG Sbjct: 457 GGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGG 498 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXG 493 GGGGGGG G G GGGGGG G Sbjct: 481 GGGGGGGGGGGGGGGGGGGGGGRGSG 506 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G G GGGGG G G GGGGG Sbjct: 458 GGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGG 499 Score = 38.3 bits (85), Expect = 0.25 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 G GGGGG G G GGGGGG G G Sbjct: 479 GAGGGGGGGGGGGGGGGGGGGGGGRGSG 506 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 SGGGGGGG GGGG G G GGGGG Sbjct: 453 SGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGG 496 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGG GG G G GGGGGG G G Sbjct: 473 GGGGTGGAGGGGGGGGGGGGGGGGGGGG 500 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GG G GGGGGG G GGGG G Sbjct: 443 GGTGGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGG 498 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GG GGG G GGGG G Sbjct: 451 GASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGGGRGSG 506 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GG GGG G G GGGGGG G G Sbjct: 478 GGAGGGGGGGGGGGGGGGGGGGGGGRG 504 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGG G G GG G G G GGGGG Sbjct: 451 GASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGG 492 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXG 493 GGGGGGG G G GGGG G G Sbjct: 485 GGGGGGGGGGGGGGGGGGRGSGNVRG 510 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGG GG G G GGGGGG G G Sbjct: 474 GGGTGGAGGGGGGGGGGGGGGGGGGGGG 501 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GG GG G G G GGGGGG G G Sbjct: 475 GGTGGAGGGGGGGGGGGGGGGGGGGGGG 502 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 GGG GG G GGGGGG G GG GG GGG Sbjct: 442 GGGTGGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGGGGGGGGGGGGGG 501 Query: 599 G 601 G Sbjct: 502 G 502 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGG--GGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G G GGGG GG G GGGGG Sbjct: 442 GGGTGGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGG 485 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 416 GGGGGG--GXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G G GG GG G G GGGGG Sbjct: 446 GGASGGASGGGGGGGTGGASGGASGGGGGGGTGGAGGGGGGGGG 489 >UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 359 Score = 56.8 bits (131), Expect = 7e-07 Identities = 26/62 (41%), Positives = 26/62 (41%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PP PP P PPPP P G P P A PPPPP P PP P PP Sbjct: 46 PPAAPPAAEP-PPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPPPGGYGAPPPA 104 Query: 806 XG 811 G Sbjct: 105 WG 106 Score = 55.2 bits (127), Expect = 2e-06 Identities = 30/84 (35%), Positives = 30/84 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPP P GP P P G P P PPPPP P Sbjct: 37 PPPAPAEPAPPAAPPAAEPPPPPAPAPASGPSEPGGPVWGAPPPP--PPGGELPPPPPPP 94 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P PP GG Sbjct: 95 PGGYGAPPPAWGP--PPPSGAPGG 116 Score = 52.8 bits (121), Expect = 1e-05 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPP---PXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPP P G PPPPPP PPPP PP G AP PPPP Sbjct: 56 PPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPPPGGYG-----APPPAWGPPPP 110 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P GPP P P P Sbjct: 111 SGAPGGW-GPPPPPPPMPSGP 130 Score = 50.8 bits (116), Expect = 4e-05 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 11/84 (13%) Frame = +2 Query: 569 PPPPPXXG---GGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP- 736 PPPPP G PPPPP PPPP PP GG P P PPP Sbjct: 55 PPPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPP-PPPPGGYGAP--PPAWGPPPPS 111 Query: 737 -------PPXPPXPXAGPPXPAAP 787 PP PP P P AAP Sbjct: 112 GAPGGWGPPPPPPPMPSGPELAAP 135 Score = 48.4 bits (110), Expect = 2e-04 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 6/86 (6%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP-- 424 PPP PPPP P PPPPPP P PPPP Sbjct: 37 PPPAPAEPAPPAAPPAAEPPPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPPPG 96 Query: 423 ----PPPXXXXXXXXGXGGGGXXXPP 358 PPP G GG PP Sbjct: 97 GYGAPPPAWGPPPPSGAPGGWGPPPP 122 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXP------PPPPXXXXXX 440 PPP G G PPPP GE P P PPPP Sbjct: 57 PPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPPSGAPGG 116 Query: 439 XTPPPPPPP 413 PPPPPPP Sbjct: 117 WGPPPPPPP 125 Score = 40.7 bits (91), Expect = 0.046 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP-XXXPPXXGXGG 820 PG PPP P P AP PPPP P P +GP P P PP GG Sbjct: 34 PGAPPPAPAEPA---PPAAPPAAE--PPPPPAPAPASGPSEPGGPVWGAPPPPPPGG 85 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 8/70 (11%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP----PPXPXXPXX- 436 PP P G PPPPP P P PPP PP P Sbjct: 58 PPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPPSGAPGGW 117 Query: 435 ---PPPPPPP 415 PPPPP P Sbjct: 118 GPPPPPPPMP 127 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXX--PPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 PPP G P PPPPPP PPP PP G P P Sbjct: 57 PPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPP 110 Score = 34.7 bits (76), Expect = 3.0 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 8/69 (11%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXP-XXPXXP-------PPPPPPXXXXXXXXGX 385 P PP P PPPP P P P P PPPPPP Sbjct: 34 PGAPPPAPAEPAPPAAPPAAEPPPPPAPAPASGPSEPGGPVWGAPPPPPPGGELPPPPPP 93 Query: 384 GGGGXXXPP 358 GG PP Sbjct: 94 PPGGYGAPP 102 >UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|Rep: Adhesin FhaB - Bordetella avium Length = 2621 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP PPPP PP P PPPPP P Sbjct: 2407 PPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP------PPPPKVKKVDPPPPPPP 2460 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P PP Sbjct: 2461 PPPKVKKVDPPPPPPPPP 2478 Score = 56.4 bits (130), Expect = 9e-07 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP PPPP PP P PPPPP P Sbjct: 2375 PPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPP-----PKVKKVDPPPPPPPPP 2429 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P PP Sbjct: 2430 PKVKKVDPPPPPPPPPPP 2447 Score = 56.4 bits (130), Expect = 9e-07 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP PPPP PP P PPPPP P Sbjct: 2424 PPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPP-------PPPKVKKVDPPPPPPP 2476 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P PP Sbjct: 2477 PPPKVKKVDPPPPPPPPP 2494 Score = 55.2 bits (127), Expect = 2e-06 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX-AXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP P P PPPPP PP P P P PP Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2380 Score = 55.2 bits (127), Expect = 2e-06 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PPPPP PPPPPP PPP PP P PPPPP Sbjct: 2390 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKV 2449 Query: 743 --XPPXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 2450 KKVDPPPPPPPPPPKVKKVDPP 2471 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP PPP PP P PPPPP P Sbjct: 2357 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP----PPPKVKKVDPPPPPPPP 2412 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P PP Sbjct: 2413 PPKVKKVDPPPPPPPPPP 2430 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP PPP PP P PPPPP P Sbjct: 2406 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP----PPPKVKKVDPPPPPPPP 2461 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P PP Sbjct: 2462 PPKVKKVDPPPPPPPPPP 2479 Score = 52.4 bits (120), Expect = 1e-05 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 4/81 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP--- 742 PPPP PPPPPP PPP PP P PPPPP Sbjct: 2342 PPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVK 2401 Query: 743 -XPPXPXAGPPXPAAPXXXPP 802 P P PP P PP Sbjct: 2402 KVDPPPPPPPPPPKVKKVDPP 2422 Score = 51.2 bits (117), Expect = 3e-05 Identities = 30/85 (35%), Positives = 30/85 (35%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP-------XXXAX 727 PPPPP PPPPP PPPP PP P P Sbjct: 2321 PPPPPPP---------PPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVD 2371 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP PP P P P PP Sbjct: 2372 PPPPPPPPPPKVKKVDPPPPPPPPP 2396 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPPPP PPPPPPP Sbjct: 2372 PPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPP 2413 Score = 49.6 bits (113), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPPPP PPPPPPP Sbjct: 2421 PPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPP 2462 Score = 49.2 bits (112), Expect = 1e-04 Identities = 26/70 (37%), Positives = 26/70 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP PPP PP P PPPPP P Sbjct: 2439 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP-----PPKVKKVDPPPPPPPP 2493 Query: 749 PXPXAGPPXP 778 P P P Sbjct: 2494 PKVKKVDPPP 2503 Score = 48.0 bits (109), Expect = 3e-04 Identities = 32/116 (27%), Positives = 33/116 (28%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P PPPPPP PPPPPPP P Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2380 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P P P PPPP PP+ P P P Sbjct: 2381 P-------KVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2429 Score = 47.2 bits (107), Expect = 5e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP PPPPP Sbjct: 2372 PPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP-----PPPPPPKVKKVDPPPPPP 2426 Query: 420 PP 415 PP Sbjct: 2427 PP 2428 Score = 47.2 bits (107), Expect = 5e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P P PPPPPP PPPPP Sbjct: 2421 PPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP-----PPPPPPKVKKVDPPPPPP 2475 Query: 420 PP 415 PP Sbjct: 2476 PP 2477 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPPP PPPPPPP Sbjct: 2356 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPP 2397 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP K P PPPP P PPPPPPP Sbjct: 2389 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPP 2430 Score = 46.4 bits (105), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPPP PPPPPPP Sbjct: 2405 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPP 2446 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/42 (47%), Positives = 21/42 (50%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPPPP + PPPPPPP Sbjct: 2454 PPPPPPPPPPKVKKVDPP--PPPPPPPPKVKKVDPPPPPPPP 2493 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/64 (35%), Positives = 25/64 (39%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP + P P PPPPP PPPP Sbjct: 2437 PPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP-----PPPPPKVKKVDPPPPPP 2491 Query: 421 PPPE 410 PPP+ Sbjct: 2492 PPPK 2495 Score = 44.0 bits (99), Expect = 0.005 Identities = 38/140 (27%), Positives = 39/140 (27%), Gaps = 4/140 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP----XXP 433 PPPP PPPPP P P PPPPP P P P Sbjct: 2322 PPPPPPPPPPPPPPKVKKVDPPPPP---------PPPKVKKVDPPPPPPPPPPKVKKVDP 2372 Query: 432 PPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPX 253 PPPPPP PP P P PPPP Sbjct: 2373 PPPPPPPPPKVKKVDPPPPPPPPPP-------PKVKKVDPPPPPPPPPPKVKKVDPPPPP 2425 Query: 252 XXXPPRXPXTPXXPGGPGXP 193 PP+ P P P Sbjct: 2426 PPPPPKVKKVDPPPPPPPPP 2445 Score = 44.0 bits (99), Expect = 0.005 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPP + PPPPPPP Sbjct: 2357 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPP 2398 Score = 44.0 bits (99), Expect = 0.005 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPP + PPPPPPP Sbjct: 2406 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPP 2447 Score = 43.6 bits (98), Expect = 0.007 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPPP PPP PP P PPP Sbjct: 2455 PPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPP-------PPPKVKKVDPPPKDEV 2507 Query: 749 PXPXAGPPXPAAPXXXP 799 P P A P P Sbjct: 2508 DGPKPAPKPKAQPRPSP 2524 Score = 42.7 bits (96), Expect = 0.011 Identities = 22/64 (34%), Positives = 24/64 (37%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP + P P PPPP PPPP Sbjct: 2373 PPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPP-----PPPPKVKKVDPPPPPPP 2427 Query: 421 PPPE 410 PPP+ Sbjct: 2428 PPPK 2431 Score = 42.7 bits (96), Expect = 0.011 Identities = 22/64 (34%), Positives = 24/64 (37%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP + P P PPPP PPPP Sbjct: 2422 PPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPP-----PPPPKVKKVDPPPPPPP 2476 Query: 421 PPPE 410 PPP+ Sbjct: 2477 PPPK 2480 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PPPP PPPPPPP Sbjct: 2342 PPPPPPPP--KVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPP 2381 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP + K P PPPPP PPPPPPP Sbjct: 2327 PPPPPPPPPKVKKVDPPP-----PPPPPKVKKVDPPPPPPPPP 2364 Score = 41.9 bits (94), Expect = 0.020 Identities = 25/72 (34%), Positives = 26/72 (36%), Gaps = 1/72 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP PPPP PP P P P Sbjct: 2456 PPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPPKDEVDGPKP--A 2513 Query: 749 PXPXAGP-PXPA 781 P P A P P P+ Sbjct: 2514 PKPKAQPRPSPS 2525 Score = 40.3 bits (90), Expect = 0.061 Identities = 23/66 (34%), Positives = 25/66 (37%), Gaps = 2/66 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPP- 425 PPPP PPPPP + P P PPPPP PPP Sbjct: 2388 PPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPP-----PPPPPKVKKVDPPPPPP 2442 Query: 424 -PPPPE 410 PPPP+ Sbjct: 2443 PPPPPK 2448 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXX----PPPPPXXXXXXXTPPPPPPP 413 PPPP + P P PPPPP PPPPPPP Sbjct: 2332 PPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPP 2378 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 P P PPPPP PPPPPPP+ Sbjct: 2321 PPPPPPPPPPPPPPPKVKKVDPPPPPPPPK 2350 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 6/70 (8%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP------PPPPXPXX 445 K PPP PPPPP P P PP PPPP P Sbjct: 2434 KVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPP 2493 Query: 444 PXXPPPPPPP 415 P PPP Sbjct: 2494 PKVKKVDPPP 2503 >UniRef50_Q08YB2 Cluster: Response regulator; n=4; cellular organisms|Rep: Response regulator - Stigmatella aurantiaca DW4/3-1 Length = 413 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/67 (43%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPPP---PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 PPPP P PPP P PP G P AP A PP P PP A PP P AP Sbjct: 147 PPPPAAAAGPRPPPGAVPRPPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAPPPG 206 Query: 797 PPXXGXG 817 G G Sbjct: 207 ARPPGPG 213 Score = 56.4 bits (130), Expect = 9e-07 Identities = 36/92 (39%), Positives = 36/92 (39%), Gaps = 9/92 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP----PPPPXXXPGP--PPPX---PPXXGGXXXPXAPXXX 721 PPP G G PP PPP PGP PPP PP G P AP Sbjct: 178 PPPGARPPGPGAPPPGMARPPGPGAPPPGARPPGPGAPPPGMARPPGPGMPPGPGAPPPG 237 Query: 722 AXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 A PP P PP A PP P AP G G Sbjct: 238 ARPPGPGAPPPGMARPPGPGAPPPGARPPGPG 269 Score = 54.4 bits (125), Expect = 4e-06 Identities = 34/88 (38%), Positives = 34/88 (38%), Gaps = 7/88 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP--PPPX--PPXXGGXXXPXA-PXXXAXPP 733 P PPP G P PP P PGP PPP PP G A P PP Sbjct: 145 PQPPPPAAAAGPRPPPGAVPRPPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAPP 204 Query: 734 PPPXPPXPXAGPPXPAAP--XXXPPXXG 811 P PP P A PP A P PP G Sbjct: 205 PGARPPGPGAPPPGMARPPGPGMPPGPG 232 Score = 48.0 bits (109), Expect = 3e-04 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXX-AXPPPP 739 PP P G G P P PPP P P PP P AP A PP P Sbjct: 166 PPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAPPPGARPPGPGAPPPGMARPPGP 225 Query: 740 PXPPXPXAGPP--XPAAPXXXPP 802 PP P A PP P P PP Sbjct: 226 GMPPGPGAPPPGARPPGPGAPPP 248 Score = 48.0 bits (109), Expect = 3e-04 Identities = 35/100 (35%), Positives = 35/100 (35%), Gaps = 15/100 (15%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX---------PPXXGGXXXPXAPXXX 721 PPP G G PP P PG PPP PP P AP Sbjct: 203 PPPGARPPGPGAPPPGMARPPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAPPPG 262 Query: 722 AXPPPPPXPP-----XPXAG-PPXPAAPXXXPPXXGXGGA 823 A PP P PP P AG PP P P P GGA Sbjct: 263 ARPPGPGAPPPGMARPPGAGIPPAPGGPGGGLPRPPPGGA 302 Score = 42.7 bits (96), Expect = 0.011 Identities = 40/146 (27%), Positives = 40/146 (27%), Gaps = 13/146 (8%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPP--PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP- 427 PPP G PP P P G P PPP P P PPP Sbjct: 147 PPPPAAAAGPRPPPGAVPRPPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAPPPG 206 Query: 426 -------PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX---PGXXXX 277 PPP G G PP P PG Sbjct: 207 ARPPGPGAPPPGMARPPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAPPPGARPP 266 Query: 276 GXXPPPPXXXXPPRXPXTPXXPGGPG 199 G PPP PP P PGGPG Sbjct: 267 GPGAPPPGMARPP-GAGIPPAPGGPG 291 Score = 42.3 bits (95), Expect = 0.015 Identities = 40/142 (28%), Positives = 42/142 (29%), Gaps = 6/142 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G P PPP G + P P P PPP P PPP Sbjct: 147 PPPPAAAAG-----------PRPPP---GAVPRPPGPGMPPGPGAPPPGARPPGPGAPPP 192 Query: 420 ----PPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPX 253 PP G PP + P PG G PPP Sbjct: 193 GMARPPGPGAPPPGARPPGPGAPPPG---MARPPGPGMPPGPGAPPPGARPPGPGAPPPG 249 Query: 252 XXXPPRXPXTPXX--PGGPGXP 193 PP P P GPG P Sbjct: 250 MARPPGPGAPPPGARPPGPGAP 271 Score = 41.9 bits (94), Expect = 0.020 Identities = 44/160 (27%), Positives = 45/160 (28%), Gaps = 6/160 (3%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P G G G G G G PP G GPG Sbjct: 147 PPPPAAAAGPRPPPGAVPRPPGPGMPPGPGAPPPGARPPGPGAPPP-GMARPPGPGAPPP 205 Query: 639 GG---GGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP 469 G G G PP P G G PP P + P P P Sbjct: 206 GARPPGPGAPPPGMARPPGPGMPPGPGAPPPGAR--PPGPGAPPPGMARPPGPGA----P 259 Query: 468 PPPPXPXXPXXPPPP---PPPXXXXXXXXGXGGGGXXXPP 358 PP P P PPP PP G GGG PP Sbjct: 260 PPGARPPGPGAPPPGMARPPGAGIPPAPGGPGGGLPRPPP 299 Score = 41.9 bits (94), Expect = 0.020 Identities = 29/77 (37%), Positives = 29/77 (37%), Gaps = 9/77 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP----PPPPXXXPGP--PPPX---PPXXGGXXXPXAPXXX 721 PPP G G PP PPP PGP PPP PP G P P Sbjct: 234 PPPGARPPGPGAPPPGMARPPGPGAPPPGARPPGPGAPPPGMARPPGAGIPPAPGGPGGG 293 Query: 722 AXPPPPPXPPXPXAGPP 772 PPP P P GPP Sbjct: 294 LPRPPPGGAPLP-PGPP 309 Score = 39.1 bits (87), Expect = 0.14 Identities = 44/159 (27%), Positives = 44/159 (27%), Gaps = 4/159 (2%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 A P P G G G P G G G G PP G G PG Sbjct: 162 AVPRPPGPGM---PPGPGAPPPGARPPGPGA------PPPGMARPP---GPGAPPPGARP 209 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 G G PPP G PPP G P P P Sbjct: 210 PGPGA----------PPPGMARPPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAP 259 Query: 462 PPXPXXPXXPPPPP----PPXXXXXXXXGXGGGGXXXPP 358 PP P PPP PP G GGG PP Sbjct: 260 PPGARPPGPGAPPPGMARPPGAGIPPAPGGPGGGLPRPP 298 Score = 38.3 bits (85), Expect = 0.25 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP--XPAAPXXXPP 802 P P PP P G P P PP P PP P A PP P P PP Sbjct: 138 PAGPGAAPQPPPPAAAAGPRPP--PGAVPRPPGPGMPPGPGAPPPGARPPGPGAPPP 192 Score = 38.3 bits (85), Expect = 0.25 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP-PPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP GP PP G P P P PPP P G P P P Sbjct: 145 PQPPPPAAAAGPRPPP----GAVPRPPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGP 200 Query: 803 XXGXGGA 823 GA Sbjct: 201 GAPPPGA 207 Score = 37.5 bits (83), Expect = 0.43 Identities = 34/117 (29%), Positives = 35/117 (29%), Gaps = 5/117 (4%) Frame = -2 Query: 528 PXXXGXXXKXPXPXXXXXPPPPP---PXPXXPXXPPPP-PPPXXXXXXXXGXGGGGXXXP 361 P G + P P P PPP P P P PP P PP G G P Sbjct: 138 PAGPGAAPQPPPPAAAAGPRPPPGAVPRPPGPGMPPGPGAPPPGARPPGPGAPPPGMARP 197 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP-PRXPXTPXXPGGPGXP 193 P P PG G PP P P P P GPG P Sbjct: 198 PG--------PGAPPPGARPPGPGAPPPGMARPPGPGMPPGPGAPPPGARPPGPGAP 246 Score = 37.5 bits (83), Expect = 0.43 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 6/91 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXX-AXPPPP 739 PP P G G P P PPP P P PP P AP A PP Sbjct: 222 PPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAPPPGARPPGPGAPPPGMARPPGA 281 Query: 740 PXPP---XPXAGPPXPAAPXXXPPXXGXGGA 823 PP P G P P P P G GA Sbjct: 282 GIPPAPGGPGGGLPRP-PPGGAPLPPGPPGA 311 Score = 37.1 bits (82), Expect = 0.57 Identities = 41/161 (25%), Positives = 41/161 (25%), Gaps = 7/161 (4%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 PP P G G P G G G G PP G GPG G Sbjct: 172 PPGPGAPPPGARPPGPGAPPPGMARPPGPGAPPPGARPPGPGAPPP-GMARPPGPGMPPG 230 Query: 639 GGG---GGXXXXXXKXPP----PPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXX 481 G G PP PP G PPP P P Sbjct: 231 PGAPPPGARPPGPGAPPPGMARPPGPGAPPPGARPPGPGAPPPGMARPPGAGIPPAPGGP 290 Query: 480 XXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PP P PP PP G G PP Sbjct: 291 GGGLPRPP-PGGAPLPPGPPGAQPATRGRDPFGLGAPAKPP 330 Score = 33.9 bits (74), Expect = 5.3 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 9/77 (11%) Frame = +3 Query: 516 PXXXGGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPP---------PPPXXXPXPPP 668 P G G P PP P G P PPP PPP P P Sbjct: 166 PPGPGMPPGPGAPPPGARPPGPGAPPPGMARPPGPGAPPPGARPPGPGAPPPGMARPPGP 225 Query: 669 XXPPXXGGXXXXXXPPG 719 PP G PPG Sbjct: 226 GMPPGPGAPPPGARPPG 242 >UniRef50_Q9LVN1 Cluster: Gb|AAD23008.1; n=2; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1307 Score = 56.8 bits (131), Expect = 7e-07 Identities = 34/92 (36%), Positives = 35/92 (38%), Gaps = 11/92 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXG----------GXXXPXAPXX 718 PPPPP PPPPPP P P PP P G P P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPP-PAPPTPQSNGISAMKSSPPAPPAPPRLPTH 766 Query: 719 XAXPPPPPXPPXPXAGPP-XPAAPXXXPPXXG 811 A PPPP PP P G P+AP PP G Sbjct: 767 SASPPPPTAPPPPPLGQTRAPSAPPPPPPKLG 798 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/75 (37%), Positives = 28/75 (37%), Gaps = 7/75 (9%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXX-------PGPPPPXPPXXGGXXXPXAPXXXAXPP 733 PPP PPPPPP P PPPP PP P P P Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPA------PPTPIVHTSSP 727 Query: 734 PPPXPPXPXAGPPXP 778 PPP PP P PP P Sbjct: 728 PPPPPPPPPPAPPTP 742 Score = 50.0 bits (114), Expect = 8e-05 Identities = 41/141 (29%), Positives = 42/141 (29%), Gaps = 6/141 (4%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX---PXXPXXPPP 427 PPP PPPPP K P P P PP P P PPP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPP 733 Query: 426 PPPPXXXXXXXXGXGG--GGXXXPPXFFFLXXXXXXXXXXXXXXPXP-GXXXXGXXPPPP 256 PPPP G PP L P P G PPPP Sbjct: 734 PPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPP 793 Query: 255 XXXXPPRXPXTPXXPGGPGXP 193 PP+ T P GP P Sbjct: 794 ----PPKL-GTKLSPSGPNVP 809 Score = 49.6 bits (113), Expect = 1e-04 Identities = 31/91 (34%), Positives = 32/91 (35%), Gaps = 14/91 (15%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP--------PPPXPPXXGGXXXPXAPXXXA 724 PPPPP PPPP P P P PPP PP P + A Sbjct: 690 PPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISA 749 Query: 725 XPPPPPXPPXP------XAGPPXPAAPXXXP 799 PP PP P A PP P AP P Sbjct: 750 MKSSPPAPPAPPRLPTHSASPPPPTAPPPPP 780 Score = 47.6 bits (108), Expect = 4e-04 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 R PPPPP P P PP PP + +PPPPPPP Sbjct: 688 RPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPP 733 Score = 44.8 bits (101), Expect = 0.003 Identities = 32/86 (37%), Positives = 32/86 (37%), Gaps = 13/86 (15%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPP---PXPPXXGGXXXPXAPXXXAX 727 PP PP G P PP P P PPP P PP G P AP Sbjct: 736 PPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAP----- 790 Query: 728 PPPPP------XPPXPXAGPPXPAAP 787 PPPPP P P PP PA P Sbjct: 791 PPPPPKLGTKLSPSGPNV-PPTPALP 815 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P P PPPP PP P PP PP P + PP P P P Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 41.1 bits (92), Expect = 0.035 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP--PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP PPPPP P PPP PP G P P PP P Sbjct: 757 PPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPPKLGTKLSPSGPN---VPPTPA 813 Query: 743 XPPXP 757 P P Sbjct: 814 LPTGP 818 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/64 (31%), Positives = 22/64 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PP PP P PPPPP + PPP Sbjct: 734 PPPPAPPTPQSNGISAMKSSPPAPPAPP-RLPTHSASPPPPTAPPPPPLGQTRAPSAPPP 792 Query: 421 PPPE 410 PPP+ Sbjct: 793 PPPK 796 Score = 39.1 bits (87), Expect = 0.14 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 +PP PP P PPPPP + PPPPPP Sbjct: 753 SPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 535 PPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP + K P P PPPPP PPPPPP Sbjct: 674 PPPISNSD--KKPALPRPPPPPPPPPMQHSTVTKVPPPPPP 712 Score = 38.3 bits (85), Expect = 0.25 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 4/85 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXP----XPXXXXXPPPPPPXPXXPXXP 433 PPPP T PPPPP P PP PP P P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHS 767 Query: 432 PPPPPPXXXXXXXXGXGGGGXXXPP 358 PPPP G PP Sbjct: 768 ASPPPPTAPPPPPLGQTRAPSAPPP 792 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PP P PP PP PP P P P PP Sbjct: 690 PPPPPPPPMQHSTVTKVP--PPPPPAPPAPPTPIVHTSSPPPPPPPPP 735 Score = 36.3 bits (80), Expect = 1.00 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPPP PP P PPP PP P A PP P PP Sbjct: 687 PRPPPPPPP-------PPMQHSTVTKVPPPPPPAPPA-PPTPIVHTSSPP 728 Score = 35.1 bits (77), Expect = 2.3 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = -3 Query: 530 PPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXN-PPPPPP 417 PP K P P PPPPP PPPPPP Sbjct: 674 PPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPP 712 >UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; Eukaryota|Rep: Putative pherophorin-dz1 protein - Oryza sativa subsp. japonica (Rice) Length = 342 Score = 56.8 bits (131), Expect = 7e-07 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP--PPX 745 PPPP P PPP PPPP PP P P A PPP P Sbjct: 103 PPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIR--PPPPPTPRPYAPPPPSHPLA 160 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P PP P P PP Sbjct: 161 PPPPHISPPAPVPPPPSPP 179 Score = 56.0 bits (129), Expect = 1e-06 Identities = 26/63 (41%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXA----PXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPP PP P PP PP G P + P A PPP PP P PP P+ P Sbjct: 52 PPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPP 111 Query: 794 XPP 802 PP Sbjct: 112 PPP 114 Score = 56.0 bits (129), Expect = 1e-06 Identities = 31/80 (38%), Positives = 32/80 (40%), Gaps = 3/80 (3%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPP---PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP G PPP PPP P PPP P P P A PPP Sbjct: 68 PPPP---GRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRR-APPPPAT 123 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P PP P+ P PP Sbjct: 124 PPPPPRRAPPPPSPPIRPPP 143 Score = 53.6 bits (123), Expect = 6e-06 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPPP- 739 PPPP PPPPP P PP PP PP P P PPPP Sbjct: 75 PPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATP-----PPPPR 129 Query: 740 --PXPPXPXAGPPXPAAPXXXPP 802 P PP P PP P P P Sbjct: 130 RAPPPPSPPIRPPPPPTPRPYAP 152 Score = 52.8 bits (121), Expect = 1e-05 Identities = 26/58 (44%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +2 Query: 629 PPPPPXXXPGPPPP-XPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PPPP P P PP PP G P P A PPP PP P PP PA P P Sbjct: 44 PPPPQRFPPPPAPPIRPPSPPGRAPP--PPGRAPPPPSQAPPPPRRAPPPPALPPPPP 99 Score = 50.4 bits (115), Expect = 6e-05 Identities = 29/74 (39%), Positives = 30/74 (40%), Gaps = 4/74 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP--PPPP 742 PPPPP PPPPP P P PP P P AP + P PPPP Sbjct: 110 PPPPPRRAP-----PPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 164 Query: 743 X--PPXPXAGPPXP 778 PP P PP P Sbjct: 165 HISPPAPVPPPPSP 178 Score = 50.0 bits (114), Expect = 8e-05 Identities = 33/88 (37%), Positives = 34/88 (38%), Gaps = 10/88 (11%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP---PPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPP 733 PPPP PP PPPP P PP P PP AP + PP Sbjct: 51 PPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPP 110 Query: 734 PPP---XPPXPXAGPPXP--AAPXXXPP 802 PPP PP P PP P A P PP Sbjct: 111 PPPPRRAPPPPATPPPPPRRAPPPPSPP 138 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 2/66 (3%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP--XXP 433 + PPPP PPPPP P P PPPP P P P Sbjct: 73 RAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAP 132 Query: 432 PPPPPP 415 PPP PP Sbjct: 133 PPPSPP 138 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/67 (37%), Positives = 25/67 (37%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPP PP P PP P P P AP PP P P Sbjct: 124 PPPPPRRA----------PPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVP 173 Query: 749 PXPXAGP 769 P P P Sbjct: 174 PPPSPPP 180 Score = 45.6 bits (103), Expect = 0.002 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = +2 Query: 629 PPPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 PP P PPPP PP P +P A PPP PP P PP P P Sbjct: 34 PPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPP 92 Score = 42.7 bits (96), Expect = 0.011 Identities = 25/67 (37%), Positives = 26/67 (38%), Gaps = 3/67 (4%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP---PPPPXPXXPXX 436 + PPPP PPPPP P P PP PPPP P P Sbjct: 87 RAPPPPALPPPPPRRAPPPPSMPPPPPPRRAP----PPPATPPPPPRRAPPPPSP--PIR 140 Query: 435 PPPPPPP 415 PPPPP P Sbjct: 141 PPPPPTP 147 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPP P P PPP PPP Sbjct: 141 PPPPPTPR--PYAPPPPSHPLAPPPPHISPPAPVPPPPSPPP 180 Score = 42.3 bits (95), Expect = 0.015 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 P P P P P P P AP PP P PP P PP PA P P Sbjct: 5 PGSPGFGFPFPFYPPNPNPYAPLNPNAPKPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPP 64 Query: 809 G 811 G Sbjct: 65 G 65 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXPP--PPPPP 415 PPPP + P P PPP PPP P PP PPPPP Sbjct: 68 PPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPP 113 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P PPPP PPP Sbjct: 75 PPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPP 134 Query: 421 PPP 413 P P Sbjct: 135 PSP 137 Score = 41.1 bits (92), Expect = 0.035 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP + P P PPPPP P P PPPP P Sbjct: 118 PPPPATPPPPPRRAPPPPSPPIRPPPPPTP-RPYAPPPPSHP 158 Score = 40.7 bits (91), Expect = 0.046 Identities = 29/96 (30%), Positives = 29/96 (30%), Gaps = 4/96 (4%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGX 511 PP G PG PPP PPPPP Sbjct: 60 PPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPP 119 Query: 510 XXKXPXPXXXXXPPPP-PP-XPXXPXXPPP--PPPP 415 P P PPPP PP P P P P PPPP Sbjct: 120 PPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPP 155 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P PP P P P PP P AP PP PP P PP P+ P Sbjct: 32 PKPPVMPPRPQAPPPPQR--FPPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPP 85 Score = 40.3 bits (90), Expect = 0.061 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP--PXXPPXXGGXXXXXXP 713 G P PPPP A P PPPPP P PP P PP P Sbjct: 65 GRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATP 124 Query: 714 PGXP 725 P P Sbjct: 125 PPPP 128 Score = 38.7 bits (86), Expect = 0.19 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP-PXPAAPXXXPPXXG 811 P P P P P P P P PPPP P P A P P+ P PP G Sbjct: 13 PFPFYPPNPNPYAPLNPNAPKPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPPPG 72 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +2 Query: 590 GGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP--XPPXPXA 763 G G PP P P P P PP P PPP P PP P Sbjct: 6 GSPGFGFPFPFYPPNPNPYAPLNPNAPKPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPG 65 Query: 764 GPPXPAAPXXXPP 802 P P PP Sbjct: 66 RAPPPPGRAPPPP 78 Score = 37.1 bits (82), Expect = 0.57 Identities = 30/117 (25%), Positives = 30/117 (25%), Gaps = 2/117 (1%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PP P P PP PP P P PPPP PP Sbjct: 32 PKPPVMPPRPQAPPPPQRFPPPPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPP 91 Query: 357 XFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPP--RXPXTPXXPGGPGXP 193 P PPPP PP R P P P P P Sbjct: 92 P----ALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPP 144 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKX--PXXPXXXXXPPPPPXXXXXXXTPP 428 PPPP PPPPP P P PP PP TP Sbjct: 89 PPPPALPPPPPRRAPPPPSMPPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPR 148 Query: 427 P--PPPP 413 P PPPP Sbjct: 149 PYAPPPP 155 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/66 (33%), Positives = 22/66 (33%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PPPPP P P PPPP P Sbjct: 122 ATPPPPPRR----APPPPSPPIRPPPPPTPR---PYAPPPPSHPLAPPPPHISPPAPVPP 174 Query: 430 PPPPPP 413 PP PPP Sbjct: 175 PPSPPP 180 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP--PP 415 PP PP P PPPP P P PPPP PP Sbjct: 53 PPAPPIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPP 96 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP A P PPPP P PP PP Sbjct: 64 PGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPP 104 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPP-----PPPP 414 APPPP + P P PPPP PPP PPPP Sbjct: 117 APPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 164 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPP--PXXPPXXGGXXXXXXPPGXP 725 P P PP A P PPPP P PP P PP PP P Sbjct: 57 PIRPPSPPGRAPPPPGRAPPPPSQAPPPPRRAPPPPALPPPPPRRAPPPPSMPPPPPP 114 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXP--PPXXPPXXGGXXXXXXPP 716 P PPPP A P PPPPP P P PP PP PP Sbjct: 105 PPSMPPPPPP-----RRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPP 154 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP---PPXXXPXPPPXXPP 680 P PPPP P PPPP PP P PPP PP Sbjct: 138 PIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVP-PPPSPPP 180 >UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=2; Ostreococcus|Rep: RhoA GTPase effector DIA/Diaphanous - Ostreococcus tauri Length = 1105 Score = 56.8 bits (131), Expect = 7e-07 Identities = 28/68 (41%), Positives = 28/68 (41%), Gaps = 2/68 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP--P 742 PPPPP PPPPP P PPPP PP P P A PP P P Sbjct: 449 PPPPPPPFARAQSANANVSAPPPPPPPPPPPPPPPPPRPS--LGPIVPTPPAPPPVPRAP 506 Query: 743 XPPXPXAG 766 PP P G Sbjct: 507 VPPAPPTG 514 Score = 56.0 bits (129), Expect = 1e-06 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP C PPPPPP P P P PPPPP P Sbjct: 429 PPPPPPPPPKRIGCDITHPPPPPPPP----PFARAQSANANVSAPPPPPPPPPPPPPPPP 484 Query: 749 PXPXAGP--PXPAAPXXXP 799 P P GP P P AP P Sbjct: 485 PRPSLGPIVPTPPAPPPVP 503 Score = 51.6 bits (118), Expect = 2e-05 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 9/82 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG---------PPPPXPPXXGGXXXPXAPXXX 721 PPPPP G PPPPPP PPPP PP P P Sbjct: 431 PPPPPPPKRIGCDITHPPPPPPPPPFARAQSANANVSAPPPPPPPPPPPPPPPPPRPSLG 490 Query: 722 AXPPPPPXPPXPXAGPPXPAAP 787 P PP PP P PA P Sbjct: 491 PIVPTPPAPPPVPRAPVPPAPP 512 Score = 46.8 bits (106), Expect = 7e-04 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPPPP P P P PP P P P PP Sbjct: 451 PPPPPFARAQSANANVSAPPPPPPPPPPPPPPPPPRPSLGPIVPTPPAPPPVPRAPVPPA 510 Query: 420 PP 415 PP Sbjct: 511 PP 512 Score = 43.6 bits (98), Expect = 0.007 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 G P PPPP A PPPPPP P PPP PP PP Sbjct: 441 GCDITHPPPPPPPPPFARAQSANANVSAPPPPPPP--PPPPPPPPPPRPSLGPIVPTPPA 498 Query: 720 XP 725 P Sbjct: 499 PP 500 Score = 40.7 bits (91), Expect = 0.046 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 8/70 (11%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX--PXPXXXXXPPPPPPXP------XX 445 PPPP G PPPPP P PPPPPP P Sbjct: 431 PPPPPPPKRIGCDITHPPPPPPPPPFARAQSANANVSAPPPPPPPPPPPPPPPPPRPSLG 490 Query: 444 PXXPPPPPPP 415 P P PP PP Sbjct: 491 PIVPTPPAPP 500 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P P P PP P PP Sbjct: 450 PPPPPPFARAQSANANVSAPPPPPPPPPPPPPPPPPRPSLGPIVPTPPAPPPVPRAPVPP 509 Query: 421 PPP 413 PP Sbjct: 510 APP 512 Score = 36.7 bits (81), Expect = 0.75 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 491 PXXXPXPPPPPXXLXXXXNPPPPPPP 414 P P PPPPP + PPPPPP Sbjct: 427 PGPPPPPPPPPKRIGCDITHPPPPPP 452 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 10/51 (19%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP----------XXXPXPPPXXPP 680 P PPPP G P PPPPPP P PPP PP Sbjct: 427 PGPPPPPPPPPKRIGCDITHPPPPPPPPPFARAQSANANVSAPPPPPPPPP 477 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 7/49 (14%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXN-------PPPPPPP 414 P PPP + P PPPPP + PPPPPPP Sbjct: 427 PGPPPPPPPPPKRIGCDITHPPPPPPPPPFARAQSANANVSAPPPPPPP 475 Score = 34.3 bits (75), Expect = 4.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 490 PXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PPPPP T PPPPPP Sbjct: 427 PGPPPPPPPPPKRIGCDITHPPPPPP 452 Score = 34.3 bits (75), Expect = 4.0 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = -2 Query: 474 PPPPPPXPXX-----PXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXX 310 PPPPPP P PPPPPPP PP Sbjct: 430 PPPPPPPPKRIGCDITHPPPPPPPPPFARAQSANANVSAPPPPP----------PPPPPP 479 Query: 309 XXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGG 205 P P P PP PR P P P G Sbjct: 480 PPPPPPRPSLGPIVPTPPAPPPVPRAPVPPAPPTG 514 >UniRef50_Q20327 Cluster: Ground-like (Grd related) protein 4; n=2; Caenorhabditis|Rep: Ground-like (Grd related) protein 4 - Caenorhabditis elegans Length = 210 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/70 (41%), Positives = 29/70 (41%), Gaps = 1/70 (1%) Frame = +2 Query: 593 GGGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP 769 GG PPPPPP P P P P PP P P PPPPP PP P P Sbjct: 20 GGCCSMGPPPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMC---PPPPPPPPPPMCPP 76 Query: 770 PXPAAPXXXP 799 P P P P Sbjct: 77 PPPPMPSYSP 86 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -2 Query: 573 GGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP-PPPXPXXPXXPPPPPPP 415 GG PPPPP P P PP PP P P PPPPPPP Sbjct: 20 GGCCSMGPPPCPPPPPPMCAPPP-LPCPPPPICPPQFCPPPPMCPPPPPPPPPP 72 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXP---PPPPXPPXPXAGPPXPAAPXXXPP 802 P PPP PP P P P PPPP P P PP P P PP Sbjct: 28 PPCPPPPPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPPPPPP 80 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPPP P P PPPPP P Sbjct: 46 PPPPICPPQFC--PPPPMCPPPPPPPPPPMCP--PPPPPMP 82 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P PPP P P PPPPPP P PPPPPP Sbjct: 44 PCPPPPICPPQFCPPPPMCPPPPPPPPP----PMCPPPPPP 80 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -1 Query: 577 GGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 GG G PPPPP P P PPP PPPPPPP Sbjct: 20 GGCCSMGPPPCPPPPPPMCAPPPLPCPPPPICPPQFCPPP--PMCPPPPPPPPPP 72 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P PPPPP PPPPP P Sbjct: 40 PPPLPCPPPPICPPQFCPPPPMCPPPPPPPPPPMCPPPPPPMP 82 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = +2 Query: 656 GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG----PPXPAAPXXXPP 802 GPPP PP P PPP P PP P PP P P PP Sbjct: 26 GPPPCPPP----------PPPMCAPPPLPCPPPPICPPQFCPPPPMCPPPPPP 68 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 56.8 bits (131), Expect = 7e-07 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P PPPP PP P PPPPP P P PP P P P Sbjct: 44 PPPPPPPASPPPPPPPPP----------PPPPPPPPPPPPEPEPQPAPPPPETPSQSQP 92 Score = 52.0 bits (119), Expect = 2e-05 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P P PPPP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 50.8 bits (116), Expect = 4e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 PP PP P PPPP PP P P A PPPPP P P Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTPLMP 1985 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P P P PPP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPP 83 Score = 48.0 bits (109), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPPPPP P PPPP P Sbjct: 46 PPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETP 87 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/53 (43%), Positives = 23/53 (43%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PP PP P PPPP PP PPPPP PP A PP P P Sbjct: 1942 PPRPPTLAPPPPPPPPPPT------------EDPPPPPPPPPAEAPPPPPPTP 1982 Score = 45.6 bits (103), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 T PP PP P P PPPPPP P PPPP P Sbjct: 1938 TSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 Score = 45.6 bits (103), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP P P P PPPPPP P PPPPP P Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPP P Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETP 87 Score = 40.3 bits (90), Expect = 0.061 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 668 PXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P P PPPPP PP PP P P PP Sbjct: 1932 PATPTITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPP 1976 Score = 39.9 bits (89), Expect = 0.081 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P P P PPPPPP P PPPPPP Sbjct: 1932 PATPTITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPP 1971 Score = 38.7 bits (86), Expect = 0.19 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP 442 PPPPP P P PPPPPP P P Sbjct: 1953 PPPPPPPTEDPPPPPPPPPAEAPPPPPPTPLMP 1985 Score = 38.3 bits (85), Expect = 0.25 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPPPP P PPP PP PP Sbjct: 50 PASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P + P PPPPPP P PPPPPPP Sbjct: 1932 PATPTITSAAPPRPPTLAPPPPPPPPPPTEDPP--PPPPPPP 1971 Score = 37.9 bits (84), Expect = 0.33 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 PPPP P PPPPPP P PP P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEP 77 Score = 37.9 bits (84), Expect = 0.33 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 P PPPP P PPPPPP P PPP P Sbjct: 1946 PTLAPPPPPPPP---PPTEDPPPPPPPPPAEAPPPPPPTP 1982 Score = 37.5 bits (83), Expect = 0.43 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPP 680 P PPPPPP P PPP PP Sbjct: 42 PPPPPPPPPASPPPPPPPPPP 62 Score = 37.5 bits (83), Expect = 0.43 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 PPPP P PPPPPP P P P P Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQP 79 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-PPPXPP 679 PPPPP PPPPPP P P P P PP Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPP 82 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPPP PPPPPPP Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPPP 1970 Score = 37.5 bits (83), Expect = 0.43 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -1 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P P PPPPP PPPPPPP Sbjct: 1943 PRPPTLAPPPPPPPPPPTEDPPPPPPPPP 1971 Score = 37.5 bits (83), Expect = 0.43 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPP 680 P PPPPPP P PPP PP Sbjct: 1951 PPPPPPPPPTEDPPPPPPPPP 1971 Score = 37.1 bits (82), Expect = 0.57 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 573 PPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 PPP P PPPPPP P PPP P Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEP 77 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP P P PPPPP PPPPP P Sbjct: 1942 PPRPPTLA--PPPPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 1/56 (1%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA-APXXXPP 802 PP P P P PPPPP P PP PA AP PP Sbjct: 1925 PPAQAQAPATPTITSAAPPRPPTLAPPPPPPPPPPTEDPPPPPPPPPAEAPPPPPP 1980 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP 417 +PPPPP P P PPPPP P PPPP Sbjct: 52 SPPPPP---------PPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 618 PXXPPPPPPXXXPXPPPXXPP 680 P PPPPPP PPP PP Sbjct: 1950 PPPPPPPPPPTEDPPPPPPPP 1970 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPPP P P P P PP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETPSQSQP 92 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 AP P + P PPPPP +PPPPPPP Sbjct: 1931 APATPTITSAAPPRPPTLAPPPPPPPPP----PTEDPPPPPPP 1969 Score = 33.5 bits (73), Expect = 7.0 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 472 PPPPPXXXXXXXTPPPPPPPE 410 PPPPP PPPPPP E Sbjct: 1953 PPPPPPPTEDPPPPPPPPPAE 1973 >UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; Basidiomycota|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 464 Score = 56.8 bits (131), Expect = 7e-07 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 6/79 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG---XXXPXAPXXXAXPP-- 733 PPPPP G PP P P PPPP P G P P A PP Sbjct: 278 PPPPPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGG 337 Query: 734 -PPPXPPXPXAGPPXPAAP 787 PPP PP P + P P P Sbjct: 338 APPPPPPPPTSAPSAPPLP 356 Score = 55.2 bits (127), Expect = 2e-06 Identities = 30/85 (35%), Positives = 30/85 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP P PPP P PPPP P P AP PPPPP P Sbjct: 256 PPPPASRSARPSSVAQPSAPSVPPPP--PPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPP 313 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGGA 823 P P PP GGA Sbjct: 314 VRSDGTGVAPPPPPPPPPARPPGGA 338 Score = 49.6 bits (113), Expect = 1e-04 Identities = 26/64 (40%), Positives = 27/64 (42%), Gaps = 5/64 (7%) Frame = +2 Query: 626 PPPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXA---XPPPPPXPPXPXAGPPXPAAPX 790 PPPPPP PP PP P P P + PPP PP P A PP A P Sbjct: 282 PPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPP 341 Query: 791 XXPP 802 PP Sbjct: 342 PPPP 345 Score = 48.8 bits (111), Expect = 2e-04 Identities = 25/62 (40%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXP--PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP-PXPAAPXXX 796 P PP P PPPP P AP PPPPP P P A P P+AP Sbjct: 245 PAPPTSRRKPAPPPPASRSARPSSVAQPSAPSVPPPPPPPPPPGRPAAPPSAPPSAPSAP 304 Query: 797 PP 802 PP Sbjct: 305 PP 306 Score = 48.8 bits (111), Expect = 2e-04 Identities = 31/86 (36%), Positives = 32/86 (37%), Gaps = 14/86 (16%) Frame = +2 Query: 569 PPPPPXXG------GGGXXCXXXXXPPPPPPXXX--------PGPPPPXPPXXGGXXXPX 706 PPPPP G PPPPPP P PPPP P P Sbjct: 281 PPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPP--------PA 332 Query: 707 APXXXAXPPPPPXPPXPXAGPPXPAA 784 P A PPPPP P + PP P A Sbjct: 333 RPPGGAPPPPPPPPTSAPSAPPLPTA 358 Score = 48.0 bits (109), Expect = 3e-04 Identities = 21/62 (33%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PPPP + PPPPPP P PPPP Sbjct: 283 PPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPP 342 Query: 420 PP 415 PP Sbjct: 343 PP 344 Score = 47.6 bits (108), Expect = 4e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX-PXXPXXPPPP 424 PPPP PPPPP PPPPPP P PPPP Sbjct: 284 PPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPP 343 Query: 423 PPP 415 PPP Sbjct: 344 PPP 346 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/65 (33%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXP--PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP 428 PPPP G P PPPP + PPPPP PP Sbjct: 281 PPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPP 340 Query: 427 PPPPP 413 PPPPP Sbjct: 341 PPPPP 345 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPP--PPXXXPXPPPXXP 677 P PPPP G A P PPPP PP P PPP P Sbjct: 305 PPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPP 346 Score = 40.3 bits (90), Expect = 0.061 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPP--PXXXPXPPPXXPP 680 P PPPP G P PPPPP P PPP PP Sbjct: 304 PPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPP 346 Score = 39.1 bits (87), Expect = 0.14 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 12/73 (16%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXP----------PPPPPPXXXXXX 397 PPPP P PPP PPP P P P PPPPPP Sbjct: 256 PPPPASRSARPSSVAQPSAPSVPPPPPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVR 315 Query: 396 XXGXGGGGXXXPP 358 G G PP Sbjct: 316 SDGTGVAPPPPPP 328 Score = 38.7 bits (86), Expect = 0.19 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP G A P PP P P PPP PP PP P Sbjct: 275 PSVPPPPPPPPPPGRPAA--PPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPP 328 Score = 38.3 bits (85), Expect = 0.25 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 3/84 (3%) Frame = -2 Query: 600 PPPPXXGGG--GGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX-PXXPXXPP 430 PPPP PPPPP P P PP PP P P PP Sbjct: 256 PPPPASRSARPSSVAQPSAPSVPPPPPPP-------PPPGRPAAPPSAPPSAPSAP--PP 306 Query: 429 PPPPPXXXXXXXXGXGGGGXXXPP 358 PPPPP G PP Sbjct: 307 PPPPPPPVRSDGTGVAPPPPPPPP 330 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 2/59 (3%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPP--PXXXXXXXXXXGGGG 372 APPPPP P PPPPP PPPPPP GG Sbjct: 303 APPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPPPPPPTSAPSAPPLPTASGG 361 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG 691 PPPPP GG PPPPPP PP P GG Sbjct: 327 PPPPPARPPGGAP------PPPPPPPTSAPSAPPLPTASGG 361 Score = 35.9 bits (79), Expect = 1.3 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P P PPPPP P Sbjct: 303 APPPPPPPPPPVRSDGTGVAPPPPPPPP---------PARPPGGAPPPPPPPPTSAPSAP 353 Query: 430 PPP 422 P P Sbjct: 354 PLP 356 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP P P P P P P PPPPPPP Sbjct: 244 PPAPPTSRRKPAPPPPASRSARPSSVAQPSAPSVPPPPPPP 284 Score = 33.9 bits (74), Expect = 5.3 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 11/67 (16%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXX--PXXPPPPPPXXXPX---------PPPXXPPXXGGXXXX 704 P PPPP A P PPPPPP P PPP PP Sbjct: 279 PPPPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGA 338 Query: 705 XXPPGXP 725 PP P Sbjct: 339 PPPPPPP 345 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 635 PPPXXXPGPP--PPXPPXXGGXXXPXAPXXX-AXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P PP PP P P A P P P PP P P P Sbjct: 232 PPPAEAPKKPSRPPAPPTSRRKPAPPPPASRSARPSSVAQPSAPSVPPPPPPPPPPGRP 290 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPP 420 R APPPP P PPPPP PPPPP Sbjct: 252 RKPAPPPPASRSARPSSVAQPSAPSVPPPPP--------PPPPP 287 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP + P P PPP P PPP G PP Sbjct: 278 PPPPPPPPPPGRPAAPPSAPPSAPSAPPPPP-PPPPPVRSDGTGVAPPPPPPP 329 >UniRef50_Q4PG90 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 1074 Score = 56.8 bits (131), Expect = 7e-07 Identities = 45/137 (32%), Positives = 45/137 (32%), Gaps = 13/137 (9%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGG-GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXX 610 G G GG G G GGG G G GG GG GGGGGG Sbjct: 904 GGGGGGGAPLGAAAAGLLGGGGTPLDGKEGAAADGGGGGPRGGAGRPVAGGGGGGGAAGD 963 Query: 609 XKX-----PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP---PPPP-- 460 PPP G GG P P G P P PPPP Sbjct: 964 DAAGREGGAPPP--GRTGGLPRLVLTLEPAPLGLSLGMPPANKPPRPGGPPSAGPPPPDD 1021 Query: 459 --PXPXXPXXPPPPPPP 415 P P PPPPPPP Sbjct: 1022 ASPERMMPDAPPPPPPP 1038 Score = 50.8 bits (116), Expect = 4e-05 Identities = 44/138 (31%), Positives = 46/138 (33%), Gaps = 9/138 (6%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG GA G GG GGGGG GA G G G GGGGG Sbjct: 885 GGGGGGAMGTLLAGLTAGG-GGGGGGGAPLGAAAAGLLGGGGTPLDGKEGAAADGGGGGP 943 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXP--PPPPXXXGXXXK-----XPXPXXXXXPPPP 463 + P GGGGG PPP G + P P PP Sbjct: 944 RGGAGR--PVAGGGGGGGAAGDDAAGREGGAPPPGRTGGLPRLVLTLEPAPLGLSLGMPP 1001 Query: 462 PPXPXXPXXPPP--PPPP 415 P P PP PPPP Sbjct: 1002 ANKPPRPGGPPSAGPPPP 1019 Score = 50.8 bits (116), Expect = 4e-05 Identities = 40/123 (32%), Positives = 40/123 (32%), Gaps = 12/123 (9%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXX---VXXXXXPPPPPXX 589 GGGG G G GGG G G P GGGGG PPP Sbjct: 922 GGGGTPLDGKEGAAADGGGGGPRGGAGR----PVAGGGGGGGAAGDDAAGREGGAPPPGR 977 Query: 590 GGGGXXCXXXXXPPP-------PPPXXXPGP--PPPXPPXXGGXXXPXAPXXXAXPPPPP 742 GG P P PP P P PP P P A PPPPP Sbjct: 978 TGGLPRLVLTLEPAPLGLSLGMPPANKPPRPGGPPSAGPPPPDDASPERMMPDAPPPPPP 1037 Query: 743 XPP 751 PP Sbjct: 1038 PPP 1040 Score = 44.4 bits (100), Expect = 0.004 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXG--AXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG GA PA G GG GGG A G A G GG GG GGGG Sbjct: 813 GGGGGGAVAFRRPAGGAGG-GGGASGAPLVGLPAGGAGGAGGGGGAGGASVLGLLGGGGA 871 Query: 627 GXXXXXXKXPPPPXXGGGG 571 G P GGGG Sbjct: 872 GGAAQDVVLGRPGGGGGGG 890 Score = 40.7 bits (91), Expect = 0.046 Identities = 30/85 (35%), Positives = 30/85 (35%), Gaps = 7/85 (8%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGX-GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGP------GXXX 643 GG G G P G G GG G GA G GG G GG G Sbjct: 827 GGAGGGGGASGAPLVGLPAGGAGGAGGG--GGAGGASVLGLLGGGGAGGAAQDVVLGRPG 884 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGG 568 GGGGGG GGGGG Sbjct: 885 GGGGGGAMGTLLAGLTAGGGGGGGG 909 Score = 39.5 bits (88), Expect = 0.11 Identities = 34/101 (33%), Positives = 34/101 (33%), Gaps = 12/101 (11%) Frame = -1 Query: 679 GGXXGG-GXGXXXGGGGGGXXGXXAXX----PPPPXXXGGGGXXXGXXXXXPPPPPXXXG 515 GG GG G GGGGGG G A PPP GG P P G Sbjct: 941 GGPRGGAGRPVAGGGGGGGAAGDDAAGREGGAPPPGRTGG--LPRLVLTLEPAPLGLSLG 998 Query: 514 ----EXXKXPXXPXXXXXPPPP---PXXXXXXXTPPPPPPP 413 P P PPP P PPPPPPP Sbjct: 999 MPPANKPPRPGGPPSAGPPPPDDASPERMMPDAPPPPPPPP 1039 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 GGGGGGG R GG GG G G GG GG Sbjct: 812 GGGGGGGAVAFRRPAGGAGGGGGASGAPLVGLPAGGAGGAGG 853 Score = 37.1 bits (82), Expect = 0.57 Identities = 23/59 (38%), Positives = 23/59 (38%), Gaps = 6/59 (10%) Frame = -2 Query: 783 AAGXGGPAXGXGGXGGGGGXAXXX------GAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 AA G G GG GGGG A G G P G GG G GGG GG Sbjct: 801 AAALGLAVAGGGGGGGGGAVAFRRPAGGAGGGGGASGAPLVGLPAGGAGGAGGGGGAGG 859 Score = 35.1 bits (77), Expect = 2.3 Identities = 43/147 (29%), Positives = 44/147 (29%), Gaps = 18/147 (12%) Frame = +2 Query: 416 GGGGGGGXXG------XXGXGGGGGG--------XXXXXGXGXFXXFPXXXGGGGGXXXV 553 GGGGGGG G G GGGGGG G G GG Sbjct: 884 GGGGGGGAMGTLLAGLTAGGGGGGGGGAPLGAAAAGLLGGGGTPLDGKEGAAADGGGGGP 943 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX 727 P GGGG PPP G P A Sbjct: 944 RGGAGRPVAGGGGGGGAAGDDAAGREGGAPPPGRTGGLPRLVLTLEPAPLGLSLGMPPAN 1003 Query: 728 PPPPPXPPXPXAGPPXP--AAPXXXPP 802 PP P P P AGPP P A+P P Sbjct: 1004 KPPRPGGP-PSAGPPPPDDASPERMMP 1029 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 GGGGGGG R GG G G P GG G Sbjct: 811 GGGGGGGGAVAFRRPAGGAGGGGGASGAPLVGLPAGGAGGAG 852 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GG GG G L + G GGG Sbjct: 812 GGGGGGGAVAFRRPAGGAGGGGGASGAPLVGLPAGGAGGAGGG 854 >UniRef50_Q0U8T6 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 285 Score = 56.8 bits (131), Expect = 7e-07 Identities = 36/86 (41%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX- 745 PPPPP G PPPPPP PPPP PP G A A PPPPP Sbjct: 196 PPPPPAAESG--------LPPPPPPAGCEAPPPP-PPAAGAAAAAAAD---AVPPPPPAG 243 Query: 746 -PPXPXAGPPXPAAPXXXPPXXGXGG 820 P A PP PAA P G G Sbjct: 244 GAPDAKACPPGPAANGTLPDAKGKKG 269 Score = 50.4 bits (115), Expect = 6e-05 Identities = 31/74 (41%), Positives = 32/74 (43%), Gaps = 9/74 (12%) Frame = +2 Query: 629 PPPPPXXXPGPP----PPXPPXXGGXXXPXAPXXXAXPPPPP---XPPXPXAG--PPXPA 781 PP PP PP PP PP P AP A PP PP PP P AG PP P Sbjct: 95 PPTPPAAGGAPPVGAAPPAPPAGAA---PPAPPAGAAPPAPPAGAAPPAPPAGAAPPAPP 151 Query: 782 APXXXPPXXGXGGA 823 + PP GGA Sbjct: 152 SGAAAPPPPAAGGA 165 Score = 48.8 bits (111), Expect = 2e-04 Identities = 33/85 (38%), Positives = 33/85 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP GG PP PP G PP PP P AP A PP PP Sbjct: 95 PPTPPAAGG----APPVGAAPPAPP---AGAAPPAPPAGAA---PPAPPAGAAPPAPPAG 144 Query: 749 PXPXAGPPXPAAPXXXPPXXGXGGA 823 P A PP AA P G GA Sbjct: 145 AAPPA-PPSGAAAPPPPAAGGASGA 168 Score = 46.8 bits (106), Expect = 7e-04 Identities = 37/140 (26%), Positives = 38/140 (27%), Gaps = 4/140 (2%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 APP P G A P G G A G P G P Sbjct: 110 APPAPPAG------AAPPAPPAGAAPPAPPAGAAPPAPPAGAAPPAPPSGAAAPPPPAAG 163 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 G G G + P P PPPPP P P PPPP Sbjct: 164 GASGAGGAPAAGESPAPA--AAAMRKRATPDAALPPPPPAAESGLPPPPPPAGCEAPPPP 221 Query: 462 PPXPXXPXXPP----PPPPP 415 PP PPPPP Sbjct: 222 PPAAGAAAAAAADAVPPPPP 241 Score = 45.6 bits (103), Expect = 0.002 Identities = 33/98 (33%), Positives = 33/98 (33%), Gaps = 13/98 (13%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP------PPXXXPGPPPPXPPXXGG----XXXPXAPXX 718 PP PP G G P G PP PP GG P AP Sbjct: 57 PPAPPADGEGKGKAKGTGAPDAKGDAKGAAKGKGAGAAPPTPPAAGGAPPVGAAPPAPPA 116 Query: 719 XAXPPPPP---XPPXPXAGPPXPAAPXXXPPXXGXGGA 823 A PP PP PP P AG PA P P GA Sbjct: 117 GAAPPAPPAGAAPPAPPAGAAPPAPPAGAAPPAPPSGA 154 Score = 41.5 bits (93), Expect = 0.026 Identities = 47/175 (26%), Positives = 47/175 (26%), Gaps = 21/175 (12%) Frame = +2 Query: 359 GGXXXPPPPX---PXXXXXXFXGGGGGGGXX---GXXGXGGGGGGXXXXXGXGXFXXFPX 520 GG P PP P G G G G G G G G P Sbjct: 40 GGAAPPAPPTGAAPTGAPPAPPADGEGKGKAKGTGAPDAKGDAKGAAKGKGAGAAPPTPP 99 Query: 521 XXGGG---GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-----PXP 676 GG G PP P G PP PP P PP P P Sbjct: 100 AAGGAPPVGAAPPAPPAGAAPPAPPAGAAPPAPPAGAAPPAPPAGAAPPAPPSGAAAPPP 159 Query: 677 PXXGGXXXP-XAPXXXAXPPPPP------XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P GG AP P P P PP PAA PP G Sbjct: 160 PAAGGASGAGGAPAAGESPAPAAAAMRKRATPDAALPPPPPAAESGLPPPPPPAG 214 Score = 40.7 bits (91), Expect = 0.046 Identities = 31/92 (33%), Positives = 31/92 (33%), Gaps = 8/92 (8%) Frame = +2 Query: 572 PPPPXXGG----GGXXCXXXXXPPPPPPXXXPGPP----PPXPPXXGGXXXPXAPXXXAX 727 PPPP GG GG P P PP PP P P Sbjct: 157 PPPPAAGGASGAGGAPAAGESPAPAAAAMRKRATPDAALPPPPPAAESGLPPPPPPAGCE 216 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PPPP PP AG AA PP GGA Sbjct: 217 APPPP-PP--AAGAAAAAAADAVPPPPPAGGA 245 Score = 35.9 bits (79), Expect = 1.3 Identities = 45/189 (23%), Positives = 45/189 (23%), Gaps = 15/189 (7%) Frame = -2 Query: 741 GGGGGXAXXXGAXGXXXPPXXGGXGGG-------GPGXXXGGGGGGXXXXXXKXPPPPXX 583 GG A GA PP G G G G G PP Sbjct: 40 GGAAPPAPPTGAAPTGAPPAPPADGEGKGKAKGTGAPDAKGDAKGAAKGKGAGAAPPTPP 99 Query: 582 GGGGGXXXXXTXXXPP----PPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP----PP 427 GG PP PP G P P PP PP P P P Sbjct: 100 AAGGAPPVGAAPPAPPAGAAPPAPPAG--AAPPAPPAGAAPPAPPAGAAPPAPPSGAAAP 157 Query: 426 PPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXX 247 PPP G G P P P G PPPP Sbjct: 158 PPPAAGGASGAGGAPAAGESPAPA---AAAMRKRATPDAALPPPPPAAESGLPPPPPPAG 214 Query: 246 XPPRXPXTP 220 P P Sbjct: 215 CEAPPPPPP 223 Score = 35.9 bits (79), Expect = 1.3 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 3/79 (3%) Frame = -1 Query: 640 GGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP 461 GG G G A P PPPPP P PPPP Sbjct: 163 GGASGAGGAPAAGESPAPAAAAMRKRATPDAALPPPPPAAESGLPPPPPPAGCEAPPPPP 222 Query: 460 PXXXXXXXTPP---PPPPP 413 P PPPPP Sbjct: 223 PAAGAAAAAAADAVPPPPP 241 >UniRef50_A4R3R8 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 464 Score = 56.8 bits (131), Expect = 7e-07 Identities = 33/100 (33%), Positives = 34/100 (34%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G A GGG G + G G G GGGG G GGG Sbjct: 207 GGAASGGGGAANNADSGNNAGGGSGGSADAGGGGGAGGSADAGGGGGGAGGAAGGGAAA- 265 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXK 502 PPPP GG PPPPP G K Sbjct: 266 -------PPPPADGGAPPPPPADGAAPPPPPPDAKGKDAK 298 Score = 54.4 bits (125), Expect = 4e-06 Identities = 32/92 (34%), Positives = 32/92 (34%), Gaps = 1/92 (1%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXP-PPPPXXG 592 GGG GGG GG G G GGGGG PPPP G Sbjct: 213 GGGAANNADSGNNAGGGSGGSADAGGGGGAGGSADAGGGGGGAGGAAGGGAAAPPPPADG 272 Query: 593 GGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXG 688 G PPPPP PPPP P G Sbjct: 273 GA----------PPPPPADGAAPPPPPPDAKG 294 Score = 43.2 bits (97), Expect = 0.009 Identities = 38/124 (30%), Positives = 38/124 (30%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G A G A GG A G G G GGG G GGGG Sbjct: 189 GDAAKAGDAAKVDDKAKAGGAAS--GGGGAANNADSGNNAGGGSGGSADAGGGGGAGGSA 246 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 GGGG PPPP G PPPPP PP Sbjct: 247 DA----GGGGGGAGGAAGGGAAAPPPPADGGA-------------PPPPPADGAA---PP 286 Query: 426 PPPP 415 PPPP Sbjct: 287 PPPP 290 Score = 41.5 bits (93), Expect = 0.026 Identities = 30/90 (33%), Positives = 31/90 (34%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKX 500 G GGG G GGGG G A GGG PPPP G Sbjct: 223 GNNAGGGSGGSADAGGGGGAGGSADA----GGGGGGAGGAAGGGAAAPPPPADGGA---- 274 Query: 499 PXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPPPP PPPPPP+ Sbjct: 275 ---------PPPPPADG----AAPPPPPPD 291 Score = 37.9 bits (84), Expect = 0.33 Identities = 31/99 (31%), Positives = 31/99 (31%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGGG GGG G G G GGGGG G Sbjct: 212 GGGGAANNADSGNNAGGGSGGSADAGGGGGAGGSADAGGGGG----------------GA 255 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP 712 GG PPPP G PPP PP G P P Sbjct: 256 GGAAGGGAAAPPPPADG---GAPPP-PPADGAAPPPPPP 290 Score = 33.5 bits (73), Expect = 7.0 Identities = 30/98 (30%), Positives = 30/98 (30%), Gaps = 13/98 (13%) Frame = -2 Query: 822 APPXPXX-GGXXXG------AAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG 664 APP P GG G AAG G A G G G G G G GG Sbjct: 331 APPPPAAAGGAGAGKGSGKKAAGAAGAAAGAAGAGAGSGGGAMGDMSGSGGSASSGGDAV 390 Query: 663 GGPGXXXGG------GGGGXXXXXXKXPPPPXXGGGGG 568 G GG GGGG GGG Sbjct: 391 SGGSASSGGSSDSSSGGGGSSSSSGGDSSASGGSSGGG 428 Score = 33.5 bits (73), Expect = 7.0 Identities = 25/83 (30%), Positives = 26/83 (31%), Gaps = 5/83 (6%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXP---PXXGGXG--GGGPGXXXGG 637 G GAAG A G G GGG G+ G GG GG GG Sbjct: 348 GKKAAGAAGAAAGAAGAGAGSGGGAMGDMSGSGGSASSGGDAVSGGSASSGGSSDSSSGG 407 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GG GGG G Sbjct: 408 GGSSSSSGGDSSASGGSSGGGSG 430 >UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomycotina|Rep: DUF1720 domain protein - Aspergillus clavatus Length = 1485 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/65 (44%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP-XPXAGPPXPAAPXXXPPXX 808 PPPP PPPP PP P A PPPPP PP P A PP P P PP Sbjct: 1382 PPPP-----PPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPPPPPGPPPPP 1436 Query: 809 GXGGA 823 GA Sbjct: 1437 APPGA 1441 Score = 56.8 bits (131), Expect = 7e-07 Identities = 28/66 (42%), Positives = 28/66 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP P P P P AP A P PPP PP P PP PA P P Sbjct: 1387 PPPPPPASAPMVVPSYDPSTAPPPPPPAPPI-APPAPPPGPPPPPGPPPPPAPPGAAAPA 1445 Query: 806 XGXGGA 823 G A Sbjct: 1446 APAGAA 1451 Score = 50.8 bits (116), Expect = 4e-05 Identities = 31/73 (42%), Positives = 31/73 (42%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PP PPPP PP P AP PPPPP P Sbjct: 1385 PPPPPPPPASAPMVVPSYDPSTAPP-----PPPPAPP-----IAPPAP--PPGPPPPPGP 1432 Query: 749 PXPXAGPPXPAAP 787 P P A PP AAP Sbjct: 1433 PPPPA-PPGAAAP 1444 Score = 46.0 bits (104), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPP-XPXXPXXPPPPPPP 415 PPPPP P PPPPPP P P PPP PPP Sbjct: 1386 PPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPPP 1428 Score = 44.8 bits (101), Expect = 0.003 Identities = 23/60 (38%), Positives = 23/60 (38%), Gaps = 3/60 (5%) Frame = +2 Query: 569 PPPPPXXGG---GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PPPP P P PPP PP G P AP A P P Sbjct: 1388 PPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPPPPPGPPPPPAPPGAAAPAAP 1447 Score = 44.0 bits (99), Expect = 0.005 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P PP PPP P P PPPPP Sbjct: 1388 PPPPPASAPMVVPSYDPSTAPPPPP-----------PAPPIAPPAPPPGPPPPPGPPPPP 1436 Query: 420 PP 415 P Sbjct: 1437 AP 1438 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP + P PPPPP P PP PP PP P Sbjct: 1384 PPPPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPPPPPGPPPPPAPP 1439 Score = 41.5 bits (93), Expect = 0.026 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P PPPP P P PP PPP Sbjct: 1384 PPPPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPP 1424 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P PPPP PP PPPP Sbjct: 1387 PPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPGPPPP 1429 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP A P PPPP P P PP P Sbjct: 1404 PSTAPPPPPPAPPIAPPAPPPGPPPPPGPPPPPAPPGAAAP 1444 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPP P P PPPPP PPPP Sbjct: 1386 PPPPPPPASAPMVVPSYDPSTAPPPPPPAPPIAPPAPPPG---PPPPPGP------PPPP 1436 Query: 421 PPP 413 PP Sbjct: 1437 APP 1439 >UniRef50_Q9ULL5 Cluster: Proline-rich protein 12; n=19; Eutheria|Rep: Proline-rich protein 12 - Homo sapiens (Human) Length = 1215 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/76 (38%), Positives = 29/76 (38%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPX 754 PPP PPPPP P PPP P P P PPPPP P Sbjct: 636 PPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLP-----PPPPPAMPS 690 Query: 755 PXAGPPXPAAPXXXPP 802 P PP AAP PP Sbjct: 691 PPPPPPPAAAPLAAPP 706 Score = 47.2 bits (107), Expect = 5e-04 Identities = 33/91 (36%), Positives = 33/91 (36%), Gaps = 13/91 (14%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP----PPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPP 733 P PPP G PP PPP P P P P PP P P A P Sbjct: 610 PGPPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPP------PPPPPQPALPS 663 Query: 734 PPP--------XPPXPXAGPPXPAAPXXXPP 802 PPP PP P PP PA P PP Sbjct: 664 PPPLVAPTPSSPPPPPLPPPPPPAMPSPPPP 694 Score = 46.4 bits (105), Expect = 0.001 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = -2 Query: 657 PGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX-PXPXXX 481 PG G + PPP PPP P P P Sbjct: 616 PGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSP 675 Query: 480 XXPPPPPPXPXXPXXPPPPPPP 415 PP PPP P PPPPPPP Sbjct: 676 PPPPLPPPPPPAMPSPPPPPPP 697 Score = 46.0 bits (104), Expect = 0.001 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPP-PPXPPXPXAGPPXPAAP 787 PP P PGPPP P P P P PPP PP P P PP P P Sbjct: 601 PPLAPAAAVPGPPPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPPPP 656 Score = 44.8 bits (101), Expect = 0.003 Identities = 31/82 (37%), Positives = 32/82 (39%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP---PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PPP P P P PP P PP P + PPPP Sbjct: 653 PPPPPQPA--------LPSPPPLVAPTPSSPPPPPLPPPP---------PPAMPSPPPPP 695 Query: 740 PXPPXPXAGPP-XPAAPXXXPP 802 P P A PP PAAP P Sbjct: 696 PPAAAPLAAPPEEPAAPSPEDP 717 Score = 43.2 bits (97), Expect = 0.009 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPPPPP P PPPP PP AP P P P Sbjct: 662 PSPPPLVAPTPSSPPPPPLPPPPPP-AMPSPPPPPPPAAAPL---AAPPEEPAAPSPEDP 717 Query: 749 PXPXAGP 769 P P Sbjct: 718 ELPDTRP 724 Score = 38.7 bits (86), Expect = 0.19 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = -2 Query: 600 PPPPXXG-GGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP T PPPPP P P PPPPPP P PP Sbjct: 654 PPPPQPALPSPPPLVAPTPSSPPPPPLPP------PPPPAMPSPPPPPPPAAAPLAAPPE 707 Query: 423 PP 418 P Sbjct: 708 EP 709 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -1 Query: 541 PPPPPXXXGEXXKXP--XXPXXXXXPPP--PPXXXXXXXTPPPPPPP 413 PPPPP P P PPP PP +PPPPPPP Sbjct: 651 PPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPP 697 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP P P P PPP P P P PPPPP Sbjct: 613 PPLPGLPSANSNGTPEPPLLEEKPPPTPPPAPTPQPQPPPPP 654 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP-----PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGX 722 P PP P A P P PPPPP P PPP PP P Sbjct: 652 PPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPPPAMPSPPPPPPPAAAPLAAPPEEPAA 711 Query: 723 P 725 P Sbjct: 712 P 712 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P PPPPP P PPP P PP P Sbjct: 630 PLLEEKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPPP 685 Score = 35.1 bits (77), Expect = 2.3 Identities = 24/82 (29%), Positives = 25/82 (30%), Gaps = 5/82 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXX---PPPPPPXXXPGPPPPXPPXXGGXXXPX--APXXXAXPP 733 PP PP G C P P P PP P + A PP Sbjct: 160 PPGPPAYDPYGPYCPGRASGAGPETPGLGLDPNKPPELPSTVNAEPLGLIQSGPHQAAPP 219 Query: 734 PPPXPPXPXAGPPXPAAPXXXP 799 PPP PP P A P P Sbjct: 220 PPPPPPPPPAPASEPKGGLTSP 241 Score = 35.1 bits (77), Expect = 2.3 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P P PPP +PPPPP P Sbjct: 640 PPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLP 681 Score = 34.7 bits (76), Expect = 3.0 Identities = 30/107 (28%), Positives = 30/107 (28%) Frame = -2 Query: 735 GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXX 556 GGG A G G PP G G G G P P G G Sbjct: 134 GGGAADDYGKAG---PPEDEGDPKAGAGPPPG-----PPAYDPYGPYCPGRASGAGPETP 185 Query: 555 XTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP P P P P P PPPPP P Sbjct: 186 GLGLDPNKPPELPSTVNAEPLGLIQSGPHQAAPPPPPP--PPPPPAP 230 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPP 415 P PP P P PPPPPPP Sbjct: 5 PGVPPGPPHPVRPPPPPPP 23 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPPP P Sbjct: 8 PPGPPHPVRPPPPPPPPMP 26 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P + P P PPP PPPP PP Sbjct: 640 PPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPP 682 >UniRef50_Q03211 Cluster: Pistil-specific extensin-like protein precursor; n=2; Nicotiana|Rep: Pistil-specific extensin-like protein precursor - Nicotiana tabacum (Common tobacco) Length = 426 Score = 56.8 bits (131), Expect = 7e-07 Identities = 28/78 (35%), Positives = 30/78 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PP PPP P PPPP PP +P PPPPP P Sbjct: 149 PPPPPSPCKPSPPDQSAKQPPQPPPAKQPSPPPPPPPVKA-----PSPSPAKQPPPPPPP 203 Query: 749 PXPXAGPPXPAAPXXXPP 802 + P P PP Sbjct: 204 VKAPSPSPATQPPTKQPP 221 Score = 53.2 bits (122), Expect = 8e-06 Identities = 29/74 (39%), Positives = 29/74 (39%), Gaps = 2/74 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP PPPPPP P P P PP P A PPPPP Sbjct: 179 PPPPPPPVKAPSPSPAKQPPPPPPPVKAPSPSPATQPPTKQPPPPPRAKKSPLLPPPPPV 238 Query: 746 PPXPXAGP-PXPAA 784 P P P PAA Sbjct: 239 AYPPVMTPSPSPAA 252 Score = 49.2 bits (112), Expect = 1e-04 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP--PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 P PP GG P P PP P P P PP P P PPPP Sbjct: 123 PDVPPIGGGPPVNQPKPSSPSPLVKPPPPPPSPCKPSPPDQSAKQPPQPPPAKQPSPPPP 182 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 PP P P PP Sbjct: 183 PPPVKAPSPSPAKQPPPPPP 202 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/58 (34%), Positives = 22/58 (37%) Frame = +2 Query: 638 PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PP P P P P P + PPP P PP P PP P+ PP G Sbjct: 41 PPAEIPLPDIPSPFDGPTFVLPPPSPLPSPPPPSPSPPPPSPSPPPPSTIPLIPPFTG 98 Score = 41.9 bits (94), Expect = 0.020 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP P P P PPPP PP P PPPPP Sbjct: 169 PQPPPAKQPSPPPPPPPVKAPSPSPAKQ--PPPPPPPVKAPSPSPATQPPTKQPPPPPRA 226 Query: 749 PXPXAGPPXPAAPXXXPP 802 PP P P PP Sbjct: 227 KKSPLLPPPP--PVAYPP 242 Score = 41.9 bits (94), Expect = 0.020 Identities = 29/83 (34%), Positives = 30/83 (36%), Gaps = 6/83 (7%) Frame = +2 Query: 569 PPPPPXXG-GGGXXCXXXXXPPPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPP--- 733 PPPPP PPPPP P PP PP +P A PP Sbjct: 199 PPPPPVKAPSPSPATQPPTKQPPPPPRAKKSPLLPPPPPVAYPPVMTPSPSPAAEPPIIA 258 Query: 734 PPPXPP-XPXAGPPXPAAPXXXP 799 P P PP P P PA P P Sbjct: 259 PFPSPPANPPLIPRRPAPPVVKP 281 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPP-----XPXXPXXPPPPPPP 415 P PP P P PPPPPP P PPPPPPP Sbjct: 158 PSPPDQSAKQPPQPPPAKQPSPPPPPPPVKAPSPSPAKQPPPPPPP 203 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PPPPP P PPPPP P PPPPP Sbjct: 179 PPPPPPPVKAPSPSPAKQPPPPPPPVKAPSPSPATQPPTKQ-PPPPPRAKKSPLLPPPPP 237 Score = 40.3 bits (90), Expect = 0.061 Identities = 29/94 (30%), Positives = 30/94 (31%), Gaps = 3/94 (3%) Frame = -2 Query: 690 PPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXP---PPPPXX 520 PP GG PG G PP GG + P PPPP Sbjct: 94 PPFTGGFLPPLPGSKLPDFAGLLPLIPNLPDVPPIGGGPPVNQPKPSSPSPLVKPPPPPP 153 Query: 519 XGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 K P PP PP P PPPPPP Sbjct: 154 S--PCKPSPPDQSAKQPPQPPPAKQPSPPPPPPP 185 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPP---PXPXXPXXPP---PPPPP 415 P PPP P P PPPPP P P PP PPPPP Sbjct: 177 PSPPPPPPPVKAPSPSPAKQPPPPPPPVKAPSPSPATQPPTKQPPPPP 224 Score = 39.1 bits (87), Expect = 0.14 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP PPPPP P PPPPP PPPP Sbjct: 180 PPPPPPVKAPSPSPAKQ---PPPPPPPVKAPSPSPATQPPTKQPPPPPRAKKSPLLPPPP 236 Query: 421 P 419 P Sbjct: 237 P 237 Score = 38.3 bits (85), Expect = 0.25 Identities = 32/117 (27%), Positives = 33/117 (28%), Gaps = 4/117 (3%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 P P G P P PPPP P P P P PPPP GG P Sbjct: 48 PDIPSPFDGPTFVLPPPSPLPSPPPPSPSP--PPPSPSPPPPSTIPLIPPFTGGFLPPLP 105 Query: 360 ----PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 P F L P P P PP P +P P P Sbjct: 106 GSKLPDFAGLLPLIPNLPDVPPIGGGPPVNQPKPSSPSPLVKPPP-PPPSPCKPSPP 161 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP---PPPPPXPXXPXXPP 430 PPPP PPPPP P P P P P P P P Sbjct: 200 PPPPVKAPSPSPATQPPTKQPPPPPRAKKSPLLPPPPPVAYPPVMTPSPSPAAEPPIIAP 259 Query: 429 PPPPP 415 P PP Sbjct: 260 FPSPP 264 Score = 35.9 bits (79), Expect = 1.3 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPPP P P P P A PP P Sbjct: 220 PPPPPRAKKS------PLLPPPPPVAYPPVMTPSPSPAAEPPIIAPFPSPPANPPLIPRR 273 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P P PP Sbjct: 274 PAPPVVKPLP--PLGKPP 289 Score = 34.3 bits (75), Expect = 4.0 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 2/64 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP--XXXP 799 P PPPP P PP P PP P PP P P P P P Sbjct: 68 PSPPPPSPSPPPPSPSPPPPSTIPL-IPPFTGGFLPPLPGSKLPDFAGLLPLIPNLPDVP 126 Query: 800 PXXG 811 P G Sbjct: 127 PIGG 130 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + PP PP P P P P P PPPPP Sbjct: 148 PPPPPPSPCKPSPPDQSAKQPPQPPPAKQPSPPPPPPPVKAPSPSPAKQP-----PPPPP 202 Query: 420 P 418 P Sbjct: 203 P 203 Score = 33.9 bits (74), Expect = 5.3 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPP---XXXXXXXTPPPPPPP 413 P PP + + P PPPPP PPPPPPP Sbjct: 158 PSPPDQSAKQPPQPPPAKQPSPPPPPPPVKAPSPSPAKQPPPPPPP 203 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP A P PPPPP P P P P Sbjct: 177 PSPPPPPPPVKAPSPSPAKQPP--PPPPPVKAPSPSPATQP 215 >UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eutheria|Rep: Protein diaphanous homolog 2 - Homo sapiens (Human) Length = 1101 Score = 56.8 bits (131), Expect = 7e-07 Identities = 29/67 (43%), Positives = 29/67 (43%), Gaps = 5/67 (7%) Frame = +2 Query: 626 PP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP---PPPPXPPXPXAGPPXPAAPX 790 PP PP P P PPPP PP GG P P PPPP PP GPP P Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 791 XXPPXXG 811 PP G Sbjct: 611 GVPPPPG 617 Score = 50.8 bits (116), Expect = 4e-05 Identities = 25/61 (40%), Positives = 25/61 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 PPPPP P P PPPPPP P PPPPPPP GG P Sbjct: 562 PPPPPPAP------PLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPP 615 Query: 360 P 358 P Sbjct: 616 P 616 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/56 (41%), Positives = 23/56 (41%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP G PPPP P PPPP PP G P P PPP Sbjct: 563 PPPPPAPPLPGG--APLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPPP 616 Score = 41.9 bits (94), Expect = 0.020 Identities = 26/61 (42%), Positives = 26/61 (42%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP GG PPPPP P P PPPPPP P PPPPP Sbjct: 564 PPPPAPPLPGGAPL------PPPPP---------PLPGMMGIPPPPPP-PLLFGGPPPPP 607 Query: 420 P 418 P Sbjct: 608 P 608 Score = 37.9 bits (84), Expect = 0.33 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPPPP P P P PPPP Sbjct: 556 PLPGVGPPPPPPAPPLPGGAPLPPPP 581 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPP-PXXXPXPPPXXPPXXGGXXXXXXPPG 719 PPPP GG P PPPPP P PPP PP G P G Sbjct: 564 PPPPAPPLPGGA----PLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P G P P P P PP P P P PP GG Sbjct: 549 PGPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGG 602 >UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV.; n=4; Xenopus tropicalis|Rep: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. - Xenopus tropicalis Length = 1182 Score = 56.4 bits (130), Expect = 9e-07 Identities = 28/73 (38%), Positives = 28/73 (38%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPPP PP PP G P P PP P Sbjct: 643 PPPPPLPGSSSV--------PPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPP 694 Query: 749 PXPXAGPPXPAAP 787 P P GPP P P Sbjct: 695 PFPGGGPPPPPPP 707 Score = 53.6 bits (123), Expect = 6e-06 Identities = 30/88 (34%), Positives = 32/88 (36%), Gaps = 4/88 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G PPP P PPPP P P P + PPPPP P Sbjct: 631 PPPPLLPG----FPSVPPPPPLPGSSSVPPPPPLPGISSAPPPPPLPGFSSVPPPPPLPD 686 Query: 752 XPXAGPPXP----AAPXXXPPXXGXGGA 823 PP P P PP G G + Sbjct: 687 LSSVPPPPPFPGGGPPPPPPPFPGYGSS 714 Score = 46.8 bits (106), Expect = 7e-04 Identities = 26/77 (33%), Positives = 27/77 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PPPP P PPPP P P PPPPP Sbjct: 655 PPPPPLPG------ISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPPPF 708 Query: 749 PXPXAGPPXPAAPXXXP 799 P + P P P Sbjct: 709 PGYGSSAVPPPLPLPLP 725 Score = 46.4 bits (105), Expect = 0.001 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXP--PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PPPP G PPPP G P P PPP P PPP Sbjct: 644 PPPPLPGSSSVPPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPP 703 Query: 426 PPPP 415 PPPP Sbjct: 704 PPPP 707 Score = 45.2 bits (102), Expect = 0.002 Identities = 29/85 (34%), Positives = 30/85 (35%), Gaps = 2/85 (2%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G + PPP P P P PPPPP P PPPPP Sbjct: 631 PPPPLLPG------FPSVPPPPPLPGSSSVPPPPPLPGISSA-PPPPPLPGFSSVPPPPP 683 Query: 420 PPXXXXXXXXG--XGGGGXXXPPXF 352 P GGG PP F Sbjct: 684 LPDLSSVPPPPPFPGGGPPPPPPPF 708 Score = 44.0 bits (99), Expect = 0.005 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 5/68 (7%) Frame = -1 Query: 601 PPPPXXXGGGGXXX-----GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXX 437 PPPP G G PPPP P P PPPPP Sbjct: 643 PPPPPLPGSSSVPPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGG-- 700 Query: 436 TPPPPPPP 413 PPPPPPP Sbjct: 701 -PPPPPPP 707 Score = 39.5 bits (88), Expect = 0.11 Identities = 27/102 (26%), Positives = 27/102 (26%), Gaps = 2/102 (1%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXG--XGGGGXX 367 PP P P P PPPP P P PPPPP P G Sbjct: 608 PPHPLSTSSQTASSPTPLDCTSIPPPPLLPGFPSVPPPPPLPGSSSVPPPPPLPGISSAP 667 Query: 366 XPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXP 241 PP P G PPPP P Sbjct: 668 PPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPPPFP 709 Score = 39.5 bits (88), Expect = 0.11 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXX---PPPPPXXXGXXXKXPXPXXXXXPPP-PPPXPXXPXXP 433 PPPP G PPPPP P P PPP PPP P Sbjct: 656 PPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPPPFPGYGSSA 715 Query: 432 PPPPPP 415 PPP P Sbjct: 716 VPPPLP 721 Score = 35.1 bits (77), Expect = 2.3 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 6/69 (8%) Frame = -1 Query: 601 PPPPXXXGGGGXXX-----GXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXX 437 PPPP G G PPPP P P PPPPP Sbjct: 655 PPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGPPPPPPPFPGYGSS 714 Query: 436 T-PPPPPPP 413 PPP P P Sbjct: 715 AVPPPLPLP 723 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPP P P PPPP PPPPP P Sbjct: 607 PPPHPLSTSSQTASSPTPLDCTSIPPPPLLPGFPSVPPPPPLP 649 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 P P PPPP P P + PPPP P + PP P P Sbjct: 622 PTPLDCTSIPPPPLLPGFPSVPPPPPLPGSSSVPPPPPLPGISSAPPPPPLP 673 Score = 33.9 bits (74), Expect = 5.3 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 4/64 (6%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGP---PPPXP-PXXGGXXXPXAPXXXAXPPPP 739 PPPP GGG PPPPPP G PPP P P G P P Sbjct: 691 PPPPPFPGGG-------PPPPPPPFPGYGSSAVPPPLPLPLPGLFFGLSKPRKAPVEPGC 743 Query: 740 PXPP 751 P P Sbjct: 744 PMKP 747 >UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae|Rep: Blr0521 protein - Bradyrhizobium japonicum Length = 745 Score = 56.4 bits (130), Expect = 9e-07 Identities = 28/63 (44%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPP-PPXPPXXGGXXXP---XAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPPPPP P PP PP PP P AP A PPPP PP P PA P Sbjct: 97 PPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPA 156 Query: 794 XPP 802 P Sbjct: 157 AAP 159 Score = 55.6 bits (128), Expect = 2e-06 Identities = 27/58 (46%), Positives = 27/58 (46%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PP PG PP P P AP A PP PP P P A PP PAAP PP Sbjct: 48 PKQPPKGPPGAAPPAAPAR-----PAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPP 100 Score = 54.8 bits (126), Expect = 3e-06 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP--PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPP P P PPPP PP P AP A P P Sbjct: 109 PPPPPPPAA-----PKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAP 163 Query: 743 XPPXPXAGPPXPAAPXXXP 799 PP P A P P P P Sbjct: 164 PPPPPPAARPTPTPPPPPP 182 Score = 53.6 bits (123), Expect = 6e-06 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPP PP P P PP PP P A A PPPPP Sbjct: 121 PSPPP---AAAPQQHAPTPPPPAPPAARPAPTPPAPP-------PAAAPQHAPPPPPPPA 170 Query: 749 --PXPXAGPPXPAAPXXXP 799 P P PP PA P P Sbjct: 171 ARPTPTPPPPPPAGPAARP 189 Score = 53.6 bits (123), Expect = 6e-06 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXP-XAPXXXAXP-PPPP 742 PP PP PPPPPP P P PP PP G P AP P PPP Sbjct: 150 PPAPPPAAA-----PQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPP 204 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P G P PAA P Sbjct: 205 AAPTARPGSPAPAATPAPTP 224 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP---- 736 P PP G P PPP P PP PP P AP PP Sbjct: 48 PKQPPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPA 107 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 PP PP P A P P+ P P Sbjct: 108 PPPPPPPPAAPKQPSPPPAAAP 129 Score = 48.0 bits (109), Expect = 3e-04 Identities = 27/75 (36%), Positives = 27/75 (36%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 P G G PP P P P PP P AP A PP P PP P Sbjct: 39 PQETGPDGKPKQPPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPP 98 Query: 758 XAGPPXPAAPXXXPP 802 PP PAA PP Sbjct: 99 ---PPPPAARPAPPP 110 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 3/64 (4%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPP---PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 PP G PPP PP P PPPPPP P PPP Sbjct: 51 PPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPP 110 Query: 426 PPPP 415 PPPP Sbjct: 111 PPPP 114 Score = 46.4 bits (105), Expect = 0.001 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP P P PPPPPP P PPPPPPP Sbjct: 76 PPHPPAAPPPAAAPPRPAAP--PPPPPPPAARPAPPPPPPPP 115 Score = 44.8 bits (101), Expect = 0.003 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA----GPPXPAAPXX 793 PP PP P PP P P P A P PPP PP P A PP AAP Sbjct: 76 PPHPPAAPPPAAAPPRP----AAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQ 131 Query: 794 XPP 802 P Sbjct: 132 HAP 134 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 540 PPP---PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPP PP P P PPPPPP P P P PPP Sbjct: 83 PPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPP 125 Score = 42.3 bits (95), Expect = 0.015 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 2/66 (3%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX--PPPPPPXPXXPXXP 433 K P PP T P PP P P PPPPPP P Sbjct: 119 KQPSPPP--AAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPT 176 Query: 432 PPPPPP 415 PPPPPP Sbjct: 177 PPPPPP 182 Score = 41.5 bits (93), Expect = 0.026 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P PPP PPP PPPP P P P P P P Sbjct: 134 PTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPAP 193 Query: 749 -PXPXAGPPXPAAPXXXP 799 P P PAAP P Sbjct: 194 TATPTPVAPPPAAPTARP 211 Score = 39.5 bits (88), Expect = 0.11 Identities = 31/98 (31%), Positives = 32/98 (32%), Gaps = 13/98 (13%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG----------PPPPXPPXXGGXXXPXAPXX 718 PPPPP PPPPP P P P PP P +P Sbjct: 163 PPPPPPPAA------RPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAP 216 Query: 719 XAXPPPPPXP-PXPXAGPPXPAAPXXXP--PXXGXGGA 823 A P P P P P P AP P P G GA Sbjct: 217 AATPAPTPTPAPTATPAPTATPAPGSTPGAPPAGRPGA 254 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPP 416 PPPPP P P P PPP P PPPP Sbjct: 98 PPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPP 139 Score = 38.7 bits (86), Expect = 0.19 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXP---PPPPXXXXXXXTPPPPPPP 413 PPPP P P P PPPP TP PPPPP Sbjct: 136 PPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPP 181 Score = 38.7 bits (86), Expect = 0.19 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 P P GG P P P P P GG P A P P P Sbjct: 279 PTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTATPAPGGALTPPPGRPGAGPTPGPQG 338 Query: 749 PXPXAGPPXPAAPXXXPPXXG 811 P AG P P P G Sbjct: 339 GTPPAGAPAAGTPAAPPQAGG 359 Score = 38.3 bits (85), Expect = 0.25 Identities = 23/77 (29%), Positives = 25/77 (32%), Gaps = 5/77 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-----PPXXGGXXXPXAPXXXAXPP 733 P P P P PP PG PPP PP G P A P Sbjct: 224 PTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPGVRPGSPPAAGSPPAPGATPAPTTTP 283 Query: 734 PPPXPPXPXAGPPXPAA 784 P P +G P PA+ Sbjct: 284 APGGTATPPSGRPGPAS 300 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP T PPP P P P PPPP P P P P Sbjct: 136 PPPPAPPAA---RPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPA 192 Query: 420 P 418 P Sbjct: 193 P 193 Score = 37.5 bits (83), Expect = 0.43 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P P PPP PP P P P PP PP P Sbjct: 114 PPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPPAPPPAAAPQHAPPPPPPP 169 Score = 37.5 bits (83), Expect = 0.43 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 3/69 (4%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPX--PPXXGGXXXPXA-PXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 P PPP PG PP PP G P P PP P P + P AA Sbjct: 252 PGAPPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAP 311 Query: 797 PPXXGXGGA 823 GGA Sbjct: 312 TATPAPGGA 320 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXP--PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PP P P P PPPPP P PPP PP P P Sbjct: 72 PAAAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAP 129 Score = 35.9 bits (79), Expect = 1.3 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 9/90 (10%) Frame = +2 Query: 569 PPPPPXXGG----GGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXA-PXXXAXP 730 PPPP PPP P PG P P P P A P A P Sbjct: 179 PPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAPTATPAPTATP 238 Query: 731 PP---PPXPPXPXAGPPXPAAPXXXPPXXG 811 P P PP G P P PP G Sbjct: 239 APGSTPGAPPAGRPGAPPPGVRPGSPPAAG 268 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/56 (30%), Positives = 17/56 (30%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P P P G P P PPP P PP PP PP P Sbjct: 44 PDGKPKQPPKGPPGAAPPAAPARPAAPPPAAAPPHPPAAPPPAAAPPRPAAPPPPP 99 Score = 35.5 bits (78), Expect = 1.7 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 1/67 (1%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXP-XXPXXXXXPPPPPXXXXXXXT 434 A PPPP PPPPP + P P PPPP Sbjct: 93 AAPPPPPPPPAAR-----PAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPA 147 Query: 433 PPPPPPP 413 P PP PP Sbjct: 148 PTPPAPP 154 Score = 35.5 bits (78), Expect = 1.7 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 2/86 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP G P P P P P P G PPP P Sbjct: 202 PPPAAPTARPGSPAPAATPAPTPTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPGVRP 261 Query: 749 PXPXA--GPPXPAAPXXXPPXXGXGG 820 P A PP P A GG Sbjct: 262 GSPPAAGSPPAPGATPAPTTTPAPGG 287 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPP---PPPPXPXXPXXPPPPPPP 415 PPPP K P P P P PP P P P P PP Sbjct: 108 PPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAPPAARPAPTPP 151 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 P P P A PPPPPP P P P PP G Sbjct: 141 PPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAG 184 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP A P PPPPPP P P P PP P Sbjct: 95 PPPPPPPP---------AARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTPPPPAP 141 Score = 33.1 bits (72), Expect = 9.3 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 3/85 (3%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPP--PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP G P P P P P P G P A P P Sbjct: 255 PPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTAT 314 Query: 749 PXP-XAGPPXPAAPXXXPPXXGXGG 820 P P A P P P P GG Sbjct: 315 PAPGGALTPPPGRPGAGPTPGPQGG 339 >UniRef50_Q2J3C8 Cluster: OmpA/MotB precursor; n=4; Alphaproteobacteria|Rep: OmpA/MotB precursor - Rhodopseudomonas palustris (strain HaA2) Length = 651 Score = 56.4 bits (130), Expect = 9e-07 Identities = 31/81 (38%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP-PXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP PP G PPP P P PPP PP P P A PP PP Sbjct: 78 PPAPPAGRIGEPPAAPRAEPPPRPAAPPPPPPPRAEPPAAPRAAPPPPPPAAATPPRPPS 137 Query: 746 PPXPXAGP--PXPAAPXXXPP 802 PP + P PAAP PP Sbjct: 138 PPAEKSAPRAEPPAAPRVAPP 158 Score = 54.4 bits (125), Expect = 4e-06 Identities = 34/93 (36%), Positives = 34/93 (36%), Gaps = 9/93 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG---XXXPXAPXXXAXPPPPP 742 PPPP PPPPPP P PP PP P AP PPPPP Sbjct: 104 PPPPPPPRAEPPAAPRAAPPPPPPAAATPPRPPSPPAEKSAPRAEPPAAPRVAPPPPPPP 163 Query: 743 --XPPXPXAGPP----XPAAPXXXPPXXGXGGA 823 P A PP P P PP G GA Sbjct: 164 AAAPQRQSAPPPAEKAAPPPPRPAPPAAGQIGA 196 Score = 44.8 bits (101), Expect = 0.003 Identities = 29/65 (44%), Positives = 29/65 (44%), Gaps = 9/65 (13%) Frame = +2 Query: 635 PPPXXXPG---PP----PPXPPXXGGXXXPXAPXXXAXPPP--PPXPPXPXAGPPXPAAP 787 PPP PG PP PP PP P AP P P PP PP P A P PAAP Sbjct: 61 PPPGAAPGAAPPPRPAAPPAPPAGRIGEPPAAPRAEPPPRPAAPPPPPPPRAEP--PAAP 118 Query: 788 XXXPP 802 PP Sbjct: 119 RAAPP 123 Score = 43.6 bits (98), Expect = 0.007 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 3/71 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXA---PXXXAXPPPP 739 PPPPP PPP P PP P PP G P A P P Sbjct: 157 PPPPPPPAAA----PQRQSAPPPAEKAAPPPPRPAPPAAGQIGAPPAGQTPPAAVQKGAP 212 Query: 740 PXPPXPXAGPP 772 P P P A PP Sbjct: 213 PPPAQPSAAPP 223 Score = 41.9 bits (94), Expect = 0.020 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 9/67 (13%) Frame = +2 Query: 629 PPPPPXXXPGPP------PPXPPXXGGXXXPXAPXXXAXPPPPP---XPPXPXAGPPXPA 781 PPP P P PP PP P P AP PPPPP P P A PP P Sbjct: 71 PPPRPAAPPAPPAGRIGEPPAAPRAEPPPRPAAPP----PPPPPRAEPPAAPRAAPPPPP 126 Query: 782 APXXXPP 802 PP Sbjct: 127 PAAATPP 133 Score = 41.5 bits (93), Expect = 0.026 Identities = 26/78 (33%), Positives = 27/78 (34%), Gaps = 7/78 (8%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPP----- 733 PPP G PP PP PP P P P P A PP Sbjct: 61 PPPGAAPGAAPPPRPAAPPAPPAGRIGEPPAAPRAEPPPRPAAPPPPPPPRAEPPAAPRA 120 Query: 734 PPPXPPXPXAGPPXPAAP 787 PP PP A PP P +P Sbjct: 121 APPPPPPAAATPPRPPSP 138 Score = 41.5 bits (93), Expect = 0.026 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 4/89 (4%) Frame = +2 Query: 569 PPPPPXXGGG----GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP PP PPPP PP P PP Sbjct: 123 PPPPPAAATPPRPPSPPAEKSAPRAEPPAAPRVAPPPPPPPAAAPQRQSAPPPAEKAAPP 182 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PP P P AG PP GA Sbjct: 183 PPRPAPPAAGQIGAPPAGQTPPAAVQKGA 211 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/88 (27%), Positives = 24/88 (27%) Frame = -2 Query: 678 GGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKX 499 G G G G G PP P G G PP P Sbjct: 52 GPPAGERKGPPPGAAPGAAPPPRPAAPPAPPAGRIGEPPAAPRAEPPPRPAAPPPPPPPR 111 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PPPP P P PP PP Sbjct: 112 AEPPAAPRAAPPPPPPAAATPPRPPSPP 139 Score = 39.5 bits (88), Expect = 0.11 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPPP + P P P P PPPPPPP Sbjct: 122 PPPPPPAAATPPRPPSPPAEKSAPRAEPPAAPRVAPPPPPPP 163 Score = 39.1 bits (87), Expect = 0.14 Identities = 28/91 (30%), Positives = 28/91 (30%), Gaps = 7/91 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP G PPP PPP P G P P PPPPP Sbjct: 203 PPAAVQKGAPPPPAQPSAAPPPAVQRERAAPPPAAAPDAGRIGAP--PAVTQTPPPPPTT 260 Query: 749 PXPXAGPPXPA-------APXXXPPXXGXGG 820 A PP A AP PP G G Sbjct: 261 QQRDAPPPATAPAERGTVAPPPPPPAAGTMG 291 Score = 38.7 bits (86), Expect = 0.19 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 7/66 (10%) Frame = +2 Query: 626 PPPPPPXXXP---GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA----GPPXPAA 784 PPPPPP P PPP P P PP P A PP PA Sbjct: 158 PPPPPPAAAPQRQSAPPPAEKAAPPPPRPAPPAAGQIGAPPAGQTPPAAVQKGAPPPPAQ 217 Query: 785 PXXXPP 802 P PP Sbjct: 218 PSAAPP 223 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP T PP PP P PPPPPP P PP Sbjct: 122 PPPPPPAAA-------TPPRPPSPPAEKSAPRAEPPAAPRVAPPPPPPPAAAPQRQSAPP 174 Query: 420 P 418 P Sbjct: 175 P 175 Score = 38.3 bits (85), Expect = 0.25 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPPP P P G AP PPP P P A PP A P Sbjct: 280 PPPPPPAAGTMGPQGAQPAAPGSLPAGAPVART-PPPTVTTPIPAAPPPPQALAPIAPGA 338 Query: 806 XGXG 817 G Sbjct: 339 VAPG 342 Score = 37.5 bits (83), Expect = 0.43 Identities = 21/66 (31%), Positives = 22/66 (33%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP PPPPP + P P P P P Sbjct: 102 AAPPPPPPPRA---EPPAAPRAAPPPPPPAAATPPRPPSPPAEKSAPRAEPPAAPRV-AP 157 Query: 430 PPPPPP 413 PPPPPP Sbjct: 158 PPPPPP 163 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA-GPPXPAAPXXXPP 802 PP GPPP P P AP P P A PP PAAP PP Sbjct: 53 PPAGERKGPPPGAAPGAAPPPRPAAPPAPPAGRIGEPPAAPRAEPPPRPAAPPPPPP 109 Score = 35.9 bits (79), Expect = 1.3 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 3/80 (3%) Frame = +2 Query: 569 PPPP--PXXGGGGXXCXXXXXPPPPPPXXX-PGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP P G G PPPPP PPP P G P PPPP Sbjct: 233 PPPAAAPDAGRIGAPPAVTQTPPPPPTTQQRDAPPPATAPAERGTVAP--------PPPP 284 Query: 740 PXPPXPXAGPPXPAAPXXXP 799 P PAAP P Sbjct: 285 PAAGTMGPQGAQPAAPGSLP 304 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPPP P P PPPP P P PP Sbjct: 159 PPPPPAAAPQRQSAPPPAEKAAPPPPRPAPPAAGQIGAPP 198 Score = 33.1 bits (72), Expect = 9.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPP A PPPPPP P P PP Sbjct: 99 PRPAAPPPPPPPRAEPPAAPRAAPPPPPPAAATPPRPPSPP 139 >UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein precursor; n=3; Mycobacterium|Rep: Fibronectin-attachment family protein precursor - Mycobacterium sp. (strain KMS) Length = 333 Score = 56.4 bits (130), Expect = 9e-07 Identities = 28/63 (44%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP----PPXPPXPXAGPPXPAAPXX 793 PPPPPP P P P PP G P A PPP PP PP PP PA P Sbjct: 43 PPPPPPAPSPAAPAPPPPGPGPVPPPPPADPNAAPPPAGQLPPPPPADPNAPP-PADPNA 101 Query: 794 XPP 802 PP Sbjct: 102 PPP 104 Score = 49.6 bits (113), Expect = 1e-04 Identities = 33/82 (40%), Positives = 33/82 (40%), Gaps = 1/82 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PPPP PGP PP PP P A A PPP P Sbjct: 43 PPPPPP-------APSPAAPAPPPP--GPGPVPPPPP-----ADPNAAPPPAGQLPPPPP 88 Query: 749 PXPXAGPP-XPAAPXXXPPXXG 811 P A PP P AP P G Sbjct: 89 ADPNAPPPADPNAPPPPAPEPG 110 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP P PPP P PPP P P P PP Sbjct: 44 PPPPPAPSPAAPAPPPPGPGPVPPPPPADPNAAPPPAGQLPPPPPADPNAPPPADPNAPP 103 Query: 420 PPXXXXXXXXGXGGG 376 PP GG Sbjct: 104 PPAPEPGRVDNAAGG 118 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 4/65 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP----PPXPXXPXXP 433 PPPP P PP P P PPPP P P P P Sbjct: 43 PPPPPPAPSPAAPAPPPPGPGPVPPPPPADPNAAPPPAGQLPPPPPADPNAPPPADPNAP 102 Query: 432 PPPPP 418 PPP P Sbjct: 103 PPPAP 107 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPP PP G P P A P P PP P G P AP PP Sbjct: 285 PPPPPPPAPG---DPNVPPPPADPNAP--PPRPEVGVAVPVAPENVPP 327 Score = 39.1 bits (87), Expect = 0.14 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPP---PPPPP 413 PPPPP P P PPPPP P PPPPP Sbjct: 43 PPPPPPAPSPAAPAPPPPGPGPVPPPPPADPNAAPPPAGQLPPPPP 88 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPP----PPP 415 P PPP P P P PPP P P PPP PPP Sbjct: 41 PTPPPPPPAPSPAAPAPPPPGPGPVPPPPPADPNAAPPPAGQLPPP 86 Score = 37.9 bits (84), Expect = 0.33 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP 415 PPPPPP P P PPPP P Sbjct: 286 PPPPPPAPGDPNVPPPPADP 305 Score = 37.5 bits (83), Expect = 0.43 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 10/70 (14%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPP----PPPXPXXPXXPPP------PPPPXXXXXXXX 391 P PPP G P PPP PPP P P PPP PPP Sbjct: 55 PAPPPPGPGPVPPPPPADPNAAPPPAGQLPPPPPADPNAPPPADPNAPPPPAPEPGRVDN 114 Query: 390 GXGGGGXXXP 361 GG P Sbjct: 115 AAGGFSYVVP 124 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP---PPPPP 415 T PPP P P P PPPPP P P PPPPP Sbjct: 42 TPPPPPPAPSPAAPAPPPPGPGPV--PPPPPADPNAAPPPAGQLPPPPP 88 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 677 PXXGGXXXPXAPXXXAXPPPPPXPPXPXAG---PPXPAAPXXXPPXXG 811 P G P A P P PP P G PP PA P PP G Sbjct: 34 PSVAGAQPTPPPPPPAPSPAAPAPPPPGPGPVPPPPPADPNAAPPPAG 81 Score = 34.3 bits (75), Expect = 4.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 471 PPPPPXPXXPXXPPPPPPP 415 PPPPP P P P PPPP Sbjct: 284 PPPPPPPPAPGDPNVPPPP 302 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +2 Query: 722 AXPPPPPXP-PXPXAGPPXPAAPXXXPPXXGXGGA 823 A PPPPP P P PP PA P PP G A Sbjct: 283 APPPPPPPPAPGDPNVPPPPADPNAPPPRPEVGVA 317 Score = 33.5 bits (73), Expect = 7.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 528 PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 P G P P P P P P P PPPPP Sbjct: 34 PSVAGAQPTPPPPPPAPSPAAPAPPPPGPGPVPPPPP 70 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPPPP G+ P P PPP P P PPE Sbjct: 286 PPPPPPAPGDP-NVPPPPADPNAPPPRPEVGVAVPVAPENVPPE 328 >UniRef50_Q8LJ87 Cluster: Putative leucine-rich repeat/extensin 1; n=4; Oryza sativa|Rep: Putative leucine-rich repeat/extensin 1 - Oryza sativa subsp. japonica (Rice) Length = 503 Score = 56.4 bits (130), Expect = 9e-07 Identities = 26/61 (42%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP--XPPXPXAGPPXPAAPXXXP 799 PPPPPP PPPP P +P PPPPP PP P + PP P P P Sbjct: 416 PPPPPPAPVQSPPPPAP-VVSPPSPVFSPPPAFSPPPPPKTSPPPPVSSPPPPPPPTMSP 474 Query: 800 P 802 P Sbjct: 475 P 475 Score = 41.9 bits (94), Expect = 0.020 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P PPPP PP P AP PP P P P PP P PP Sbjct: 406 PAPESSKHSPPPPPPPAPVQSPPPPAPV--VSPPSPVFSPPPAFSPPPPPKTSPPPP 460 Score = 41.1 bits (92), Expect = 0.035 Identities = 26/81 (32%), Positives = 27/81 (33%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP---PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPPPP PP P PP PPPP P P PPP Sbjct: 417 PPPPPAPVQSPPPPAPVVSPPSPVFSPPPAFSPPPPPKTSPPPPVSSPPPPPPPTMSPPP 476 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P PP +A PP Sbjct: 477 PI-QEPVILPPILSAKYQSPP 496 Score = 41.1 bits (92), Expect = 0.035 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P PPPP P P PPPPPP Sbjct: 428 PPPAPVVSPPSPVFSPPPAFSPPPPPKTSPPPPVSSPPPPPP 469 Score = 37.9 bits (84), Expect = 0.33 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 2/62 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP--PPPXPXXPXXPPP 427 PPPP PP P P P PPP PP P P PP Sbjct: 416 PPPPPPAPVQSPPPPAPVVSPPSPVFSPPPAFSPPPPPKTSPPPPVSSPPPPPPPTMSPP 475 Query: 426 PP 421 PP Sbjct: 476 PP 477 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP PP P P P PPPP P P P P Sbjct: 415 PPPPPPPAPVQSPPPPAPVVSPPSPVFSPPPAFSPPPPPKTSPPPPVSSPPPPPPPTMSP 474 Query: 420 PP 415 PP Sbjct: 475 PP 476 Score = 37.1 bits (82), Expect = 0.57 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXX--TPPPPPPP 413 PPPP P PPPPP +PPPPPPP Sbjct: 427 PPPPAPVVSPPSPVFSPPPAFSPPPPPKTSPPPPVSSPPPPPPP 470 Score = 36.7 bits (81), Expect = 0.75 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXL--XXXXNPPPPPPP 414 +PPPP P PPPPP +PPPPPPP Sbjct: 426 SPPPPAPVVSPPSPVFSPPPAFSPPPPPKTSPPPPVSSPPPPPPP 470 Score = 36.3 bits (80), Expect = 1.00 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 504 KXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 K P P PPPPP P PPPP P Sbjct: 404 KKPAPESSKHSPPPPPPPAPVQSPPPPAP 432 Score = 34.7 bits (76), Expect = 3.0 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PP P + P PPPPP P PP PP PP Sbjct: 429 PPAPVVSPPSPVFSPPPAFSPPPPPKTSPPPPVSSPPPPPPPTMSPPPP 477 >UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 352 Score = 56.4 bits (130), Expect = 9e-07 Identities = 37/102 (36%), Positives = 37/102 (36%), Gaps = 5/102 (4%) Frame = +2 Query: 530 GGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP-PXXGGXXXPX 706 G GG PPPPP PPPPPP G PP P P GG P Sbjct: 260 GSGGPPRPPAPQVPPPPPQA------------PPPPPPNAPMGMPPRIPPPPVGGTQPPP 307 Query: 707 APXXXAXPPPPPXPPXPXAGPP----XPAAPXXXPPXXGXGG 820 P A PP PP P G P AP PP G G Sbjct: 308 PPPPLANGPPRSIPPPPMTGGAMANFTPGAPPPRPPMQGFPG 349 Score = 50.8 bits (116), Expect = 4e-05 Identities = 33/84 (39%), Positives = 33/84 (39%), Gaps = 3/84 (3%) Frame = +2 Query: 569 PPPPPXX---GGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PP P G GG PPPPP P PPPP P P P PPPP Sbjct: 250 PPAAPGTLPNGSGGPPRPPAPQVPPPPPQ-APPPPPPNAPMGMPPRIPPPPVGGTQPPPP 308 Query: 740 PXPPXPXAGPPXPAAPXXXPPXXG 811 P PP GPP P PP G Sbjct: 309 P-PPLAN-GPPRSIPP---PPMTG 327 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/81 (32%), Positives = 28/81 (34%) Frame = -2 Query: 657 PGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXX 478 PG G GG + PPPP PPPP G + P P Sbjct: 254 PGTLPNGSGGPPRPPAPQVPPPPPQA-----------PPPPPPNAPMGMPPRIPPPPVGG 302 Query: 477 XPPPPPPXPXXPXXPPPPPPP 415 PPPPP P P PPP Sbjct: 303 TQPPPPPPPLANGPPRSIPPP 323 Score = 41.1 bits (92), Expect = 0.035 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +2 Query: 635 PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P P P P GG P AP PPPP PP P P P PP G Sbjct: 245 PEANKPPAAPGTLPNGSGGPPRPPAPQ--VPPPPPQAPPPPPPNAPMGMPPRIPPPPVG 301 Score = 40.3 bits (90), Expect = 0.061 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = +3 Query: 528 GGGGGXXXXXPXXXPPPPXXXGGGGXXAXXPXXPP-PPPPXXXPXPPPXXPPXXGGXXXX 704 G GG P PPPP A P PPPP PPP PP G Sbjct: 260 GSGGPPRPPAPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRS 319 Query: 705 XXPP 716 PP Sbjct: 320 IPPP 323 Score = 37.9 bits (84), Expect = 0.33 Identities = 24/81 (29%), Positives = 25/81 (30%) Frame = -1 Query: 655 GXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXX 476 G G GG PPPP PPPP G + P P Sbjct: 255 GTLPNGSGGPPRPPAPQVPPPPPQA-----------PPPPPPNAPMGMPPRIPPPPVGGT 303 Query: 475 XPPPPPXXXXXXXTPPPPPPP 413 PPPPP PPPP Sbjct: 304 QPPPPPPPLANGPPRSIPPPP 324 Score = 34.3 bits (75), Expect = 4.0 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 9/84 (10%) Frame = -1 Query: 637 GGGGXXGXXAXXPPPPXXXGGGGXXXGXXXXXPP--PPPXXXGEXXKXPXXPXXXXXP-- 470 G GG A PPP PP PPP G P P P Sbjct: 260 GSGGPPRPPAPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRS 319 Query: 469 -PPPPXXXXXXX--TP--PPPPPP 413 PPPP TP PPP PP Sbjct: 320 IPPPPMTGGAMANFTPGAPPPRPP 343 Score = 32.3 bits (70), Expect(2) = 0.19 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 P P P P PPPPP P PPPP P GG P Sbjct: 251 PAAPGTLPNGSGGPPRPPAPQVPPPPPQAP----PPPPPNAPMGMPPRIPPPPVGGTQPP 306 Query: 360 P 358 P Sbjct: 307 P 307 Score = 25.4 bits (53), Expect(2) = 0.19 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 Query: 267 PPPPXXXXPPRXPXTPXXPGG 205 PPPP PPR P GG Sbjct: 308 PPPPLANGPPRSIPPPPMTGG 328 >UniRef50_Q22168 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 165 Score = 56.4 bits (130), Expect = 9e-07 Identities = 43/129 (33%), Positives = 44/129 (34%), Gaps = 8/129 (6%) Frame = -2 Query: 777 GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXP 598 G G A G GG GGGG + G G GGG GGG G P Sbjct: 20 GYGAQAYGMGG--GGGGYNRPMNSYGN------GYNNGGGFNNYGNGGGFGGNNYNNGPP 71 Query: 597 P-------PPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-PPPPPXPXXP 442 P P GGGGG PPPPP P P P P P P P Sbjct: 72 PFDGGYNRPYGGGGGGGYGRPQGYVPPPPPPPTQPEPEPEPRPEPQPEPQPEPQPEPQPE 131 Query: 441 XXPPPPPPP 415 P P P P Sbjct: 132 PQPEPHPEP 140 Score = 48.4 bits (110), Expect = 2e-04 Identities = 40/127 (31%), Positives = 40/127 (31%), Gaps = 10/127 (7%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPP------ 580 GG G G G GGG G G G GG PPP Sbjct: 19 GGYGAQAYGMGGGGGGYNRPMNSYGNGYNNGGGFNNYGNGGGFGGNNYNNGPPPFDGGYN 78 Query: 581 -PXXGGGGXXCXXXXX--PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP- 748 P GGGG PPPPPP P P P P P P P P P P Sbjct: 79 RPYGGGGGGGYGRPQGYVPPPPPPPTQPEPEPEPRPEPQPEPQP-EPQPEPQPEPQPEPH 137 Query: 749 PXPXAGP 769 P P P Sbjct: 138 PEPAPEP 144 Score = 45.6 bits (103), Expect = 0.002 Identities = 29/93 (31%), Positives = 30/93 (32%), Gaps = 3/93 (3%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXF---XXFPXXXGGGGGXXXVXXXXXPPPP 580 + G GG G GGG GG G F P GGGGG PPPP Sbjct: 42 YGNGYNNGGGFNNYGNGGGFGGNNYNNGPPPFDGGYNRPYGGGGGGGYGRPQGYVPPPPP 101 Query: 581 PXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPP 679 P P P P P P P P Sbjct: 102 PPTQPEPEPEPRPEPQPEPQPEPQPEPQPEPQP 134 Score = 42.3 bits (95), Expect = 0.015 Identities = 33/111 (29%), Positives = 34/111 (30%), Gaps = 9/111 (8%) Frame = -1 Query: 715 GGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXG---------GGGXX 563 GG + G G G G GGG G PPP G GGG Sbjct: 31 GGGGYNRPMNSYGNGYNNGGGFNNYGNGGGFGGNNYNNGPPPFDGGYNRPYGGGGGGGYG 90 Query: 562 XGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPPE 410 PPPPP E P P P P P P P P PE Sbjct: 91 RPQGYVPPPPPPPTQPEPEPEP-RPEPQPEPQPEP-QPEPQPEPQPEPHPE 139 Score = 38.3 bits (85), Expect = 0.25 Identities = 36/119 (30%), Positives = 36/119 (30%) Frame = -2 Query: 771 GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPP 592 GG G GG GG G PP GG P GGGG G PPP Sbjct: 49 GGGFNNYGNGGGFGGNNYNNGP-----PPFDGGYNR--PYGGGGGGGYGRPQGYVPPPPP 101 Query: 591 PXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P T P P P P P P P P P P P P P Sbjct: 102 P-----------PTQPEPEPEPRPEPQPEPQPEP-----QPEPQPEPQPEPHPEPAPEP 144 >UniRef50_O44367 Cluster: Precollagen D; n=2; Mytilus|Rep: Precollagen D - Mytilus edulis (Blue mussel) Length = 922 Score = 56.4 bits (130), Expect = 9e-07 Identities = 43/137 (31%), Positives = 44/137 (32%), Gaps = 2/137 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXX 643 P P G G G GGP GG GG G G P GG GG GGP Sbjct: 149 PGQPGGPGGPGGPGGPGGPGM-PGGPGGPSGPG-TGGPGQPGGPGGPGGPGGPGGPSMPG 206 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXG-XXXKXPXPXXXXXPPP 466 G GG G P GG GG PP P G + P P Sbjct: 207 GPGGPGGPGMPGGPGGPGGPGGAGGIPGMTGPAGPPGPAGPQGPEGEQGPRGRTPAGTPG 266 Query: 465 PPPXPXXPXXPPPPPPP 415 PP P P P P Sbjct: 267 PPGNPGEPGQGGAPGAP 283 Score = 48.8 bits (111), Expect = 2e-04 Identities = 42/144 (29%), Positives = 42/144 (29%), Gaps = 1/144 (0%) Frame = +2 Query: 359 GGXXXPPPPX-PXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGG 535 GG P P P GG G G G GG GG G G P GG Sbjct: 153 GGPGGPGGPGGPGGPGMPGGPGGPSGPGTGGPGQPGGPGGPGGPGGPGG----PSMPGGP 208 Query: 536 GGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPX 715 GG P P GG G P P PGP P P P Sbjct: 209 GGPGGPGMPGGPGGPGGPGGAGGI------PGMTGPAGPPGPAGPQGPEGEQGPRGRTPA 262 Query: 716 XXAXPPPPPXPPXPXAGPPXPAAP 787 PP P P P P AP Sbjct: 263 GTPGPPGNPGEPGQGGAPGAPGAP 286 Score = 48.0 bits (109), Expect = 3e-04 Identities = 25/58 (43%), Positives = 25/58 (43%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G G GG G GG GG GG G G GG GGG G GG GG Sbjct: 739 GGLGAGGLG-GGLGGGLGGLGGAGGLGGGLGGLGGGLGGGLGGLGGGAGGAGAGGNGG 795 Score = 45.6 bits (103), Expect = 0.002 Identities = 54/202 (26%), Positives = 54/202 (26%), Gaps = 1/202 (0%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG-GGPGXXXGGGGGG 625 GG AA A G GG GG G G P GG GG GGPG G GG Sbjct: 112 GGFGSAAANAAAAARAGAGFGGFGGLGGFGGLGGVGGPGQPGGPGGPGGPG----GPGGP 167 Query: 624 XXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXX 445 P P GG G P P G P P P P Sbjct: 168 GMPGGPGGPSGPGTGGPG----------QPGGPGGPGGPGGPGGPSM----PGGPGGPGG 213 Query: 444 PXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXP 265 P P P P G G PP P P Sbjct: 214 PGMPGGPGGPGGPGGAGGIPGMTGPAGPPG--------PAGPQGPEGEQGPRGRTPAGTP 265 Query: 264 PPPXXXXPPRXPXTPXXPGGPG 199 PP P P PG PG Sbjct: 266 GPPGNPGEPGQGGAPGAPGAPG 287 Score = 44.0 bits (99), Expect = 0.005 Identities = 53/216 (24%), Positives = 56/216 (25%), Gaps = 7/216 (3%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G PG PG G+ G GG GG G P P + + Sbjct: 206 GGPGGPGGPGMPGGPGGPGGPGGAGGIPGMTGPAGPPGPAGPQGPEGEQGPRGRTPAGTP 265 Query: 374 PPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 PP P G GG G G G G G G P G G Sbjct: 266 GPPGNPGE-----PGQGGAPGAPGAPGHAGKHGTAGAAGKAG--RPGPXGQAGASGSSGQ 318 Query: 554 XXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP 733 P P G P P G P P G P AP P Sbjct: 319 HGASGAPGRPGNPGSTGRPGATGDPGRPGATGTTGRPGP----SGAPGNPGAPGALGAPG 374 Query: 734 PPPXP-----PXPXAGPPXPA--APXXXPPXXGXGG 820 P P P P P P P P G G Sbjct: 375 PRGSPGFVGLPGPRGSPGEPGNQGPIGGPGYPGPRG 410 Score = 43.2 bits (97), Expect = 0.009 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXG-XGGXGG-GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G G GG A G GG GG GGG G G G GG GG GG Sbjct: 748 GGLGGGLGGLGG-AGGLGGGLGGLGGGLGGGLGGLGGGAGGAGAGGNGGAGAGGAGGNGG 806 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G GG GG Sbjct: 807 GSAAARAAAQAAAAAGGNGG 826 Score = 41.9 bits (94), Expect = 0.020 Identities = 24/59 (40%), Positives = 24/59 (40%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G G G GG GGG G G G GG GG G G G G GG Sbjct: 744 GGLGGGLGGGLGGLGGAGGLGGGLG--GLGGGLGGGLGGLGGGAGGAGAGGNGGAGAGG 800 Score = 40.7 bits (91), Expect = 0.046 Identities = 26/76 (34%), Positives = 26/76 (34%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G G G GG GGG G G G GG GGG G G GG G Sbjct: 733 GGLGGLGGLGAGGLG-GGLGGGLGGLGGAGGLGGGLGGLGGGLGGGLGGLGGGAGGAGAG 791 Query: 618 XXXXKXPPPPXXGGGG 571 GGG Sbjct: 792 GNGGAGAGGAGGNGGG 807 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P GG AG G G GG GG G G G G GGG G G Sbjct: 713 PGGANAGGNAAAGAGPGVGPGGLGGLGGLGAGGLGGGLGGGLGGLGGAGGLGGGLGGLGG 772 Query: 639 GGGGG 625 G GGG Sbjct: 773 GLGGG 777 Score = 39.5 bits (88), Expect = 0.11 Identities = 29/75 (38%), Positives = 29/75 (38%), Gaps = 2/75 (2%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG--GGPGXXXGGGGGGXXXX 613 G G GG G G G GGG GA G GG GG GG G GG GGG Sbjct: 734 GLGGLGGLGAGGLGGGLGGGLGGLGGAGGLG-----GGLGGLGGGLGGGLGGLGGGAGGA 788 Query: 612 XXKXPPPPXXGGGGG 568 GG GG Sbjct: 789 GAGGNGGAGAGGAGG 803 Score = 37.9 bits (84), Expect = 0.33 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 12/83 (14%) Frame = -2 Query: 780 AGXGGPAXGXG---------GXGGGGGXAXXXGAXG---XXXPPXXGGXGGGGPGXXXGG 637 AG GGPA G G G G GG A A G P GG GG G G GG Sbjct: 690 AGTGGPAPGVGAAATAGAFAGAGPGGANAGGNAAAGAGPGVGPGGLGGLGGLGAGGLGGG 749 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 GGG GG GG Sbjct: 750 LGGGLGGLGGAGGLGGGLGGLGG 772 Score = 35.9 bits (79), Expect = 1.3 Identities = 51/177 (28%), Positives = 53/177 (29%), Gaps = 4/177 (2%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXG--GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGX 367 G PG PG G G GG G GG P PG + GG Sbjct: 150 GQPGGPGGPGGPGGPGGPGMPGGPGGPSGPGTGGPG-------------------QPGGP 190 Query: 368 XXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXX 547 P P GG GG G GG GG G G P GG GG Sbjct: 191 GGPGGP----------GGPGG---PSMPGGPGGPGGPGMPGGPGG----PGGPGGAGGIP 233 Query: 548 XVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP--PPXPPXXGGXXXPXAP 712 + PP P G P P PGPP P P G P AP Sbjct: 234 GMTGPAGPPGP----AGPQGPEGEQGPRGRTPAGTPGPPGNPGEPGQGGAPGAPGAP 286 Score = 35.5 bits (78), Expect = 1.7 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXG-AXGXXXPPXXGGXGGGGPGXXXG 640 P P G A G G GG GG A G G GG G GG G G Sbjct: 695 PAPGVGAAATAGAFAGA---GPGGANAGGNAAAGAGPGVGPGGLGGLGGLGAGGLGGGLG 751 Query: 639 GGGGG 625 GG GG Sbjct: 752 GGLGG 756 Score = 33.9 bits (74), Expect = 5.3 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GG GGG G G GG GG Sbjct: 747 GGGLGGGLGGLGGAGGLGGG-LGGLGGGLGGGLGGLGGGAGG 787 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 56.4 bits (130), Expect = 9e-07 Identities = 28/63 (44%), Positives = 28/63 (44%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P P PPPP PP GG P P PPPP PP P AGP P P PP Sbjct: 946 PEQAPLFPPPPPPPPPGVGGPPPPPPPPGMGGPPPP--PPPPGAGPGGPPPP---PPGAS 1000 Query: 812 XGG 820 GG Sbjct: 1001 MGG 1003 Score = 54.4 bits (125), Expect = 4e-06 Identities = 21/41 (51%), Positives = 21/41 (51%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP G P P PPPPPP P PPPPPP Sbjct: 957 PPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPP 997 Score = 54.0 bits (124), Expect = 5e-06 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPPPP GPPPP PP G P P A P PP PP Sbjct: 955 PPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPP 996 Score = 53.6 bits (123), Expect = 6e-06 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG 766 PPPPPP PPPP PP GG P P PPP PP G Sbjct: 956 PPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPPGASMG 1002 Score = 50.0 bits (114), Expect = 8e-05 Identities = 26/58 (44%), Positives = 26/58 (44%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP G PPPPPP GPPPP PP G P PPPPP Sbjct: 953 PPPPPPPPPG-----VGGPPPPPPPPGMGGPPPPPPPPGAGPGGP--------PPPPP 997 Score = 44.4 bits (100), Expect = 0.004 Identities = 24/54 (44%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXP--PXXGGXXXPXAPXXXA 724 PPPPP G GG PPPPPP PG PPP P GG P A Sbjct: 967 PPPPPPPGMGGPP------PPPPPPGAGPGGPPPPPPGASMGGWKKTYLPVADA 1014 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPPG 719 P PPPP G G PPPPPP PPP PP G PPG Sbjct: 950 PLFPPPPPPPPPGVGG-----PPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPPG 998 Score = 42.7 bits (96), Expect = 0.011 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 5/44 (11%) Frame = -2 Query: 474 PPPPPPXPXXPXXPPPPPPP-----XXXXXXXXGXGGGGXXXPP 358 PPPPPP P PPPPPPP G G GG PP Sbjct: 953 PPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPP 996 Score = 39.1 bits (87), Expect = 0.14 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 PPPP G GG PPPPP P PPPPP PPPP Sbjct: 955 PPPPPPPGVGGPP-------PPPPP------------PGMGGPPPPPPPPGAGPGGPPPP 995 Query: 421 PP 416 PP Sbjct: 996 PP 997 >UniRef50_P03211 Cluster: Epstein-Barr nuclear antigen 1; n=50; root|Rep: Epstein-Barr nuclear antigen 1 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 641 Score = 56.4 bits (130), Expect = 9e-07 Identities = 30/76 (39%), Positives = 30/76 (39%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G AG GG A G GG G GGG GA G GG GG G G G GG G Sbjct: 151 GGGAGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGAGGA 210 Query: 618 XXXXKXPPPPXXGGGG 571 G GG Sbjct: 211 GGAGAGGAGAGGGAGG 226 Score = 56.0 bits (129), Expect = 1e-06 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G G AG GG A G GG G GGG GA G GG GG G G G GGG Sbjct: 123 GAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGGAG 182 Query: 621 XXXXXKXPPPPXXGGGGG 568 G GG Sbjct: 183 GAGAGGGAGGAGGAGAGG 200 Score = 54.4 bits (125), Expect = 4e-06 Identities = 31/77 (40%), Positives = 31/77 (40%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G AG GG A G GG G GG A GA G GG G GG G GG GG Sbjct: 211 GGAGAGGAGAGGGAGGAGGAGAGGAGAGGAGA-GGAGAGGAGGAGAGGAGGAGAGGAGGA 269 Query: 621 XXXXXKXPPPPXXGGGG 571 G GG Sbjct: 270 GAGGGAGGAGAGGGAGG 286 Score = 52.0 bits (119), Expect = 2e-05 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G AG GG A GG GG GG G GG GG G G G GGG Sbjct: 96 GGAGAGGAGAGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAG 155 Query: 621 XXXXXKXPPPPXXGGGGG 568 G GG Sbjct: 156 GAGAGGGAGGAGGAGAGG 173 Score = 52.0 bits (119), Expect = 2e-05 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G G AG GG A G G GGG G A GA G GG GG G G GGG G Sbjct: 168 GAGAGGGAGAGGGAGGAGA-GGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGGGAGG 226 Query: 621 XXXXXKXPPPPXXGGGGG 568 G GG Sbjct: 227 AGGAGAGGAGAGGAGAGG 244 Score = 52.0 bits (119), Expect = 2e-05 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G GA G GG G G G GG A GA G GG GG G G G G GG Sbjct: 249 GAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAGGGAGGAGAGGAGGAGAGGAGGAGAGGA 308 Query: 621 XXXXXKXPPPPXXGGGGG 568 G GG Sbjct: 309 GGAGAGGGAGAGGAGAGG 326 Score = 50.8 bits (116), Expect = 4e-05 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG-GGGG 625 GG G AG GG G G G GG A GA G GG GG G G GG G GG Sbjct: 233 GGAGAGGAGAGGAGAGGAGGAGAGG-AGGAGAGGAGGAGAGGGAGGAGAGGGAGGAGAGG 291 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 292 AGGAGAGGAGGAGAGGAGG 310 Score = 50.4 bits (115), Expect = 6e-05 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G GA G GG G G GGG G A GA G G GG G G G G GG Sbjct: 201 GAGAGGAGGAGGAGAGGAGAGGGAGGAGGAGAGGAG--AGGAGAGGAGAGGAGGAGAGGA 258 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 259 GGAGAGGAGGAGAGGGAG 276 Score = 49.6 bits (113), Expect = 1e-04 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G GA G G G G GG GG GA G GG G GG G GG GG Sbjct: 244 GAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAGGGAGGAGAGGAGGAGAGGAGGA 303 Query: 621 XXXXXKXPPPPXXGGGGG 568 G GG Sbjct: 304 GAGGAGGAGAGGGAGAGG 321 Score = 49.2 bits (112), Expect = 1e-04 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXG-GGGPGXXXGGGGGG 625 GG GA G A G G GG G GA G GG G GGG G G G GG Sbjct: 87 GGTGAGAGAGGAGAGGAGAGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGG 146 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 147 GAGAGGGAGGAGAGGGAGG 165 Score = 49.2 bits (112), Expect = 1e-04 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXG-GXGGGGPGXXXGGGGGG 625 G G AG GG A GG GG GG GA G G G GG G GGG G Sbjct: 117 GAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAG 176 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 177 AGGGAGGAGAGGGAGGAGG 195 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G GA G GG G G G GG G GG GG G G G G GG Sbjct: 241 GAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAGGGAGGAGAGGAGGAGAGGA 300 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 301 GGAGAGGAGGAGAGGGAG 318 Score = 48.8 bits (111), Expect = 2e-04 Identities = 24/57 (42%), Positives = 24/57 (42%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G G AG GG A G G G GG A G G G GG G G GGGG Sbjct: 272 GGGAGGAGAGGGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGGG 328 Score = 48.8 bits (111), Expect = 2e-04 Identities = 31/80 (38%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGG-GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG-GGG 628 GG AG G G GG GG G G A GA G GG G GG G GG G G Sbjct: 273 GGAGGAGAGGGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGGGRGRG 332 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G GG GG Sbjct: 333 GSGGRGRGGSGGRGRGGSGG 352 Score = 48.0 bits (109), Expect = 3e-04 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGG-GXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG AG G A G GG GG G G A G G GG G GG G G G GG Sbjct: 191 GGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGGGAGGAGGAGAGGAGAGGAG-AGGAGAGG 249 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GG GG Sbjct: 250 AGGAGAGGAGGAGAGGAGG 268 Score = 46.8 bits (106), Expect = 7e-04 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGX-AXXXGAXGXXXPPXXGGXGG-GGPGXXXGGGGG 628 GG G AG GG G G GG GG A G G G GG GG G G GG Sbjct: 228 GGAGAGGAGAGGAGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAGGGAGGA 287 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G G GG Sbjct: 288 GAGGAGGAGAGGAGGAGAGG 307 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGG-GXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G AG G G GG G GG G A GA G G GGG G G GGG Sbjct: 268 GAGAGGGAGGAGAGGGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGG 327 Score = 46.0 bits (104), Expect = 0.001 Identities = 28/79 (35%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXG--GXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G G AG GG A G G G GG G A G G G GGG G G GG Sbjct: 141 GAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGG 200 Query: 627 GXXXXXXKXPPPPXXGGGG 571 G GG G Sbjct: 201 GAGAGGAGGAGGAGAGGAG 219 Score = 45.6 bits (103), Expect = 0.002 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGX---GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 G G AG G A GG GG GG GA G GG G GG G G G Sbjct: 156 GAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGA 215 Query: 630 GGXXXXXXKXPPPPXXGGGGG 568 GG GG G Sbjct: 216 GGAGAGGGAGGAGGAGAGGAG 236 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G G AG GG A G G GG A GA G G GG G G GG G Sbjct: 189 GAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGGGAGGAGGAGAGGAGAGGAGAGGAG 246 Score = 43.2 bits (97), Expect = 0.009 Identities = 26/73 (35%), Positives = 26/73 (35%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXX 607 G G G G GG G GG A GA GG GG G G G GGG Sbjct: 84 GTHGGTGAGAGAGGAGAGGAGA-GGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGA 142 Query: 606 KXPPPPXXGGGGG 568 GGG G Sbjct: 143 GAGGGAGAGGGAG 155 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/56 (42%), Positives = 25/56 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 G G AG GG A G GG G GGG G+ G GG G GG G G G Sbjct: 304 GAGGAGGAGAGGGA-GAGGAGAGGGGRGRGGSGGRGR-GGSGGRGRGGSGGRRGRG 357 Score = 37.1 bits (82), Expect = 0.57 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 G G AG GG G GG G GG G G GG G G GG Sbjct: 310 GAGAGGGAGAGGAGAGGGGRGRGGSGGRGRGGSGGRGRGGSGGRRGRGRERARGG 364 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G G GGG GG G G G G G Sbjct: 137 GGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAG 178 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G G GGG GG G G G G G Sbjct: 164 GGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAG 205 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G G GGG G G GG G G G G GGG G Sbjct: 108 GAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAG 149 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGG G G G GG G G G G GG GG Sbjct: 219 GAGGGAGGAGGAGAGGAGAGGAGAGGAGAGGAGGAGAGGAGG 260 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GG G GG G G GGG GG G G GG GG Sbjct: 267 GGAGAGGGAGGAGAGGGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGG 326 Query: 596 GG 601 GG Sbjct: 327 GG 328 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGG G G GGGG G G G GG GG Sbjct: 312 GAGGGAGAGGAGAGGGGRGRGGSGGRGRGGSGGRGRGGSGG 352 Score = 33.5 bits (73), Expect = 7.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGG G G G G GGG G G G G G Sbjct: 110 GAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAG 151 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -2 Query: 756 GXGGXGGGGGXAXXXGAXGXXXPPXXGGXG-GGGPGXXXGGGGGGXXXXXXKXPPPPXXG 580 G G GG G G G GG G GGG G G GG G G Sbjct: 81 GCKGTHGGTGAGAGAGGAGAGGAGAGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAG 140 Query: 579 GGG 571 G G Sbjct: 141 GAG 143 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 G GG G G G GGG GG G G G GG Sbjct: 99 GAGGAGAGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGG 138 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGG G G G GG GG G G G G G Sbjct: 104 GAGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAG 145 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG GG G G G GGG G G G GGG Sbjct: 113 GGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGG 153 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG GG G G G G GGG G G G GG Sbjct: 116 GGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGG 156 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G G GGG GG G G G G Sbjct: 119 GGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAG 160 Score = 33.1 bits (72), Expect = 9.3 Identities = 31/118 (26%), Positives = 31/118 (26%), Gaps = 2/118 (1%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXG-GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXX 370 G G G G G GG G GGG G GG Sbjct: 122 GGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGGA 181 Query: 371 XPPPPXPXXXXXXFXGGGGGGGXXGXXGXGG-GGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGG G G G GG G GG G G G GG Sbjct: 182 GGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGGGAGGAGGAGAGGAGAGG 239 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG G GG G GG GG G G GG GG Sbjct: 211 GGAGAGGAGAGGGAGGAGGAGAGGAGAGGAGAGGAGAGGAGG 252 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GG G G G GG G G G G GG GG Sbjct: 246 GAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAGGGAGG 286 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GG GG G G G G GGG G G GG G Sbjct: 256 GGAGGAGAGGAGGAGAGGGAGGAGAGGGAGGAGAGGAGGAG 296 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG G G G G GGG GG G G G GG Sbjct: 259 GGAGAGGAGGAGAGGGAGGAGAGGGAGGAGAGGAGGAGAGG 299 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 56.4 bits (130), Expect = 9e-07 Identities = 31/79 (39%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PPPPP PPPPPP G PPPP PP G P PPPPP Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAP--------PPPPPA 540 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P G P P P P Sbjct: 541 PIEGGGGIPPPPPPMSASP 559 Score = 54.8 bits (126), Expect = 3e-06 Identities = 25/54 (46%), Positives = 25/54 (46%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPPP PPP PP P A PPPPP P A PP P AP Sbjct: 488 PPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 50.8 bits (116), Expect = 4e-05 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 6/67 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXG------XGG 379 PPPPP P P PPPPPP PPPPPPP GG Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 545 Query: 378 GGXXXPP 358 GG PP Sbjct: 546 GGIPPPP 552 Score = 50.4 bits (115), Expect = 6e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 542 APPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 APPPPP P P PPPPP L PPPPPPP Sbjct: 484 APPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 526 Score = 50.4 bits (115), Expect = 6e-05 Identities = 24/67 (35%), Positives = 24/67 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP PPPP P PPPP P GG P P A P Sbjct: 506 PPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKTTIS 565 Query: 749 PXPXAGP 769 P P P Sbjct: 566 PAPLPDP 572 Score = 47.2 bits (107), Expect = 5e-04 Identities = 24/64 (37%), Positives = 24/64 (37%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPP PPPP PP P P PPP PP P P P P Sbjct: 489 PPPPPLHAFVAPPPPPPPPP-----PPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIE 543 Query: 806 XGXG 817 G G Sbjct: 544 GGGG 547 Score = 46.8 bits (106), Expect = 7e-04 Identities = 23/57 (40%), Positives = 23/57 (40%) Frame = +2 Query: 641 PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P PPPP PP P P PPPPP PP P A P P PP G Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPP-----PPPPPPPPPPLANYGAPPPPPPPPPGSG 531 Score = 44.0 bits (99), Expect = 0.005 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX--PPPPPPXPXXPXXPPP 427 PPPP PPPP G P P PPPPPP P P Sbjct: 490 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIP 549 Query: 426 PPPP 415 PPPP Sbjct: 550 PPPP 553 Score = 43.2 bits (97), Expect = 0.009 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPP-XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 P PPPP P PPPPPP PPP PP G PP P Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 43.2 bits (97), Expect = 0.009 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP P P PPPPP PPPPPPP Sbjct: 487 PPPPPPPLHAFVAPPPPPPP---PPPPPPPLANYGAPPPPPPP 526 Score = 43.2 bits (97), Expect = 0.009 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP A P PPPP P PPP P GG PP Sbjct: 502 PPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 554 Score = 41.5 bits (93), Expect = 0.026 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 P PPPP P PPPPP PPP P GG PP Sbjct: 501 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 553 Score = 40.3 bits (90), Expect = 0.061 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 3/66 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXX-GEXXKXPXXPXXXXX--PPPPPXXXXXXXTP 431 PPPP PPPPP G P P PPPPP Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGI 548 Query: 430 PPPPPP 413 PPPPPP Sbjct: 549 PPPPPP 554 Score = 39.1 bits (87), Expect = 0.14 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 492 PXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PPPPPP P PPPPPP G PP Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPP 524 Score = 37.1 bits (82), Expect = 0.57 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 4/66 (6%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX----PPPPPPXPXXPXXP 433 PPPP PPPPP G P P PPPPPP P Sbjct: 503 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASPSKT 562 Query: 432 PPPPPP 415 P P Sbjct: 563 TISPAP 568 Score = 35.1 bits (77), Expect = 2.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -1 Query: 514 EXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 E + P PPPPP PPPPPPP Sbjct: 475 EDGEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPP 508 Score = 34.7 bits (76), Expect = 3.0 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP-----GPPP-PXPPXXGGXXXPXAPXXXAXP 730 PPP P GGGG PPPPP P P P P P A Sbjct: 537 PPPAPIEGGGG------IPPPPPPMSASPSKTTISPAPLPDPAEGNWFHRTNTMRKSAVN 590 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPP 802 PP P P A P PP Sbjct: 591 PPKPMRPLYWTRIVTSAPPAPRPP 614 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 609 AXXPXXPPPPPP----XXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P PPPPPP P PPP PP PP P Sbjct: 482 AVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPP 524 >UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 143 Score = 56.0 bits (129), Expect = 1e-06 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G GG GGGG GGG GG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGG 63 Score = 56.0 bits (129), Expect = 1e-06 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G G GGGG G GG GGG Sbjct: 6 GGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGG 64 Score = 54.8 bits (126), Expect = 3e-06 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG--GG 628 GG G G GG G GG GGGGG G G GG G GG G GGG GG Sbjct: 12 GGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGR---GGGGGSGGDGGGIGGGGTGG 68 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G GGGGG Sbjct: 69 GAGGGSGGDGNVWRCGGGGG 88 Score = 54.4 bits (125), Expect = 4e-06 Identities = 30/74 (40%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXGGGGGGXXXXX 610 G G GG G GG GGGGG G G GG GGG G G GGG GG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGI 61 Query: 609 XKXPPPPXXGGGGG 568 GGG G Sbjct: 62 GGGGTGGGAGGGSG 75 Score = 53.2 bits (122), Expect = 8e-06 Identities = 26/59 (44%), Positives = 26/59 (44%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG GGGGG G G G GG G G GG GGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGG 60 Score = 45.6 bits (103), Expect = 0.002 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGG Sbjct: 11 GGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGG 52 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGG G Sbjct: 8 GGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRG 49 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GG GG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGG 46 Score = 44.4 bits (100), Expect = 0.004 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GG GG Sbjct: 18 GGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGG 59 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGV----GGGGGGGG 39 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GG GG Sbjct: 9 GGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGG 50 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G G GGG Sbjct: 10 GGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGG 51 Score = 43.6 bits (98), Expect = 0.007 Identities = 21/42 (50%), Positives = 21/42 (50%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGG G G GGGGG Sbjct: 12 GGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGG 53 Score = 41.1 bits (92), Expect = 0.035 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGG GG G G GGG G Sbjct: 14 GGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSG 55 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GGGGGGG G G G GGGG G G GGG Sbjct: 33 GGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGGAGGG 73 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG 661 GG G G GG G GG G GGG G G GG GG Sbjct: 45 GGGRGGGGGSGGDGGGIGGGGTGGGAGGGSGGDGNVWRCGGGGGAGG 91 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGG GG G G GG GG Sbjct: 32 GGGGGGGGIG-GGDGGGRGGGGGSGGDGGGIGGGGTGGGAGG 72 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGG-GXAXXXGAXGXXXPPXXGGXGGGG 658 GG G G GG GG GGGG G G+ G GG GG G Sbjct: 42 GGDGGGRGGGGGSGGDGGGIGGGGTGGGAGGGSGGDGNVWRCGGGGGAG 90 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGGG G GGGG G Sbjct: 2 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGG 42 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGGG G GGGG G Sbjct: 3 GGGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGG 43 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGG 540 GGGGGGG GGGGG G G GGG G Sbjct: 4 GGGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDG 45 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G GGG GG G G GG G Sbjct: 37 GGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGGAGGGSGGDG 78 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G GGGG G Sbjct: 14 GGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGG 69 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGG-GGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G G GGG GGG G G G GGG Sbjct: 27 GGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGG 69 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 GGGGG G G G GGGG G G G GGGG V Sbjct: 49 GGGGGSGGDG-GGIGGGGTGGGAGGGSGGDGNVWRCGGGGGAGGCV 93 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGGGGG G GG G G Sbjct: 7 GGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIG 62 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GGGGG G G G GGG Sbjct: 5 GGGGGGGGGGGGGGGGGGGGGGGGGGVGGGGGGGGIGGGDGGG 47 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GGGGG G G G GGG Sbjct: 18 GGGGGGGGGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGG 60 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GGGGGG G G G GGG G G GGGG Sbjct: 25 GGGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGG 65 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGA 543 G GGGGG GGGG G G GGGGGA Sbjct: 47 GRGGGGGSGGDGGGIGGGGTGGGAGGGSGGDGNVWRCGGGGGA 89 Score = 33.5 bits (73), Expect = 7.0 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGG G G G GGG G G G GGG G Sbjct: 26 GGGGGVGGGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTG 67 Score = 33.1 bits (72), Expect = 9.3 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 414 GGGGGGGVXXXXXXX-GGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG+ GGGGG G G GG GG Sbjct: 33 GGGGGGGIGGGDGGGRGGGGGSGGDGGGIGGGGTGGGAGGGSGG 76 >UniRef50_UPI0000DA32FB Cluster: PREDICTED: hypothetical protein; n=1; Rattus norvegicus|Rep: PREDICTED: hypothetical protein - Rattus norvegicus Length = 236 Score = 56.0 bits (129), Expect = 1e-06 Identities = 28/68 (41%), Positives = 29/68 (42%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G G GG GGGGG G G GG GGGG G GGGGGG Sbjct: 66 GGVGGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGA 125 Query: 621 XXXXXKXP 598 + P Sbjct: 126 GEAVLRSP 133 Score = 47.2 bits (107), Expect = 5e-04 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGGGG G G GGGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 GGGGGGG G G GGGGGG G G GGGG V Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGEAV 129 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G GGGGGG G G GGGGG Sbjct: 69 GGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGG 110 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GG G G G GGGGGG G G GGGGG Sbjct: 74 GGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 115 Score = 39.9 bits (89), Expect = 0.081 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGG G G G GGGGGG G G GGGGG Sbjct: 71 GVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112 Score = 38.3 bits (85), Expect = 0.25 Identities = 22/63 (34%), Positives = 22/63 (34%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 G GG GG GGG G GGGGGG G GGGG G Sbjct: 71 GVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGEAVL 130 Query: 544 XPP 536 P Sbjct: 131 RSP 133 Score = 37.9 bits (84), Expect = 0.33 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G GGGGGG G G GGGGG Sbjct: 73 GGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GG G G G GGGGGG G G GGGGG Sbjct: 75 GVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 116 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG G G G G GGGGGG G G GGGGG Sbjct: 77 GGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGG GGGV GGGGG G G GGGGG Sbjct: 69 GGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 111 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGG 569 G GG GG GGG G GGGGGG G GGGG Sbjct: 70 GGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 121 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GG G GGGGGG G G GGGGG Sbjct: 73 GGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +1 Query: 415 GGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGA 543 GGGGGGG GGGGG G G GGGGGA Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGA 125 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGG 539 GGGGGGG GGGGG G G GGGG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 124 Score = 35.1 bits (77), Expect = 2.3 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GGGGG G G GGG G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 126 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG--GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGG G G G GGGGG G G GGGGG Sbjct: 66 GGVGGGVGGGVGGRGRVGGGGGGGGGGGGGGGGGGGGGGGGGGG 109 >UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=3; Danio rerio|Rep: Wiskott-Aldrich syndrome protein (WASp). - Danio rerio Length = 490 Score = 56.0 bits (129), Expect = 1e-06 Identities = 26/54 (48%), Positives = 26/54 (48%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 P P PP GP PP P G P P PPPP PP P A PP PAAP Sbjct: 342 PLPQPPGPRSGPLPPPPTNRSGGLPPPLPEPSGGGPPPP-PPPPAAPPPPPAAP 394 Score = 50.4 bits (115), Expect = 6e-05 Identities = 28/68 (41%), Positives = 29/68 (42%), Gaps = 3/68 (4%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP---XAGPPXPAAPXXXP 799 PPPP G PPP P GG P P A PPPPP P P + P AAP Sbjct: 355 PPPPTNRSGGLPPPLPEPSGGGPPPPPPPPAA-PPPPPAAPPPMNFGSSPSSAAAPPASS 413 Query: 800 PXXGXGGA 823 G GA Sbjct: 414 GEEGGRGA 421 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXX-PPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPPP P P PP PPP Sbjct: 355 PPPPTNRSGGLPPPLPEPSGGGPPPPPPPPAAPPPPPAAPPP 396 Score = 37.5 bits (83), Expect = 0.43 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP P PPP P P PPPPPPP Sbjct: 344 PQPPGPRSGPLPPPPTNRSGGLPPPLPEPSGGGPPPPPPPP 384 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -1 Query: 598 PPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPP 419 PP G G PPPP P PPPPP PP P Sbjct: 335 PPGGRTGPLPQPPGPRSGPLPPPPTNRSGGLPPPLPEPSGGGPPPPPPPPAAPPPPPAAP 394 Query: 418 PP 413 PP Sbjct: 395 PP 396 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 PPP GGG P PPPPP P PPP PP Sbjct: 366 PPPLPEPSGGG-----PPPPPPPP--AAPPPPPAAPP 395 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 56.0 bits (129), Expect = 1e-06 Identities = 29/63 (46%), Positives = 29/63 (46%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PPPP P PPP P G P P PPPPP PP P G PA P PP G Sbjct: 166 PPPP---PSAPPPAPA--SGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPP---PPSGG 217 Query: 812 XGG 820 GG Sbjct: 218 GGG 220 Score = 56.0 bits (129), Expect = 1e-06 Identities = 24/56 (42%), Positives = 24/56 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGG 373 PPP P P P PPPPPP P PP PPPP G GGGG Sbjct: 173 PPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGG 228 Score = 53.6 bits (123), Expect = 6e-06 Identities = 26/65 (40%), Positives = 26/65 (40%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPX 805 PPPPP P P PP G P P PPPPP PP PP P P Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPP-----PPPPPPPPSGGGAPPAPPPPSGGGGG 220 Query: 806 XGXGG 820 G GG Sbjct: 221 GGGGG 225 Score = 47.6 bits (108), Expect = 4e-04 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP 712 PPPP PP PPP P PPPP PP GG P P Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPP 212 Score = 45.6 bits (103), Expect = 0.002 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXP-----PPPPPPXXXXXXXXGXGGG 376 PPPP P P P P PP P P P PP PPP G GGG Sbjct: 167 PPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGG 226 Query: 375 G 373 G Sbjct: 227 G 227 Score = 45.2 bits (102), Expect = 0.002 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 13/78 (16%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGA-------------XGXXXPPXX 679 PP P GG G G GG GGGGG A G P Sbjct: 199 PPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAAS 258 Query: 678 GGXGGGGPGXXXGGGGGG 625 GGGG G GGGGGG Sbjct: 259 ASSGGGGGGSSGGGGGGG 276 Score = 44.8 bits (101), Expect = 0.003 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 5/61 (8%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPP-----PPPPPXXXXXXXXGXGGG 376 PPPPP P PP P P P P PP PP PP G GGG Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGG 225 Query: 375 G 373 G Sbjct: 226 G 226 Score = 44.4 bits (100), Expect = 0.004 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +3 Query: 570 PPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 PPPP + P P PPP P PPP PP GG PP Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPP 214 Score = 42.7 bits (96), Expect = 0.011 Identities = 30/82 (36%), Positives = 31/82 (37%), Gaps = 17/82 (20%) Frame = -2 Query: 819 PPXPXXGGXXXGA----AGXGGPAXGXGGXGGGGGXAXXX-------------GAXGXXX 691 PP P GG A +G GG G GG GG GG A G Sbjct: 198 PPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAA 257 Query: 690 PPXXGGXGGGGPGXXXGGGGGG 625 GG GGG G GGGGGG Sbjct: 258 SASSGGGGGGSSGGGGGGGGGG 279 Score = 41.9 bits (94), Expect = 0.020 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXGG 692 P PPPP G A P PPPPPP PP PP GG Sbjct: 177 PASGPPPPP----GPPPAPGPPPPPPPPPPSGGGAPPAPPPPSGG 217 Score = 39.9 bits (89), Expect = 0.081 Identities = 25/55 (45%), Positives = 26/55 (47%) Frame = +2 Query: 659 PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 PPPP P P AP + PPPPP PP P GPP P P P GGA Sbjct: 167 PPPPSAP-------PPAPA--SGPPPPPGPP-PAPGPPPPPPP----PPPSGGGA 207 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 551 RXXAPPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 R APPPPP P P PPP P PPPPPPP Sbjct: 162 RASAPPPPPSAP-PPAPASGPPPPPGPPPAP----GPPPPPPPPPP 202 Score = 38.3 bits (85), Expect = 0.25 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 498 PXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P P PP P P P PPP P P GGG PP Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPP 212 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGG 691 PPPP G PPPPPP PP P PP GG Sbjct: 182 PPPPGPPPAPG----PPPPPPPPPPSGGGAPPAPPPPSGGG 218 Score = 36.7 bits (81), Expect = 0.75 Identities = 23/66 (34%), Positives = 23/66 (34%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTP 431 A PPPP G PPPPP P PPPPP P Sbjct: 163 ASAPPPPPSAPPPAPASG-----PPPPPG---------PPPAPGPPPPPPPPPPSGGGAP 208 Query: 430 PPPPPP 413 P PPPP Sbjct: 209 PAPPPP 214 Score = 35.9 bits (79), Expect = 1.3 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGG 475 GGGGGG G G GGGGGG Sbjct: 262 GGGGGGSSGGGGGGGGGGGG 281 Score = 33.5 bits (73), Expect = 7.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGG 475 GGGGG G G GGGGGG Sbjct: 263 GGGGGSSGGGGGGGGGGGGG 282 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 609 AXXPXXP---PPPPPXXXPXPPPXXPPXXGGXXXXXXPP 716 A P P PPP P P PPP PP G PP Sbjct: 163 ASAPPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPP 201 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/63 (33%), Positives = 21/63 (33%), Gaps = 2/63 (3%) Frame = +2 Query: 359 GGXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGG--GGXXXXXGXGXFXXFPXXXGG 532 GG P PP P GGGGGGG G G G GG Sbjct: 204 GGGAPPAPPPPSGGGGGGGGGGGGGGDGGLASALAGAKLRKVAKDDSGGPAPAASASSGG 263 Query: 533 GGG 541 GGG Sbjct: 264 GGG 266 >UniRef50_Q3KEU2 Cluster: Putative uncharacterized protein precursor; n=2; Pseudomonas|Rep: Putative uncharacterized protein precursor - Pseudomonas fluorescens (strain PfO-1) Length = 220 Score = 56.0 bits (129), Expect = 1e-06 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G +G GG G GG GGG G G G GG GGG G GG GGG Sbjct: 38 GGSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGH 97 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG G Sbjct: 98 GGSGSGGNSGSGGGGNSG 115 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -2 Query: 780 AGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 A GG G G GGGGG G G GG GGG G GGGGGG Sbjct: 35 AKEGGSGGGGSGGGGGGG--GNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGG 84 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G G GGGG G G G GGGGG Sbjct: 43 GGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGG 84 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGG-XXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G G GGGGGG G G GGGGG Sbjct: 41 GGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGG 83 Score = 40.3 bits (90), Expect = 0.061 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G G GGGG G GG GG Sbjct: 46 GGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGG 87 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG G GG G+ GG G G G G G Sbjct: 69 GGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGGNSGHSGSDHGSGHSG 127 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G G GG GGG G G GGG G Sbjct: 38 GGSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSG 79 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGGG G G G GGG Sbjct: 47 GGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGG 88 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G G GG GGG G G GGG G Sbjct: 50 GGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSG 91 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G GGGG G G G G GGG Sbjct: 55 GGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGG 96 Score = 38.7 bits (86), Expect = 0.19 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGG GGG G G G GGGG G GG GG GG Sbjct: 51 GGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGG 110 Query: 596 GG 601 GG Sbjct: 111 GG 112 Score = 38.3 bits (85), Expect = 0.25 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGG-GGXXXXXGXGXFXXFPXXXGGGG 538 GGGGGG G G GGGG GG G G GGGG Sbjct: 48 GGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGG 89 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +2 Query: 416 GGGGGGGXXGXXGXG-GGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGG G G G GGGGG G G G GGG Sbjct: 39 GSGGGGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGG 81 Score = 35.5 bits (78), Expect = 1.7 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G G GG GG G G GG G Sbjct: 74 GGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGGNSG 115 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGGG G + GG G G Sbjct: 43 GGSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGG 83 Score = 34.7 bits (76), Expect = 3.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GG GGG G GGGG G Sbjct: 47 GGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGG 87 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GGGG G G GGGG Sbjct: 47 GGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGG 89 Score = 33.5 bits (73), Expect = 7.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GGG GG G GGG G Sbjct: 60 GNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGGSGSGGNSGSGGGGNSG 115 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G GG GGG G G GG G Sbjct: 44 GSGGGGGGGGNGGGGGGNGGGGSGGGGGGNGGGGSGGGGGGNGGGGSGGNGGGHGG 99 >UniRef50_Q9XDH2 Cluster: Proline-rich mucin homolog; n=2; Mycobacterium tuberculosis|Rep: Proline-rich mucin homolog - Mycobacterium tuberculosis Length = 763 Score = 56.0 bits (129), Expect = 1e-06 Identities = 32/86 (37%), Positives = 33/86 (38%), Gaps = 9/86 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP PP C P PP P P PP PP PP P P PP PP Sbjct: 554 PPTPPKLLSANPPCP----PVPPAPNRPPAPPAPPAPPELPAPPDPPTPPVANSPPAPPA 609 Query: 746 PPXPXA--------GPPXPAAPXXXP 799 PP P + PP PAAP P Sbjct: 610 PPAPPSALPFVNPPAPPTPAAPKSRP 635 Score = 53.2 bits (122), Expect = 8e-06 Identities = 31/75 (41%), Positives = 31/75 (41%), Gaps = 2/75 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP-PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP PP PP PP P PPP PP P AP A PP PP Sbjct: 622 PPAPPTPAAPKSRPALPAAPPAPPAPPVRATTPPPAPPA------PPAPNSMALPPAPPD 675 Query: 746 PPXP-XAGPPXPAAP 787 PP P A PP P AP Sbjct: 676 PPIPLLATPPAPPAP 690 Score = 52.0 bits (119), Expect = 2e-05 Identities = 28/77 (36%), Positives = 29/77 (37%), Gaps = 4/77 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP----PPXPPXXGGXXXPXAPXXXAXPPP 736 PP PP P PPPP P PP PP PP P P P Sbjct: 78 PPLPPAPPEAPRESRPALPPCPPPPVVIPDPPEPAAPPVPPAPNSPPFPPFPPAPKFVPA 137 Query: 737 PPXPPXPXAGPPXPAAP 787 PP PP P + PP P P Sbjct: 138 PPVPPVPNS-PPFPPFP 153 Score = 52.0 bits (119), Expect = 2e-05 Identities = 30/78 (38%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP P C P PP P P PP PP PP P P A P PP P Sbjct: 523 PPAPPSPPATRLCPPLP-PSPPAPNSPPAPPAPPTPPKLLSANPPCPPVPPA-PNRPPAP 580 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P A P PA P P Sbjct: 581 PAPPAPPELPAPPDPPTP 598 Score = 50.0 bits (114), Expect = 8e-05 Identities = 27/58 (46%), Positives = 27/58 (46%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP P PP PP P AP PP PP PP P AG P PAAP P Sbjct: 138 PPVPPVPNSPPFPPFPPAALNPPAPPAPPLANSPPLPPAPPTP-AGTP-PAAPWPPVP 193 Score = 50.0 bits (114), Expect = 8e-05 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 3/80 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP PP PP PP PP PP PP P AP P PP Sbjct: 539 PPSPPAPNSP----PAPPAPPTPPKLLSANPPCPPVPPAPNRPPAPPAPPAPPELPAPPD 594 Query: 746 PPXPXA--GPPXPAAPXXXP 799 PP P PP P AP P Sbjct: 595 PPTPPVANSPPAPPAPPAPP 614 Score = 50.0 bits (114), Expect = 8e-05 Identities = 26/65 (40%), Positives = 27/65 (41%), Gaps = 7/65 (10%) Frame = +2 Query: 626 PPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXX------AXPPPPPXPPXPXAGPPXPAA 784 P PP P P PP PP PP P AP PP PP P P + P PAA Sbjct: 581 PAPPAPPELPAPPDPPTPPVANSPPAPPAPPAPPSALPFVNPPAPPTPAAPKSRPALPAA 640 Query: 785 PXXXP 799 P P Sbjct: 641 PPAPP 645 Score = 49.6 bits (113), Expect = 1e-04 Identities = 30/80 (37%), Positives = 30/80 (37%), Gaps = 3/80 (3%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP--- 739 PP PP PP PP P PP PP P P PPPP Sbjct: 49 PPAPPAPPKPKSKAPFPPVPPAPPARELAPPLPPAPPEAPRESRPALPPC---PPPPVVI 105 Query: 740 PXPPXPXAGPPXPAAPXXXP 799 P PP P A PP P AP P Sbjct: 106 PDPPEP-AAPPVPPAPNSPP 124 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/58 (41%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXA-XPPPPPXPPXPXAGPPXPAAPXXXP 799 PP PP P PP PP P AP A PP P PP P A PA+P P Sbjct: 150 PPFPPAALNPPAPPAPPLANSPPLPPAPPTPAGTPPAAPWPPVPAAPKSKPASPPRPP 207 Score = 48.0 bits (109), Expect = 3e-04 Identities = 28/85 (32%), Positives = 28/85 (32%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP-- 742 PP PP P PP P P PP PP P P PP PP Sbjct: 655 PPAPPAPPAPNSMALPPAPPDPPIPLLATPPAPPAPPLPMSPPAPPLPPAAPDPPAPPLT 714 Query: 743 --XPPXPXAGPPXPAAPXXXPPXXG 811 PP P P P AP P G Sbjct: 715 INQPPSPPLA-PVPGAPLAPLPING 738 Score = 47.6 bits (108), Expect = 4e-04 Identities = 23/60 (38%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAG--PPXPAAPXXXPP 802 PP PP P PP PP P P PP PP PP + PP P P PP Sbjct: 126 PPFPPAPKFVPAPPVPPVPNSPPFPPFPPAALNPPAPPAPPLANSPPLPPAPPTPAGTPP 185 Score = 47.6 bits (108), Expect = 4e-04 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXX--PXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP P PP PP G P P A P PP P A PP PA P PP Sbjct: 162 PPAPPLANSPPLPPAPPTPAGTPPAAPWPPVPAAPKSKPASPPRPPA-PPMPATPMEFPP 220 Score = 47.2 bits (107), Expect = 5e-04 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PP P P PP P PP P P P AP P PP PP Sbjct: 641 PPAPPAPPVRATTPPPAPPAPPAPNSMALPPAPPDPPIPLLATPPAPPAPPLPMSPPAPP 700 Query: 752 XPXAGPPXPAAP 787 P A P PA P Sbjct: 701 LPPAAPDPPAPP 712 Score = 46.0 bits (104), Expect = 0.001 Identities = 27/74 (36%), Positives = 27/74 (36%), Gaps = 1/74 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP-PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP PP PP PP P PP P P P P PP PP Sbjct: 203 PPRPPAPPMPATPMEFPPLPPVPPDPISKETPPAPPAP-------PIPPAPVPIPPVPPL 255 Query: 746 PPXPXAGPPXPAAP 787 PP P PP P AP Sbjct: 256 PPVPNKIPPAPPAP 269 Score = 45.6 bits (103), Expect = 0.002 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP PP P PP P PP PP PP P AP A P P Sbjct: 577 PPAPPAPPAPPELPAPPDPPTPPVANSPPAPPAPPAPPSALPFVNPPAPPTPAAPKSRPA 636 Query: 746 PPXPXAGPPXPAAPXXXPP 802 P PP P PP Sbjct: 637 LPAAPPAPPAPPVRATTPP 655 Score = 45.2 bits (102), Expect = 0.002 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP P PP PP P P PP PP PP P PA P P Sbjct: 114 PPVPPAPNSPPFPPFPPAPKFVPAPPVPPVPNSPPFPPFPPAALNPPAPPAPPLANSP 171 Score = 44.4 bits (100), Expect = 0.004 Identities = 31/88 (35%), Positives = 31/88 (35%), Gaps = 11/88 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPP---PXXXPGP--PPPXPPXXGGXXXPXAPXXX-AXP 730 PP PP G PP P P PGP PP P P P A P Sbjct: 428 PPAPPIPPGKPWTTPPLAPAPPEPKTVPVLPPGPSCPPSEKPNPPAPPEPPEPKSSPALP 487 Query: 731 PPPPXPPXPXA-----GPPXPAAPXXXP 799 P PP P P A PP P AP P Sbjct: 488 PAPPAPSMPSAVRVPPSPPIPPAPPAAP 515 Score = 43.2 bits (97), Expect = 0.009 Identities = 25/63 (39%), Positives = 26/63 (41%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPP--PPXXXPGPP-PPXPPXX-GGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PP P PP P PP PP PP P AP + P PP P P PAAP Sbjct: 458 PPGPSCPPSEKPNPPAPPEPPEPKSSPALPPAPPAPSMPSAVRVPPSPPIPPAPPAAPRA 517 Query: 794 XPP 802 P Sbjct: 518 SMP 520 Score = 43.2 bits (97), Expect = 0.009 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 4/71 (5%) Frame = +2 Query: 599 GXXCXXXXXPPPPPPXXXPGPPPP--XPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGP- 769 G C P PP P P PP P P P P PP PP PP P A P Sbjct: 460 GPSCPPSEKPNPPAP---PEPPEPKSSPALPPAPPAPSMPSAVRVPPSPPIPPAPPAAPR 516 Query: 770 -PXPAAPXXXP 799 PA P P Sbjct: 517 ASMPALPPAPP 527 Score = 43.2 bits (97), Expect = 0.009 Identities = 27/78 (34%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXP-PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP PP P PP PP P PP P P PP PP Sbjct: 487 PPAPPAPSMPSAVRVPPSPPIPPAPPAAPRASMPALPPAP-----PSPPATRLCPPLPPS 541 Query: 746 PPXPXAGPPXPAAPXXXP 799 PP P + PP P AP P Sbjct: 542 PPAPNS-PPAPPAPPTPP 558 Score = 42.7 bits (96), Expect = 0.011 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX--PPPPP 742 PP PP P PP P P PP PP P AP PP Sbjct: 508 PPAPPAAPRASMPALPPAPPSPPATRLCP-PLPPSPPAPNSPPAPPAPPTPPKLLSANPP 566 Query: 743 XPPXPXAGPPXPAAPXXXP 799 PP P A P P AP P Sbjct: 567 CPPVPPA-PNRPPAPPAPP 584 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP P PP PP P A PP PP PP PP PA P P Sbjct: 610 PPAPPSALPFVNPPAPPTPAAPKS--RPALPAAPPAPPAPPVRATTPP-PAPPAPPAP 664 Score = 42.3 bits (95), Expect = 0.015 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 4/81 (4%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PP-PPXPPXXGGXXXPXAPXXXAXPPPP- 739 P PP PP PP P PP PP PP P AP PP P Sbjct: 188 PWPPVPAAPKSKPASPPRPPAPPMPATPMEFPPLPPVPPDPISKETPPAPPAPPIPPAPV 247 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP PP P P PP Sbjct: 248 PIPPV----PPLPPVPNKIPP 264 Score = 41.9 bits (94), Expect = 0.020 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 7/84 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG-PP-PPXPPXXGGXXXPXAPXXXAXPPPPP 742 PP PP PP P P PP PP P P AP P PP Sbjct: 65 PPVPPAPPARELAPPLPPAPPEAPRESRPALPPCPPPPVVIPDPPEPAAPPVPPAPNSPP 124 Query: 743 XPPXPXA-----GPPXPAAPXXXP 799 PP P A PP P P P Sbjct: 125 FPPFPPAPKFVPAPPVPPVPNSPP 148 Score = 41.9 bits (94), Expect = 0.020 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP G P P P PP PP P P PP PP P Sbjct: 174 PPAPPTPAGTPPAAPWPPVPAAPKSKPASPPRPPAPPM------PATPMEF--PPLPPVP 225 Query: 749 PXPXAG--PPXPAAPXXXP 799 P P + PP P AP P Sbjct: 226 PDPISKETPPAPPAPPIPP 244 Score = 41.5 bits (93), Expect = 0.026 Identities = 26/78 (33%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP PP PP P PP PP P AP + PP PP Sbjct: 263 PPAPPAPPVAVAAVLVAPCPPLPP---LPNNHPPAPPAAPVPGVPLAPLPNSHPPAPPSA 319 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P G P P P Sbjct: 320 PVP--GVPLAPLPISGRP 335 Score = 41.1 bits (92), Expect = 0.035 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP C PP P P PP P P P PP PP P Sbjct: 30 PPAPP-----APPCWMLVSAAPPCPPAPPAPPKPKSKAPFPPVPPAPPARELAPPLPPAP 84 Query: 749 PXPXAGPPXPAAPXXXPP 802 P PA P PP Sbjct: 85 PEAPR-ESRPALPPCPPP 101 Score = 41.1 bits (92), Expect = 0.035 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 9/86 (10%) Frame = +2 Query: 569 PPPPPXXG--GGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXG-GXXXPXAPXXXAXPPP 736 PP PP C PP P P PP PP PP P AP Sbjct: 33 PPAPPCWMLVSAAPPCPPAPPAPPKPKSKAPFPPVPPAPPARELAPPLPPAPPEAPRESR 92 Query: 737 PPXPPXP-----XAGPPXPAAPXXXP 799 P PP P PP PAAP P Sbjct: 93 PALPPCPPPPVVIPDPPEPAAPPVPP 118 Score = 41.1 bits (92), Expect = 0.035 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 9/82 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPP- 742 PP PP P PP P P PP PP P P P PP PP Sbjct: 96 PPCPPPPVVIPDPPEPAAPPVPPAPNSPPFPPFPPAPKFVPAPPVPPVPNSPPFPPFPPA 155 Query: 743 --XPPXPXA-----GPPXPAAP 787 PP P A PP P AP Sbjct: 156 ALNPPAPPAPPLANSPPLPPAP 177 Score = 40.7 bits (91), Expect = 0.046 Identities = 32/86 (37%), Positives = 32/86 (37%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP-PPXXXPGPP-PPXPPXXGGXXX-PXAPXXXAXP--- 730 PP PP P PP PP P PP PP PP P AP Sbjct: 219 PPLPPVPPDPISKETPPAPPAPPIPPAPVPIPPVPPLPPVPNKIPPAPPAPPVAVAAVLV 278 Query: 731 -PPPPXPPXPXAGPP-XPAAPXXXPP 802 P PP PP P PP PAAP P Sbjct: 279 APCPPLPPLPNNHPPAPPAAPVPGVP 304 Score = 40.7 bits (91), Expect = 0.046 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP P P P P PP PP P A PP PP P Sbjct: 474 PPEPPEPKSSPALPPAPPAPSMPSAVRVP-PSPPIPPAPPAAPRASMP---ALPPAPPSP 529 Query: 749 PXPXAGPPXPAAP 787 P PP P +P Sbjct: 530 PATRLCPPLPPSP 542 Score = 40.3 bits (90), Expect = 0.061 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P P P P PP PP P P P P PP P P + P P AP P Sbjct: 420 PLPISPGVPPAPPIPPGKPWTTPPLAPAPPEPKTVPVLPPGPSCPPSEKPNPPAPPEPP 478 Score = 39.5 bits (88), Expect = 0.11 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXX----PXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PP PP P PP PP AP PP PP P PP P AP Sbjct: 14 PPAPPAPAEPKSKPPFPPAPPAPPCWMLVSAAPPCPPAPPAPPKPKSKAPFPPVPPAP 71 Score = 38.7 bits (86), Expect = 0.19 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP P P PP P P P P PP PP P P +A PP Sbjct: 511 PPAAPRASMPALPPAPPSPPATRLCPPLPPSPPAPNSPPAPPAPPTPPKLLSANPPCPP 569 Score = 38.7 bits (86), Expect = 0.19 Identities = 27/116 (23%), Positives = 28/116 (24%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 P PP P P PP PP P P P PP PP P Sbjct: 555 PTPPKLLSANPPCPPVPPAPNRPPAPPAPPAPPELPAPPDPPTPPVANSPPAPPAPPAPP 614 Query: 360 PXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 F+ P PP PP P P P P Sbjct: 615 SALPFVNPPAPPTPAAPKSRPALPAAPPAPPAPPVRATTPPPAPPAPPAPNSMALP 670 Score = 38.3 bits (85), Expect = 0.25 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 8/85 (9%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPP---PPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-- 733 PP PP P PP P P PP P P P AP PP Sbjct: 592 PPDPPTPPVANSPPAPPAPPAPPSALPFVNPPAPPTPAAPK-SRPALPAAPPAPPAPPVR 650 Query: 734 ---PPPXPPXPXAGPPXPAAPXXXP 799 PPP PP P A P A P P Sbjct: 651 ATTPPPAPPAPPA-PNSMALPPAPP 674 Score = 37.9 bits (84), Expect = 0.33 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 6/84 (7%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP-PPPPXXXPGPPPPXPP-----XXGGXXXPXAPXXXAXP 730 PP PP PP PP P P P PP PP P P P Sbjct: 234 PPAPPAPPIPPAPVPIPPVPPLPPVPNKIP-PAPPAPPVAVAAVLVAPCPPLPPLPNNHP 292 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P P G P P PP Sbjct: 293 PAPPAAPVP--GVPLAPLPNSHPP 314 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = +2 Query: 653 PGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPP-XPAAPXXXPP 802 P P PP PP P P A PP PP PP PP P AP P Sbjct: 381 PAPIPPLPPL------PPLPINTAVPPIPPLPPVTALAPPLPPLAPLPISP 425 Score = 37.1 bits (82), Expect = 0.57 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 2/79 (2%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPPPPX 745 PP P PP PP P PP PP P PP P Sbjct: 490 PPAPSMPSAVRVPPSPPIPPAPPAAPRASMPALPPAPPSPPATRL--CPPLPPSPPAPNS 547 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P A P P PP Sbjct: 548 PPAPPAPPTPPKLLSANPP 566 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP P P PP PP P P PP PP P P G P P P Sbjct: 687 PPAPPLPMSP-PAPPLPP--AAPDPPAPPLTINQPPSPPLAPVP--GAPLAPLPINGRP 740 Score = 36.7 bits (81), Expect = 0.75 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 7/64 (10%) Frame = +2 Query: 629 PPPPPXXXPGPPP------PXPPXXGGXXXPXAPXXXA-XPPPPPXPPXPXAGPPXPAAP 787 PP PP P PP PP P P A PP PP PP PP P AP Sbjct: 27 PPFPPA--PPAPPCWMLVSAAPPCPPAPPAPPKPKSKAPFPPVPPAPPARELAPPLPPAP 84 Query: 788 XXXP 799 P Sbjct: 85 PEAP 88 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXP 799 P P P P PP P P P P PP PP A PP P AP P Sbjct: 3 PVPAPRALAPLPPAPPAPAEPKSKPPFPPA----PPAPPCWMLVSAAPPCPPAPPAPP 56 Score = 36.3 bits (80), Expect = 1.00 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXP----XAPXXXAXPPPPPXPPXPXAGPPXPAAPXXX 796 P PP P P PP P PP PP PP P + P P P Sbjct: 12 PLPPAPPAPAEPKSKPPFPPAPPAPPCWMLVSAAPPCPPAPPAPPKPKSKAPFPPVPPAP 71 Query: 797 P 799 P Sbjct: 72 P 72 Score = 35.9 bits (79), Expect = 1.3 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA-GPPXPAAPXXXPP 802 PP PP PP PP P P PP P P A PP P PP Sbjct: 400 PPIPPLPPVTALAPPLPPLAPLPISPGVPPAPPIPPGKPWTTPPLAPAPPEPKTVPVLPP 459 Score = 35.5 bits (78), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PP PP K P P PP P P P P PP P Sbjct: 219 PPLPPVPPDPISKETPPAPPAPPIPPAPVPIPPVPPLPPVP 259 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXX-----GXXXKXPXPXXXXXPPPPPPXPXXPXX 436 P PP + PP PP P P PP PP P P Sbjct: 488 PAPPAPSMPSAVRVPPSPPIPPAPPAAPRASMPALPPAPPSPPATRLCPPLPPSPPAPNS 547 Query: 435 PPPPPPP 415 PP PP P Sbjct: 548 PPAPPAP 554 Score = 35.5 bits (78), Expect = 1.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP PP P P PP PP P PP PP Sbjct: 554 PPTPPKLLSANPPCPPVPPAPNRPPAPPAPPAPPELPAPPDPP 596 Score = 35.5 bits (78), Expect = 1.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP PP PP P P P PP P P P PP P Sbjct: 654 PPPAPPAPPAPNSMALPPAPPDPPIPL--LATPPAPPAPPLPMSPPAPPLPPAAPDPPAP 711 Query: 417 P 415 P Sbjct: 712 P 712 Score = 34.7 bits (76), Expect = 3.0 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 8/66 (12%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXX-PXAPXXXAXPP-------PPPXPPXPXAGPPXPAA 784 PP P P PP PP P P PP PP PP P A PP P + Sbjct: 2 PPVPAPRALAPLPPAPPAPAEPKSKPPFPPAPPAPPCWMLVSAAPPCPPAPPA-PPKPKS 60 Query: 785 PXXXPP 802 PP Sbjct: 61 KAPFPP 66 Score = 34.7 bits (76), Expect = 3.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP PP G P P P P P P PP P P Sbjct: 174 PPAPPTPAGTPPAAPWPPVPAAPKSKPASPPRPPAPPMPATP 215 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP P P PP PP P P PP PP P Sbjct: 542 PPAPNSPPAPPAPPTPPKLLSANPPCPPVPPAPNRPPAPPAP 583 Score = 33.9 bits (74), Expect = 5.3 Identities = 28/114 (24%), Positives = 29/114 (25%), Gaps = 2/114 (1%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPP--PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXX 364 PP P + P PPPP P P P PP PP P Sbjct: 78 PPLPPAPPEAPRESRPALPPCPPPPVVIPDPPEPAAPPVPPAPNSPPFPP-------FPP 130 Query: 363 PPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGP 202 P F P P PP PP P P G P Sbjct: 131 APKFVPAPPVPPVPNSPPFPPFPPAALNPPAPPAPPLANSPPLPPAPPTPAGTP 184 Score = 33.9 bits (74), Expect = 5.3 Identities = 22/59 (37%), Positives = 23/59 (38%), Gaps = 2/59 (3%) Frame = +2 Query: 629 PPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPP-PPXPPXPXAGPPXPAAPXXXP 799 P P P PP PP P P P A PP PP P P + P P AP P Sbjct: 378 PALPAPIPPLPPLPPLPINTAVPPIPPLPPVTALAPPLPPLAPLPIS-PGVPPAPPIPP 435 Score = 33.9 bits (74), Expect = 5.3 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PP P PP PP PP P P P P PP P P P P PP Sbjct: 389 PLPPLPINTAVPPIPPLPPVTA--LAPPLPPLAPLPISPGVPPAP---PIPPGKPWTTPP 443 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP PP PP P P P PP P P PP PP Sbjct: 503 PSPPIPPAPPAAPRASMPALPPAPPSPPATRLCPPLP-------PSPPAPNSPPAPPAPP 555 Query: 420 PP 415 P Sbjct: 556 TP 557 >UniRef50_Q0RHG8 Cluster: Putative serine/threonine protein kinase; n=1; Frankia alni ACN14a|Rep: Putative serine/threonine protein kinase - Frankia alni (strain ACN14a) Length = 822 Score = 56.0 bits (129), Expect = 1e-06 Identities = 37/129 (28%), Positives = 37/129 (28%), Gaps = 1/129 (0%) Frame = -2 Query: 765 PAXGXGGXGGGGGX-AXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPP 589 P G GG GGG G GA G G PG GG GG P P Sbjct: 667 PTPGQGGAGGGPGVWLGSAGAPGTGVAGNPAAPGVHVPGAPVPGGAGGPAPTSGAAGPLP 726 Query: 588 XXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXX 409 GG PP PP P P P P P P P P P Sbjct: 727 PSPGGASPGGGIVTTPPPAPPATRPPTATPPAPTAEPSSSAPTPKPTPKPTPKPTPKPTK 786 Query: 408 XXXXXXGXG 382 G G Sbjct: 787 TCQTSGGRG 795 Score = 45.6 bits (103), Expect = 0.002 Identities = 32/112 (28%), Positives = 32/112 (28%), Gaps = 2/112 (1%) Frame = +2 Query: 419 GGGGGGXXGXXGXGG--GGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXG 592 GG GGG G G G G G GG GG P PP G Sbjct: 672 GGAGGGPGVWLGSAGAPGTGVAGNPAAPGVHVPGAPVPGGAGGPAPTSGAAGPLPPSPGG 731 Query: 593 GGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP P PP P P P P P P P Sbjct: 732 ASPGGGIVTTPPPAPPATRPPTATPPAPTAEPSSSAP-TPKPTPKPTPKPTP 782 Score = 39.5 bits (88), Expect = 0.11 Identities = 39/136 (28%), Positives = 39/136 (28%) Frame = +2 Query: 377 PPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVX 556 P P P G G G GG GGG G G G Sbjct: 646 PAPAPSSRVSV-SAGASPGAVLPTPGQGGAGGGPGVWLGSAG------APGTGVAGNPAA 698 Query: 557 XXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 P P GG G P P GP PP P GG P PP Sbjct: 699 PGVHVPGAPVPGGAGG---------PAPTSGAAGPLPPSP---GG-ASPGGGIVTTPPPA 745 Query: 737 PPXPPXPXAGPPXPAA 784 PP P A PP P A Sbjct: 746 PPATRPPTATPPAPTA 761 Score = 37.9 bits (84), Expect = 0.33 Identities = 24/88 (27%), Positives = 25/88 (28%), Gaps = 1/88 (1%) Frame = +3 Query: 417 GGGGGGVXXXXXXXGGGG-GXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXXG 593 GG GGG G G G G + GG GG P PP G Sbjct: 672 GGAGGGPGVWLGSAGAPGTGVAGNPAAPGVHVPGAPVPGGAGGPAPTSGAAGPLPPSPGG 731 Query: 594 GGGXXAXXPXXPPPPPPXXXPXPPPXXP 677 PP PP P P P Sbjct: 732 ASPGGGIVTTPPPAPPATRPPTATPPAP 759 Score = 36.3 bits (80), Expect = 1.00 Identities = 28/104 (26%), Positives = 28/104 (26%) Frame = -2 Query: 732 GGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXX 553 G G G P G PG G G P P GG GG Sbjct: 663 GAVLPTPGQGGAGGGPGVWLGSAGAPGT---GVAGNPAAPGVHVPGAPVPGGAGGPAPTS 719 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP P PPP PP P PP P Sbjct: 720 GAAGPLPP----SPGGASPGGGIVTTPPPAPPATRPPTATPPAP 759 >UniRef50_Q0LTW4 Cluster: Peptidase M56, BlaR1 precursor; n=1; Caulobacter sp. K31|Rep: Peptidase M56, BlaR1 precursor - Caulobacter sp. K31 Length = 596 Score = 56.0 bits (129), Expect = 1e-06 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 2/85 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP PP P PP P P PP P P A PPPPP P Sbjct: 335 PPAPPAPPAPPAPPALSSIPAPPEPPAPPAPPEPAESAEAMTLALLPPPPPA-PPPPPAP 393 Query: 749 PXPXAGPPXPAAP--XXXPPXXGXG 817 P P PP P AP PP G G Sbjct: 394 PPPPPAPPAPPAPPAPPAPPPEGLG 418 Score = 48.0 bits (109), Expect = 3e-04 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 17/75 (22%) Frame = +2 Query: 626 PPPPPPXXXPGPP-PPXPPXXGG------XXXPXAPXXXA----------XPPPPPXPPX 754 P PP P P PP PP PP P AP A PPPPP PP Sbjct: 330 PLPPAPPAPPAPPAPPAPPALSSIPAPPEPPAPPAPPEPAESAEAMTLALLPPPPPAPPP 389 Query: 755 PXAGPPXPAAPXXXP 799 P A PP P AP P Sbjct: 390 PPAPPPPPPAPPAPP 404 Score = 43.2 bits (97), Expect = 0.009 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 P PP T PPPP P P PPPPPP P P PP PP Sbjct: 360 PAPPAPPEPAESAEAMTLALLPPPP---------PAPPPPPAPPPPPPAPPAPPAPPAPP 410 Query: 420 PP 415 P Sbjct: 411 AP 412 Score = 42.3 bits (95), Expect = 0.015 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPPP P P PPP PP P P PP PPP Sbjct: 381 PPPPPAP-------PPPPAPPPPPPAPPAPPAPPAPPAPPP 414 Score = 38.7 bits (86), Expect = 0.19 Identities = 22/74 (29%), Positives = 22/74 (29%), Gaps = 1/74 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP-PXPXXPXXPPPP 424 P PP PP P P PPPPP P P P P PP Sbjct: 345 PAPPALSSIPAPPEPPAPPAPPEPAESAEAMTLALLPPPPPAPPPPPAPPPPPPAPPAPP 404 Query: 423 PPPXXXXXXXXGXG 382 PP G G Sbjct: 405 APPAPPAPPPEGLG 418 >UniRef50_Q6Z495 Cluster: Putative glycine-rich cell wall structural protein; n=2; Oryza sativa|Rep: Putative glycine-rich cell wall structural protein - Oryza sativa subsp. japonica (Rice) Length = 296 Score = 56.0 bits (129), Expect = 1e-06 Identities = 33/80 (41%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXX--PPXXGGXGGGGPGXXXGGGGG 628 GG G G G GG GGGGG GA G GG GGGG G GGGGG Sbjct: 116 GGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGG 175 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G K GG GG Sbjct: 176 GIGGGGGKGGGFGAGGGVGG 195 Score = 55.2 bits (127), Expect = 2e-06 Identities = 32/79 (40%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXG-GGGPGXXXGGGGGG 625 GG G G G G GG GGGGG GA G GG G G G G GGGGG Sbjct: 158 GGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGGK 217 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 218 GGGFGAGGVMGGGAGGGGG 236 Score = 51.6 bits (118), Expect = 2e-05 Identities = 32/80 (40%), Positives = 32/80 (40%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGG-GGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXGGGGG 628 GG G GG G GG GG GGG G G GG GGG G G GGGGG Sbjct: 65 GGFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGG 124 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G G GGG Sbjct: 125 GGFGGGSGGGVGGGGGQGGG 144 Score = 50.8 bits (116), Expect = 4e-05 Identities = 27/61 (44%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGX--GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G GG A G GG GGGGG G G G G GG G GGGGG Sbjct: 184 GGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGGG 243 Query: 627 G 625 G Sbjct: 244 G 244 Score = 50.4 bits (115), Expect = 6e-05 Identities = 33/81 (40%), Positives = 34/81 (41%), Gaps = 3/81 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXP--PXXGGXGGG-GPGXXXGGGG 631 GG G +G GG G GG G GGG G G GG GGG G G GGGG Sbjct: 106 GGGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGG 165 Query: 630 GGXXXXXXKXPPPPXXGGGGG 568 GG GGGGG Sbjct: 166 GGGFGGGGGG----GIGGGGG 182 Score = 50.0 bits (114), Expect = 8e-05 Identities = 30/78 (38%), Positives = 31/78 (39%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G GG GGGG G GG GGGG G GG GGG Sbjct: 78 GGGLGGGGGFGG--GGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGGV 135 Query: 621 XXXXXKXPPPPXXGGGGG 568 + GG GG Sbjct: 136 GGGGGQGGGFGAGGGVGG 153 Score = 47.6 bits (108), Expect = 4e-04 Identities = 27/59 (45%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXG-GGGPGXXXGGGGG 628 GG G +G GG G GG G GGG G G GG G GGG G GGGGG Sbjct: 148 GGGVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGGG----KGGGFGAGGGVGGAAGGGGG 202 Score = 47.2 bits (107), Expect = 5e-04 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXGGGGGG 625 GG G G G GG GGGGG G GG GGG G G GGG GG Sbjct: 62 GGGGGFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGG 121 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 122 GGGGGFGGGSGGGVGGGGG 140 Score = 47.2 bits (107), Expect = 5e-04 Identities = 29/80 (36%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGG--GGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G GG G GG GGG GG G G GGGG G GGG G Sbjct: 153 GGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFG 212 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G GGG G Sbjct: 213 GGGGKGGGFGAGGVMGGGAG 232 Score = 46.8 bits (106), Expect = 7e-04 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G GG + GG GGGGG G G GG GG G G GGG GG Sbjct: 142 GGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGG-----GIGGGGGKGGGFGAGGGVGGA 196 Query: 621 XXXXXKXPPPPXXGGGGG 568 G GGG Sbjct: 197 AGGGGGMGSGGGGGFGGG 214 Score = 45.2 bits (102), Expect = 0.002 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXG-GGGPGXXXGGGGGG 625 GG G GG G G GGG G G G GG G GGG G G GGG Sbjct: 96 GGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGS 155 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 156 GTGGGLGGGGGGGFGGGGG 174 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/62 (41%), Positives = 26/62 (41%), Gaps = 3/62 (4%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGG---GGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 GG G G GG G G GGG GG G G GG GGG G G GG Sbjct: 180 GGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGG 239 Query: 630 GG 625 GG Sbjct: 240 GG 241 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G GG GGG G G GGGGG Sbjct: 162 GGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGG 202 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGG G G GG GGG G G GGGGG Sbjct: 195 GAAGGGGGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGG 236 Score = 38.7 bits (86), Expect = 0.19 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGG GGG G GGGGGG G G GG G V GG Sbjct: 148 GGGVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGG 207 Query: 596 GG 601 GG Sbjct: 208 GG 209 Score = 38.3 bits (85), Expect = 0.25 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 410 FXGGGGGG--GXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 F GGGGGG G G G GGGG G G G G GGG Sbjct: 73 FRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGG 118 Score = 38.3 bits (85), Expect = 0.25 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGG G G GG GGG G G GGGGG Sbjct: 125 GGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGG 166 Score = 37.9 bits (84), Expect = 0.33 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGG---GGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGG GGG G G G GGG Sbjct: 170 GGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGG 214 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 416 GGGG--GGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GGG G G G G GG G G F GGGG Sbjct: 96 GGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGG 139 Score = 37.5 bits (83), Expect = 0.43 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G G GGG G G G F GGGGG Sbjct: 137 GGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGF--GGGGGGG 176 Score = 37.1 bits (82), Expect = 0.57 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGGG G G G GGGG G G GG GG Sbjct: 66 GFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGG 107 Score = 37.1 bits (82), Expect = 0.57 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 410 FXGGGG--GGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 F GGGG GGG G G GG GGG G G G GGG Sbjct: 67 FGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGG 112 Score = 36.7 bits (81), Expect = 0.75 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G G G GGG G G GGGGG Sbjct: 85 GGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGG 126 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GGG GGG G GGGGGG G GG G V GG Sbjct: 106 GGGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGG 165 Query: 596 GG 601 GG Sbjct: 166 GG 167 Score = 36.3 bits (80), Expect = 1.00 Identities = 27/65 (41%), Positives = 27/65 (41%), Gaps = 6/65 (9%) Frame = -2 Query: 801 GGXXXGAAGXG-GPAXGXGGX-----GGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 GG G G G GP G GGGGG G G GG GG G G G Sbjct: 36 GGFGHGPKGFGRGPGFGHDCRFGRCHGGGGGFGGGGGFRG-------GGGGGLGGGGGFG 88 Query: 639 GGGGG 625 GGGGG Sbjct: 89 GGGGG 93 Score = 36.3 bits (80), Expect = 1.00 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGG---GGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPX 586 GGG GGG G GGG GGG G G GGGGG Sbjct: 138 GGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAA 197 Query: 587 XGGGG 601 GGGG Sbjct: 198 GGGGG 202 Score = 35.9 bits (79), Expect = 1.3 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GG GGGG G G GG GGG G G GGG G GG Sbjct: 79 GGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGG 138 Query: 596 GG 601 GG Sbjct: 139 GG 140 Score = 35.9 bits (79), Expect = 1.3 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGG-GGXXXVXXXXXPPPPPXXG 592 GG G GG G G GG GGG G G GGG GG G Sbjct: 111 GGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFG 170 Query: 593 GGG 601 GGG Sbjct: 171 GGG 173 Score = 35.9 bits (79), Expect = 1.3 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGG GG G G GG G G G F G GGG Sbjct: 179 GGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGGKGGG 220 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXV 553 G GGGG G G GGG G G G GGGGG V Sbjct: 204 GSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGGGGMVEV 248 Score = 35.5 bits (78), Expect = 1.7 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGG-GGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXG 592 GGGG GG G G GGGG GG G G GGG V G Sbjct: 63 GGGGFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGG 122 Query: 593 GGG 601 GGG Sbjct: 123 GGG 125 Score = 35.5 bits (78), Expect = 1.7 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GGG G GGGGG G A GGGG G Sbjct: 166 GGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSG 206 Score = 35.5 bits (78), Expect = 1.7 Identities = 26/68 (38%), Positives = 26/68 (38%), Gaps = 4/68 (5%) Frame = +2 Query: 410 FXGGGGGG-GXXGXXGXG---GGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPP 577 F GGGGGG G G G G GGG G G G GGGGG Sbjct: 169 FGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGGKGGGFGAGGVMG 228 Query: 578 PPXXGGGG 601 GGGG Sbjct: 229 GGAGGGGG 236 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 F GGGGGG G GG GGG G G GGGGG Sbjct: 87 FGGGGGGGLGGGGCEGGGFGGGVGGGSGAGG-----GLGGGGGG 125 Score = 34.3 bits (75), Expect = 4.0 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 F GG GGG G GGGGGG G G GGGGG Sbjct: 105 FGGGVGGGSGAGGGLGGGGGGGFGGGSGGG--------VGGGGG 140 Score = 33.5 bits (73), Expect = 7.0 Identities = 24/63 (38%), Positives = 24/63 (38%), Gaps = 3/63 (4%) Frame = +2 Query: 422 GGGGGXXGXXGX-GGGGGGXXXXXGXGXFXXFPXXXGG--GGGXXXVXXXXXPPPPPXXG 592 GGGGG G G GGGGGG G G GG GGG G Sbjct: 62 GGGGGFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGG 121 Query: 593 GGG 601 GGG Sbjct: 122 GGG 124 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG GG G GGGGGG G GGGG G Sbjct: 63 GGGGFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGG 103 Score = 33.5 bits (73), Expect = 7.0 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 421 GGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGA 543 GGGGG GGGGG G G GGG GA Sbjct: 75 GGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGA 115 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 410 FXGGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 F GGGG GG G G GGG G G G Sbjct: 211 FGGGGGKGGGFGAGGVMGGGAGGGGGLGGG 240 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G GG GG GGG G G G GG G A GGGG G Sbjct: 159 GGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGG 214 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 679 GGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 GG G G G GGGGG G A GGGG G Sbjct: 200 GGGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGG 240 >UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; Magnoliophyta|Rep: Extensin-like protein precursor - Zea mays (Maize) Length = 1188 Score = 56.0 bits (129), Expect = 1e-06 Identities = 38/109 (34%), Positives = 38/109 (34%), Gaps = 13/109 (11%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPP---PPXXGGGGXXCXXXXXPPPPPPXXXPGPP---PPXP 676 P G V PPP PP G PPPP P P PP PP P Sbjct: 526 PAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASPPPPVKSPPPP 585 Query: 677 PXXGG----XXXPXAPXXXAXPPPP---PXPPXPXAGPPXPAAPXXXPP 802 P P A PPPP P PP P A PP PA PP Sbjct: 586 TLVASPPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPP 634 Score = 54.4 bits (125), Expect = 4e-06 Identities = 31/85 (36%), Positives = 32/85 (37%), Gaps = 8/85 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP---PPPPXXXPGPPPPX--PPXXGGXXXPXAPXXXAXPPP 736 PPPP PP PPPP PPPP PP P P A PP Sbjct: 575 PPPPVKSPPPPTLVASPPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPP 634 Query: 737 P---PXPPXPXAGPPXPAAPXXXPP 802 P P PP P + PP P PP Sbjct: 635 PMKSPPPPTPVSSPPPPEKSPPPPP 659 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPP---PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP PP PPPP P P PP PP P P PP P Sbjct: 1022 PPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAP 1081 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P P P AP PP Sbjct: 1082 VSSPPPPVKSPPPPAPVSSPP 1102 Score = 52.8 bits (121), Expect = 1e-05 Identities = 28/81 (34%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPP---PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP PP PPPP P P PP PP P P PP P Sbjct: 1038 PPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSPPPPAP 1097 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P P P P AP PP Sbjct: 1098 VSSPPPPIKSPPPPAPVSSPP 1118 Score = 52.4 bits (120), Expect = 1e-05 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPPP P P PP PP P P PP P Sbjct: 996 PPPAPM---SSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSS 1052 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P AP PP Sbjct: 1053 PPPPVKSPPPPAPISSPP 1070 Score = 51.6 bits (118), Expect = 2e-05 Identities = 30/86 (34%), Positives = 32/86 (37%), Gaps = 9/86 (10%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP-----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPP PP PPPP P PP P P P + PPP Sbjct: 1044 PPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPP 1103 Query: 737 P---PXPPXPXAG-PPXPAAPXXXPP 802 P P PP P + PP P P PP Sbjct: 1104 PIKSPPPPAPVSSPPPAPVKPPSLPP 1129 Score = 50.0 bits (114), Expect = 8e-05 Identities = 28/84 (33%), Positives = 30/84 (35%), Gaps = 8/84 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP-----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPP PP PPPP P PP P P P + PPP Sbjct: 1012 PPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPP 1071 Query: 737 P---PXPPXPXAGPPXPAAPXXXP 799 P P PP P + PP P P Sbjct: 1072 PVKSPPPPAPVSSPPPPVKSPPPP 1095 Score = 49.6 bits (113), Expect = 1e-04 Identities = 28/84 (33%), Positives = 30/84 (35%), Gaps = 8/84 (9%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP-----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPP PP PPPP P PP P P P + PPP Sbjct: 1028 PPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPP 1087 Query: 737 P---PXPPXPXAGPPXPAAPXXXP 799 P P PP P + PP P P Sbjct: 1088 PVKSPPPPAPVSSPPPPIKSPPPP 1111 Score = 48.4 bits (110), Expect = 2e-04 Identities = 24/60 (40%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPX--PPXPXAGPPXPAAPXXXPP 802 PPP P P P P P P P + PPP P PP P PP PA P PP Sbjct: 980 PPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPA-PVSSPP 1038 Score = 46.8 bits (106), Expect = 7e-04 Identities = 22/60 (36%), Positives = 24/60 (40%), Gaps = 3/60 (5%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP---PXPPXPXAGPPXPAAPXXXP 799 PPP P P P P P P P + PPPP P PP P + PP P P Sbjct: 988 PPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPP 1047 Score = 46.8 bits (106), Expect = 7e-04 Identities = 30/86 (34%), Positives = 31/86 (36%), Gaps = 8/86 (9%) Frame = +2 Query: 569 PPP---PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP-- 733 PPP PP PPPP P P PP PP P P PP Sbjct: 1054 PPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPIKSPPPPAP 1113 Query: 734 ---PPPXPPXPXAGPPXPAAPXXXPP 802 PPP P P + PP PA PP Sbjct: 1114 VSSPPPAPVKPPSLPP-PAPVSSPPP 1138 Score = 45.6 bits (103), Expect = 0.002 Identities = 28/84 (33%), Positives = 28/84 (33%), Gaps = 8/84 (9%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPP----PPXXXPGPPPPX---PPXXGGXXXPXAPXXXAXPP 733 PPP PP P PP PPPP PP P P PP Sbjct: 972 PPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPP 1031 Query: 734 PP-PXPPXPXAGPPXPAAPXXXPP 802 P PP P PP PA PP Sbjct: 1032 APVSSPPPPVKSPPPPAPVSSPPP 1055 Score = 45.2 bits (102), Expect = 0.002 Identities = 27/81 (33%), Positives = 28/81 (34%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPP---PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP PP PPPP P P PP P P P + PPPP Sbjct: 592 PPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPP 651 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP P A PP Sbjct: 652 EKSP-----PPPPPAKSTPPP 667 Score = 44.4 bits (100), Expect = 0.004 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPP P PPP P P PP P AP P P P Sbjct: 948 PPPAPV---SSPPATPKSSPPPAPVNLPPPEVKSSPPPTPVSSPPPAPKSSPPPAPMSSP 1004 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P AP PP Sbjct: 1005 PPPEVKSPPPPAPVSSPP 1022 Score = 44.0 bits (99), Expect = 0.005 Identities = 30/86 (34%), Positives = 30/86 (34%), Gaps = 10/86 (11%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPP-----PPXXXPGPPPPXP--PXXGGXXXPXAPXXXAXP 730 PPPP PPPP PP PPPP P P P A P Sbjct: 516 PPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASP 575 Query: 731 PPP-PXPPXP--XAGPPXPAAPXXXP 799 PPP PP P A PP P P Sbjct: 576 PPPVKSPPPPTLVASPPPPVKSPPPP 601 Score = 43.2 bits (97), Expect = 0.009 Identities = 23/62 (37%), Positives = 23/62 (37%), Gaps = 5/62 (8%) Frame = +2 Query: 629 PPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPPP---PXPPXPXAGPPXPAAPXX 793 PP P P PP PP G P P PPPP P PP P PP P Sbjct: 508 PPQAPVGSPPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPP 567 Query: 794 XP 799 P Sbjct: 568 PP 569 Score = 42.7 bits (96), Expect = 0.011 Identities = 26/76 (34%), Positives = 27/76 (35%), Gaps = 3/76 (3%) Frame = +2 Query: 569 PPP---PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP PP PPPP P P PP PP P P PP Sbjct: 1070 PPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPIKSPPPPAPVSSP--PPAPVKPPSL 1127 Query: 740 PXPPXPXAGPPXPAAP 787 P PP P + PP P Sbjct: 1128 P-PPAPVSSPPPVVTP 1142 Score = 42.3 bits (95), Expect = 0.015 Identities = 25/78 (32%), Positives = 26/78 (33%), Gaps = 1/78 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP-PXP 748 PPPP PPPP P PP PP P P PPPP Sbjct: 607 PPPPVKSPPPPT--PVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPAKST 664 Query: 749 PXPXAGPPXPAAPXXXPP 802 P P P P + PP Sbjct: 665 PPPEEYPTPPTSVKSSPP 682 Score = 41.9 bits (94), Expect = 0.020 Identities = 26/83 (31%), Positives = 27/83 (32%), Gaps = 6/83 (7%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP-----PPPPXXXPGPPPPXPPXXGGXXXPXAP-XXXAXPP 733 PPPP PP PPPP P PPPP P P + PP Sbjct: 623 PPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPP 682 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 P P P P P PP Sbjct: 683 PEKSLPPPTLIPSPPPQEKPTPP 705 Score = 40.7 bits (91), Expect = 0.046 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPPPPPXXXP----GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPPP P G P P PP P P PP P P P P P AP Sbjct: 516 PPPPVKTTSPPAPIGSPSPPPPV--SVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVA 573 Query: 794 XPP 802 PP Sbjct: 574 SPP 576 Score = 40.3 bits (90), Expect = 0.061 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP PPP P P + PPP P Sbjct: 639 PPPPTPVSSPPP--PEKSPPPPPPAKST-PPPEEYPTPPTSVKSSPPPEKSLPPPTLIPS 695 Query: 752 XPXAGPPXPAAPXXXPP 802 P P P + PP Sbjct: 696 PPPQEKPTPPSTPSKPP 712 Score = 39.9 bits (89), Expect = 0.081 Identities = 30/90 (33%), Positives = 30/90 (33%), Gaps = 12/90 (13%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXX--PP----PPPPXXXPGPPPPX---PPXXGGXXXPXAPXXX 721 PP PP G PP PPP PP PP P AP Sbjct: 472 PPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVGSPPPPVKTTSPPAPIGS 531 Query: 722 AXPPPP---PXPPXPXAGPPXPAAPXXXPP 802 PPPP PP P PP PA PP Sbjct: 532 PSPPPPVSVVSPPPPVKSPPPPAPVGSPPP 561 Score = 39.5 bits (88), Expect = 0.11 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP T PPPP P P PP P P P PPPP Sbjct: 607 PPPPVKS-----PPPPTPVASPPPPAPVA---SSPPPMKSPPPPTPVSSPPPPEKSPPPP 658 Query: 420 PP 415 PP Sbjct: 659 PP 660 Score = 39.5 bits (88), Expect = 0.11 Identities = 27/85 (31%), Positives = 29/85 (34%), Gaps = 9/85 (10%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPP---PPXXXPGPPPPXP---PXXGGXXXPXAPXXXAXPPP 736 PPP PP P PP PPP P P P P + PPP Sbjct: 932 PPPVVVSSPPPTVKSSPPPAPVSSPPATPKSSPPPAPVNLPPPEVKSSPP-PTPVSSPPP 990 Query: 737 PPX---PPXPXAGPPXPAAPXXXPP 802 P PP P + PP P PP Sbjct: 991 APKSSPPPAPMSSPPPPEVKSPPPP 1015 Score = 39.5 bits (88), Expect = 0.11 Identities = 27/77 (35%), Positives = 28/77 (36%), Gaps = 8/77 (10%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP---PPPPXXXPGPPPPX---PPXXGGXXXPXAPXXX-AXP 730 PPPP PP PPPP PPPP PP P AP + P Sbjct: 1069 PPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPIKSPPPPAPVSSPPPAPVKPPSLP 1128 Query: 731 PPPP-XPPXPXAGPPXP 778 PP P P P P P Sbjct: 1129 PPAPVSSPPPVVTPAPP 1145 Score = 38.7 bits (86), Expect = 0.19 Identities = 24/82 (29%), Positives = 26/82 (31%), Gaps = 4/82 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPP----PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPP PPP PPP PPPP P P + PPP Sbjct: 614 PPPPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSP------PPPPPAKSTPPP 667 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 P P + P PP Sbjct: 668 EEYPTPPTSVKSSPPPEKSLPP 689 Score = 38.7 bits (86), Expect = 0.19 Identities = 26/81 (32%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPP---PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPP 739 PPP PP PPPP P P P P PP P AP P Sbjct: 1086 PPPVKSPPPPAPVSSPPPPIKSPPPPAPVSSPPPAPVKPP----SLPPPAPVSSPPPVVT 1141 Query: 740 PXPPXPXAGPPXPAAPXXXPP 802 P PP P A PP Sbjct: 1142 PAPPKKEEQSLPPPAESQPPP 1162 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP P P P PP P P P P PP P AP PP Sbjct: 704 PPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPVSSPP 762 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP---PXPXXPXX 436 K PPPP PP P K P P PPPP P P P Sbjct: 1010 KSPPPPAPVSS--PPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPIS 1067 Query: 435 PPPPP 421 PPPP Sbjct: 1068 SPPPP 1072 Score = 37.1 bits (82), Expect = 0.57 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP---PXPXXPXX 436 K PPPP PP P K P P PPPP P P P Sbjct: 1026 KSPPPPAPVSS--PPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAPVS 1083 Query: 435 PPPPP 421 PPPP Sbjct: 1084 SPPPP 1088 Score = 36.7 bits (81), Expect = 0.75 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +2 Query: 581 PXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPX 760 P GGG P P P PP P P P P PP Sbjct: 410 PTPGGGPPSSPVPGKPAASAPMPSPHTPPDVSPEPLPEPSPVPAPAPMPMPTPHSPPADD 469 Query: 761 AGPPXPAAPXXXPP 802 PP P P PP Sbjct: 470 YVPPTPPVPGKSPP 483 Score = 36.7 bits (81), Expect = 0.75 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPP---PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXX 436 K PP G + PPPP P P P PP P P P Sbjct: 521 KTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASPPPPVK 580 Query: 435 PPPPP 421 PPPP Sbjct: 581 SPPPP 585 Score = 36.7 bits (81), Expect = 0.75 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 8/72 (11%) Frame = -2 Query: 606 KXPPPPXXGGGG-----GXXXXXTXXXPPPP---PXXXGXXXKXPXPXXXXXPPPPPPXP 451 K PPPP G PPPP P P P PP P P Sbjct: 548 KSPPPPAPVGSPPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPPPVKSPPPPAPVASP 607 Query: 450 XXPXXPPPPPPP 415 P PPPP P Sbjct: 608 PPPVKSPPPPTP 619 Score = 36.7 bits (81), Expect = 0.75 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 5/82 (6%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP---PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-- 736 PPPP PP P PP PPP P P PP Sbjct: 648 PPPPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIPSPPPQEKPTPPST 707 Query: 737 PPXPPXPXAGPPXPAAPXXXPP 802 P PP P P P PP Sbjct: 708 PSKPPSSPEKPSPPKEPVSSPP 729 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 4/63 (6%) Frame = +2 Query: 626 PPP----PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXX 793 PPP PPP P PPP P P P P P PP P P P Sbjct: 681 PPPEKSLPPPTLIPSPPPQEKPTP-----PSTPSKPPSSPEKPSPPKEPVSSP-PQTPKS 734 Query: 794 XPP 802 PP Sbjct: 735 SPP 737 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP + P P P P PP P P P PPPP Sbjct: 1004 PPPPEVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPVKSPPPP 1063 Query: 420 PP 415 P Sbjct: 1064 AP 1065 Score = 36.7 bits (81), Expect = 0.75 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP---PXPXXPXX 436 K PPPP PP P K P P PPPP P P P Sbjct: 1042 KSPPPPAPVSS--PPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSPPPPAPVS 1099 Query: 435 PPPPP 421 PPPP Sbjct: 1100 SPPPP 1104 Score = 36.3 bits (80), Expect = 1.00 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPP PPP P P P PP P AP P PP Sbjct: 776 PPPAPQVKSSPPPVQVSSPPPAPKSSPPLAPVSSPPQVEKTSPPPAPLSSPPLAPKSSPP 835 Query: 752 XPXAGPPXPAAPXXXPP 802 P P PP Sbjct: 836 HVVVSSPPPVVKSSPPP 852 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPP---PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P P PP P P P PPPP P Sbjct: 1053 PPPPVKSPPPPAPISSPPPPVKSPPPPAPVSSPPPPVKSPPPPAP 1097 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP---PXPXXPXX 436 K PPPP PP P K P P PPPP P P P Sbjct: 1058 KSPPPPAPISS--PPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPIKSPPPPAPVS 1115 Query: 435 PPPPPP 418 PPP P Sbjct: 1116 SPPPAP 1121 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPP---PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P P PP P P P PPPP P Sbjct: 1069 PPPPVKSPPPPAPVSSPPPPVKSPPPPAPVSSPPPPIKSPPPPAP 1113 Score = 35.9 bits (79), Expect = 1.3 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 629 PPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P PPP P PP P PP P + P P P P P P PP Sbjct: 694 PSPPPQEKPTPPSTPSKPPSSPEKPSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPP 753 Score = 35.9 bits (79), Expect = 1.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = -2 Query: 540 PPPP---PXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P P PP P P P PPPP P Sbjct: 1037 PPPPVKSPPPPAPVSSPPPPVKSPPPPAPISSPPPPVKSPPPPAP 1081 Score = 35.5 bits (78), Expect = 1.7 Identities = 22/79 (27%), Positives = 24/79 (30%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PP P G PP P P P P P A PP P Sbjct: 416 PPSSPVPGKPAASAPMPSPHTPPDVSPEPLPEPSPVPAPAPMPMPTPHSPPADDYVPPTP 475 Query: 749 PXPXAGPPXPA-APXXXPP 802 P P PP + +P PP Sbjct: 476 PVPGKSPPATSPSPQVQPP 494 Score = 35.1 bits (77), Expect = 2.3 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 629 PPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P P P PP PP G +P PP PP P AP PP Sbjct: 458 PMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLSPPQAPVGSPP 517 Score = 35.1 bits (77), Expect = 2.3 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 6/69 (8%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP---PXXXXXXXTP 431 PPPP G PP K P P PPPP P +P Sbjct: 516 PPPPVKTTSPPAPIGSPSPPPPVSVVSPPPPVKSPPPPAPVGSPPPPEKSPPPPAPVASP 575 Query: 430 PPP---PPP 413 PPP PPP Sbjct: 576 PPPVKSPPP 584 Score = 35.1 bits (77), Expect = 2.3 Identities = 23/69 (33%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP---PXXXXXXXTP 431 PPPP G PP P K P P PPPP P +P Sbjct: 550 PPPPAPVGS--PPPPEKSPPPPAPVASPPPPVKSPPPPTLVASPPPPVKSPPPPAPVASP 607 Query: 430 PPP---PPP 413 PPP PPP Sbjct: 608 PPPVKSPPP 616 Score = 35.1 bits (77), Expect = 2.3 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXX--KXPXPXXXXXPPPPPPXPXXPXXP 433 K PPPP PPP P P P PPPP P P Sbjct: 580 KSPPPPTLVAS---PPPPVKSPPPPAPVASPPPPVKSPPPPTPVASPPPPAPVASSPPPM 636 Query: 432 PPPPPP 415 PPPP Sbjct: 637 KSPPPP 642 Score = 34.7 bits (76), Expect = 3.0 Identities = 25/69 (36%), Positives = 27/69 (39%), Gaps = 10/69 (14%) Frame = +2 Query: 626 PPPP---PPXXXPGPPPPX----PPXXGGXXXPXAPXXXAXPPP---PPXPPXPXAGPPX 775 PP P PP P PP PP P AP + PPP PP P + PP Sbjct: 745 PPTPVSSPPALAPVSSPPSVKSSPPPAPLSSPPPAPQVKSSPPPVQVSSPPPAPKSSPPL 804 Query: 776 PAAPXXXPP 802 AP PP Sbjct: 805 --APVSSPP 811 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = -2 Query: 540 PPPPPXXXGXXX--KXPXPXXXXXPPPPPP--XPXXPXXPPPPPPP 415 PPP P P P PPPP P P P PPPP P Sbjct: 988 PPPAPKSSPPPAPMSSPPPPEVKSPPPPAPVSSPPPPVKSPPPPAP 1033 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 K PPPP PP P P PPPPP P P Sbjct: 612 KSPPPPTPVASPPPPAPVASSPPPMKSPPPPTPVSSPPPPEKSPPPPPPAKSTPPPEEYP 671 Query: 426 PPP 418 PP Sbjct: 672 TPP 674 Score = 33.9 bits (74), Expect = 5.3 Identities = 26/88 (29%), Positives = 28/88 (31%), Gaps = 11/88 (12%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP----- 736 P PP PPP P P P PP P P + PPP Sbjct: 718 PSPPKEPVSSPPQTPKSSPPPAPVSSPPPTPVSSPPALAPVSSP--PSVKSSPPPAPLSS 775 Query: 737 -PPXPPXPXAGPP-----XPAAPXXXPP 802 PP P + PP P AP PP Sbjct: 776 PPPAPQVKSSPPPVQVSSPPPAPKSSPP 803 Score = 33.5 bits (73), Expect = 7.0 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP-----PPPXPXXP 442 K PPPP PPP P P P PPP PPP P P Sbjct: 1074 KSPPPPAPVSS---PPPPVKSPPPPAPV------SSPPPPIKSPPPPAPVSSPPPAPVKP 1124 Query: 441 XXPPPPPP 418 PPP P Sbjct: 1125 PSLPPPAP 1132 Score = 33.1 bits (72), Expect = 9.3 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 4/67 (5%) Frame = +2 Query: 629 PPPPPXXXPGP-PPPXPPXXGGXXXPXAPXXXAXPP---PPPXPPXPXAGPPXPAAPXXX 796 P P P P P P P P P P PP P P P A P P+ Sbjct: 448 PSPVPAPAPMPMPTPHSPPADDYVPPTPPVPGKSPPATSPSPQVQPPAASTPPPSLVKLS 507 Query: 797 PPXXGXG 817 PP G Sbjct: 508 PPQAPVG 514 Score = 33.1 bits (72), Expect = 9.3 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = -2 Query: 606 KXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP 427 K PPPP PPPP + P P PPP P P Sbjct: 637 KSPPPPTPVSS--PPPPEKSPPPPPPAKSTPPPEEYPTPPTSVKSSPPPEKSLPPPTLIP 694 Query: 426 PPPP 415 PPP Sbjct: 695 SPPP 698 Score = 33.1 bits (72), Expect = 9.3 Identities = 25/70 (35%), Positives = 27/70 (38%), Gaps = 11/70 (15%) Frame = +2 Query: 626 PPP-----PPPXXXPGPPPPX---PPXXGGXXXPXAPXXXAXPPPP---PXPPXPXAGPP 772 PPP PPP PPP PP P P + PPP PP P + PP Sbjct: 900 PPPTPVSLPPPIVKSSPPPAMVSSPPMTPKSSPP--PVVVSSPPPTVKSSPPPAPVSSPP 957 Query: 773 XPAAPXXXPP 802 A P PP Sbjct: 958 --ATPKSSPP 965 >UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 786 Score = 56.0 bits (129), Expect = 1e-06 Identities = 28/77 (36%), Positives = 31/77 (40%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP PPPPPP P PPPP P + PPP P PP Sbjct: 446 PPPP--SSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPP 503 Query: 752 XPXAGPPXPAAPXXXPP 802 + PP P +P PP Sbjct: 504 YIYSSPP-PPSPSPPPP 519 Score = 44.0 bits (99), Expect = 0.005 Identities = 30/87 (34%), Positives = 31/87 (35%), Gaps = 9/87 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP---GPPPPXP---PXXGGXXXPXA---PXXX 721 PPPPP PPPPP P PPPP P P P P Sbjct: 607 PPPPPVY-----YTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVT 661 Query: 722 AXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP P P P +P PP Sbjct: 662 QSPPPPPVYYLPVTQSPPPPSPVYYPP 688 Score = 41.1 bits (92), Expect = 0.035 Identities = 27/80 (33%), Positives = 29/80 (36%), Gaps = 7/80 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP----PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP P PPPP P PP P PP P +P PPP Sbjct: 463 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP----SPPP 518 Query: 737 P---PXPPXPXAGPPXPAAP 787 P PP PP +P Sbjct: 519 PYIYSSPPPVVNCPPTTQSP 538 Score = 40.7 bits (91), Expect = 0.046 Identities = 28/80 (35%), Positives = 29/80 (36%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPPP PPPPPP P PP PP P + PPPPP Sbjct: 578 PPPPPPP-----TYYAVQSPPPPPPVYYPPVTASPPPPPVY------YTPVIQS-PPPPP 625 Query: 743 XPPXPXAGPPXPAAPXXXPP 802 P P P P PP Sbjct: 626 VYYSPVTQSPPPPPPVYYPP 645 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 5/51 (9%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXP-----PPPPPXPXXPXXPPPPPPP 415 T PPPPP P P P PPPPP P PPPPP Sbjct: 575 TQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 625 Score = 39.9 bits (89), Expect = 0.081 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 6/65 (9%) Frame = +2 Query: 626 PPPPPPXXXPGP----PPPXPPXXGGXXXPXAPXXXAXP-PPPPXPPXPXA-GPPXPAAP 787 PPPP P P P P PP P P A PPPP PP A P P P Sbjct: 538 PPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPP 597 Query: 788 XXXPP 802 PP Sbjct: 598 VYYPP 602 Score = 39.5 bits (88), Expect = 0.11 Identities = 24/70 (34%), Positives = 25/70 (35%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP P PPPP PPPP P P P + PPP Sbjct: 488 PPPPPLS---------PPPPSPPPPYIYSSPPPPSP-------SPPPPYIYSSPPPVVNC 531 Query: 749 PXPXAGPPXP 778 P PP P Sbjct: 532 PPTTQSPPPP 541 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 PPPP PPPP PP P P PP PP P Sbjct: 567 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPP 610 Score = 39.1 bits (87), Expect = 0.14 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP-----PPPPPXPXXPXX 436 PPPP T PPPPP + P P P PPPPP P Sbjct: 621 PPPPPV-----YYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVT 675 Query: 435 PPPPPP 418 PPPP Sbjct: 676 QSPPPP 681 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP + P PPPP P P PPPP P Sbjct: 473 PPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 514 Score = 38.7 bits (86), Expect = 0.19 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPPP P P PPPP P P P PPP Sbjct: 488 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 527 Score = 38.3 bits (85), Expect = 0.25 Identities = 24/76 (31%), Positives = 25/76 (32%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP P PP PPPP P P A PPP PP Sbjct: 538 PPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPP 597 Query: 752 XPXAGPPXPAAPXXXP 799 PP A+P P Sbjct: 598 --VYYPPVTASPPPPP 611 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXX----PPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPPP P PPPPP Sbjct: 567 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 611 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/65 (33%), Positives = 24/65 (36%), Gaps = 6/65 (9%) Frame = +2 Query: 626 PPPPPPXXXP---GPPPPXP---PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP 787 PPPPP P PPPP P P P +P P PP PA+P Sbjct: 664 PPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASP 723 Query: 788 XXXPP 802 PP Sbjct: 724 NQSPP 728 Score = 36.7 bits (81), Expect = 0.75 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P PP P PPPPPP PPPPPP Sbjct: 556 PSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPP 597 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXP-----PPPPXXXXXXXTPPPPPPP 413 PPPPP P P P PPPP PPPPPP Sbjct: 593 PPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 640 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXX--PPPPPXXXXXXXTPPPPPPP 413 PPPP + P P PPPPP T PPPPP Sbjct: 567 PPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 611 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXX------PPPPPPXPXXPXXPPPPPPP 415 PPPPP + P P PPPPPP P PPP P Sbjct: 607 PPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSP 654 Score = 36.3 bits (80), Expect = 1.00 Identities = 25/78 (32%), Positives = 25/78 (32%), Gaps = 8/78 (10%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP----GPPPPXP----PXXGGXXXPXAPXXXA 724 PPPPP PPPP P P PPPP P P P P Sbjct: 664 PPPPPVY-----YLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYH 718 Query: 725 XPPPPPXPPXPXAGPPXP 778 P P P P P P Sbjct: 719 PPASPNQSPPPEYQSPPP 736 Score = 34.7 bits (76), Expect = 3.0 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 6/69 (8%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXG------EXXKXPXXPXXXXXPPPPPXXXXXX 440 PPPP PPP E P P PPP Sbjct: 516 PPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYAT 575 Query: 439 XTPPPPPPP 413 +PPPPPPP Sbjct: 576 QSPPPPPPP 584 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXX----PXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP E P P PPPPP +PPPP PP Sbjct: 461 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPL------SPPPPSPP 501 Score = 34.3 bits (75), Expect = 4.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P P P P PPPP PP Sbjct: 461 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPP 501 Score = 34.3 bits (75), Expect = 4.0 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXX-----PXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPPP + P P PPPPP PPPP P Sbjct: 636 PPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSP 683 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = -2 Query: 552 TXXXPPPPPXXXGXXXKXPXPXXXXXPP----PPPPXP-XXPXXPPPPPPP 415 T PPPP P P PP PPPP P P PPPP Sbjct: 661 TQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPP 711 Score = 33.9 bits (74), Expect = 5.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 P PP P PPPPP PPPPPP Sbjct: 556 PSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPP 597 >UniRef50_Q58MY1 Cluster: Phage tail fiber-like protein; n=1; Cyanophage P-SSM2|Rep: Phage tail fiber-like protein - Cyanophage P-SSM2 Length = 597 Score = 56.0 bits (129), Expect = 1e-06 Identities = 44/143 (30%), Positives = 44/143 (30%), Gaps = 7/143 (4%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 GG G G G G GG G G P G G P G Sbjct: 214 GGPGPTGPAGPPGPAGGPPGPQGPQGDAG-PTGPTGPPGTGSPGPAGPPGPSGGPGPTGP 272 Query: 596 GGXXCXXXXXPPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPX-PPXPX--- 760 G P P PGPP P PP G P P PP P PP P Sbjct: 273 AGPTGPDGPTGPTGPAGGPPGPPGPSGPPGPSGGDGPAGPSGSPGPPGPSGGPPGPSGGP 332 Query: 761 --AGPPXPAAPXXXPPXXGXGGA 823 AGPP P P P G GA Sbjct: 333 GPAGPPGPDGPSGPPGPAGSAGA 355 Score = 55.2 bits (127), Expect = 2e-06 Identities = 43/142 (30%), Positives = 44/142 (30%), Gaps = 7/142 (4%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPP--PPXX 589 G GG G G G G GG G P G G P P PP Sbjct: 211 GPSGGPGPTGPAGPPGPAGGPPGPQG-------PQGDAGPTGPTGPPGTGSPGPAGPPGP 263 Query: 590 GGGGXXCXXXXXPPPPPPXXXPGPP--PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA 763 GG P P GP PP PP G P A P P PP P Sbjct: 264 SGGPGPTGPAGPTGPDGPTGPTGPAGGPPGPPGPSGPPGPSGGDGPAGPSGSPGPPGPSG 323 Query: 764 GPPXPA---APXXXPPXXGXGG 820 GPP P+ P P G G Sbjct: 324 GPPGPSGGPGPAGPPGPDGPSG 345 Score = 54.4 bits (125), Expect = 4e-06 Identities = 50/189 (26%), Positives = 50/189 (26%), Gaps = 3/189 (1%) Frame = -2 Query: 750 GGXGGGGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXG--GGGGGXXXXXXKXPPPPXXG 580 GG G G G G PP G GGG GP G G GG PP P G Sbjct: 171 GGPTGPAGPPGPTGITGPSGPPGPSGPGGGPGPAGPQGDVGPSGGPGPTGPAGPPGPA-G 229 Query: 579 GGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXX 400 G G P P G P P P P P P P P Sbjct: 230 GPPGPQGPQGDAGPTGPTGPPGTGSPGPAGPPGPSGGPGPTGPAGPTGPDGPTGPTGPAG 289 Query: 399 XXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPXPGXXXXGXXPPPPXXXXPPRXPXTP 220 G G P PG PP P P P P Sbjct: 290 GPPGPPGPSGPPGPS---------GGDGPAGPSGSPGPPGPSGGPPGPSGGPGPAGPPGP 340 Query: 219 XXPGGPGXP 193 P GP P Sbjct: 341 DGPSGPPGP 349 Score = 52.0 bits (119), Expect = 2e-05 Identities = 45/156 (28%), Positives = 46/156 (29%), Gaps = 2/156 (1%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G G GP+ G G G G G G P G G GP G Sbjct: 194 PSGPGGGPGPAGPQGDVGPSGGPGPTGPAGPPGPAGGPPGPQGP--QGDAGPTGPTGPPG 251 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPP 460 G G PP GG G P P G P P PP P Sbjct: 252 TGSPGPAG-------PPGPSGGPGPTGPAGPTGPDGPTGPTGPAGGPPGPPGPSGPPGPS 304 Query: 459 --PXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P P P PP P GG G PP Sbjct: 305 GGDGPAGPSGSPGPPGPSGGPPGP--SGGPGPAGPP 338 Score = 51.6 bits (118), Expect = 2e-05 Identities = 50/186 (26%), Positives = 51/186 (27%), Gaps = 5/186 (2%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXX 373 G GPPG G+ G G G GG P P GG Sbjct: 175 GPAGPPGPTGITGPSGPPGPSGPGGG-PGPAGPQGDVGPSGGPGPTGPAGPPGPAGGPPG 233 Query: 374 PPPPXPXXXXXXFXG--GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXX 547 P P G G G G G G GG G G P G G Sbjct: 234 PQGPQGDAGPTGPTGPPGTGSPGPAGPPGPSGGPGPTGPAGPTGPDG--PTGPTGPAGGP 291 Query: 548 XVXXXXXPPPPPXXGGGGXXCXXXXXPPPP---PPXXXPGPPPPXPPXXGGXXXPXAPXX 718 PP P G G PP P PP GP P PP G P P Sbjct: 292 PGPPGPSGPPGPSGGDGPAGPSGSPGPPGPSGGPPGPSGGPGPAGPPGPDGPSGPPGPAG 351 Query: 719 XAXPPP 736 A P Sbjct: 352 SAGAIP 357 Score = 50.8 bits (116), Expect = 4e-05 Identities = 40/141 (28%), Positives = 40/141 (28%), Gaps = 6/141 (4%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P P G G GPA G GG G G G P G G GP G Sbjct: 203 PAGPQGDVGPSGGPGPTGPAGPPGPAGGPPGPQGPQGDAGPTGPTGPPGTGSPGPAGPPG 262 Query: 639 GGGG----GXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXK--XPXPXXXX 478 GG G P G GG PP P G P P Sbjct: 263 PSGGPGPTGPAGPTGPDGPTGPTGPAGGPPGPPGPSGPPGPSGGDGPAGPSGSPGPPGPS 322 Query: 477 XPPPPPPXPXXPXXPPPPPPP 415 PP P P PP P P Sbjct: 323 GGPPGPSGGPGPAGPPGPDGP 343 Score = 50.4 bits (115), Expect = 6e-05 Identities = 43/139 (30%), Positives = 44/139 (31%), Gaps = 10/139 (7%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXG--------AXGXXXPPXX-GGXGGGG 658 P G G AG GPA G G G G A G + G PP GG G G Sbjct: 212 PSGGPGPTGPAGPPGPAGGPPGPQGPQGDAGPTGPTGPPGTGSPGPAGPPGPSGGPGPTG 271 Query: 657 PGXXXGGGGGGXXXXXXKXPP-PPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXX 481 P G G PP PP G G P P G P P Sbjct: 272 PAGPTGPDGPTGPTGPAGGPPGPPGPSGPPGPSGGDGPAGPSGSPGPPGPSGGPPGPSGG 331 Query: 480 XXPPPPPPXPXXPXXPPPP 424 P PP P P PP P Sbjct: 332 PG-PAGPPGPDGPSGPPGP 349 Score = 46.0 bits (104), Expect = 0.001 Identities = 40/131 (30%), Positives = 40/131 (30%), Gaps = 4/131 (3%) Frame = +2 Query: 422 GGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGG 601 G GGG G G G G G P GGG G P P G Sbjct: 168 GNGGGPTGPAGPPGPTGITGPSGPPG-----PSGPGGGPGPAGPQGDVGPSGGPGPTGPA 222 Query: 602 XXCXXXXXPPPPP-PXXXPGPP-PPXPPXXG--GXXXPXAPXXXAXPPPPPXPPXPXAGP 769 PP P P GP P PP G G P P P P P P GP Sbjct: 223 GPPGPAGGPPGPQGPQGDAGPTGPTGPPGTGSPGPAGPPGPSGGPGPTGPAGPTGPD-GP 281 Query: 770 PXPAAPXXXPP 802 P P PP Sbjct: 282 TGPTGPAGGPP 292 Score = 45.2 bits (102), Expect = 0.002 Identities = 30/103 (29%), Positives = 32/103 (31%), Gaps = 1/103 (0%) Frame = +2 Query: 515 PXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGX 694 P G G + PP P GGG P GP P P GG Sbjct: 173 PTGPAGPPGPTGITGPSGPPGPSGPGGGPGPAGPQGDVGPSGGPGPTGPAGP-PGPAGGP 231 Query: 695 XXPXAPXXXAXPPPPPXPPXPXA-GPPXPAAPXXXPPXXGXGG 820 P P A P P PP + GP P P P G G Sbjct: 232 PGPQGPQGDAGPTGPTGPPGTGSPGPAGPPGPSGGPGPTGPAG 274 Score = 41.1 bits (92), Expect = 0.035 Identities = 27/86 (31%), Positives = 27/86 (31%), Gaps = 3/86 (3%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXP---PXXGGXGGGGPGX 649 P P G G GPA G G G G G G P P G GG PG Sbjct: 269 PTGPAGPTGPDGPTGPTGPAGGPPGPPGPSGPPGPSGGDGPAGPSGSPGPPGPSGGPPGP 328 Query: 648 XXGGGGGGXXXXXXKXPPPPXXGGGG 571 G G G PP G G Sbjct: 329 SGGPGPAGPPGPDGPSGPPGPAGSAG 354 Score = 38.3 bits (85), Expect = 0.25 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = -2 Query: 819 PPXPXXG---GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGP 655 PP P G G+ G GP+ G G GG G A G G PP G G P Sbjct: 300 PPGPSGGDGPAGPSGSPGPPGPSGGPPGPSGGPGPAGPPGPDGPSGPPGPAGSAGAIP 357 Score = 35.5 bits (78), Expect = 1.7 Identities = 30/108 (27%), Positives = 30/108 (27%), Gaps = 1/108 (0%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXG 640 P P G G GPA G G G G G P G GG GP Sbjct: 255 PGPAGPPGPSGGPGPTGPAGPTGPDGPTGPTGPAGGPPGPPGPSGPPGPSGGDGP----- 309 Query: 639 GGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXP 496 G G PP GG G P PP G P Sbjct: 310 AGPSGSPGPPGPSGGPPGPSGGPGPAGPPGPDGPSGPPGPAGSAGAIP 357 >UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_73, whole genome shotgun sequence - Paramecium tetraurelia Length = 442 Score = 56.0 bits (129), Expect = 1e-06 Identities = 28/60 (46%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 626 PPPPPPXXXP-GPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPPP P G PPP PP G P A + PP PP PP P + PP P PP Sbjct: 77 PPPPPPPPPPKGAPPPPPPRPPG---PPAAKPTSNPPNPP-PPKPASQPPPPPVQNLPPP 132 Score = 55.2 bits (127), Expect = 2e-06 Identities = 30/82 (36%), Positives = 30/82 (36%), Gaps = 10/82 (12%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPP----------PPPPXXXPGPPPPXPPXXGGXXXPXAPXX 718 PPPPP G PP PPPP PPPP PP P P Sbjct: 90 PPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQQ 149 Query: 719 XAXPPPPPXPPXPXAGPPXPAA 784 PPPPP P PP P A Sbjct: 150 NVMPPPPPPPQQNVMPPPPPPA 171 Score = 52.8 bits (121), Expect = 1e-05 Identities = 31/85 (36%), Positives = 31/85 (36%), Gaps = 7/85 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPP-------PPXPPXXGGXXXPXAPXXXAX 727 PPPPP G PPPPP PGPP PP PP P P Sbjct: 80 PPPPPPPKGA----------PPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNL 129 Query: 728 PPPPPXPPXPXAGPPXPAAPXXXPP 802 PPPPP P PP PP Sbjct: 130 PPPPPPPQQNVLPPPPKPQQNVMPP 154 Score = 52.0 bits (119), Expect = 2e-05 Identities = 26/78 (33%), Positives = 26/78 (33%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPPP G PP PP PP PP P P PPPPP Sbjct: 78 PPPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPPPPPQ 137 Query: 749 PXPXAGPPXPAAPXXXPP 802 PP P PP Sbjct: 138 QNVLPPPPKPQQNVMPPP 155 Score = 49.6 bits (113), Expect = 1e-04 Identities = 23/60 (38%), Positives = 23/60 (38%) Frame = -2 Query: 597 PPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPP 418 PPP PPPPP P P PPPPPP P PPPPPP Sbjct: 112 PPPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPP-PQQNVMPPPPPP 170 Score = 49.2 bits (112), Expect = 1e-04 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP PPPPPP PPPP P P P PPPPP P Sbjct: 112 PPPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPPPQQNVMPPPPP-P 170 Query: 749 PXPXAGPPXPAAP 787 A P AP Sbjct: 171 AQQQAQAPSFQAP 183 Score = 44.8 bits (101), Expect = 0.003 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 9/71 (12%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPP---------PPPPXPX 448 PPPP G T P PPP P P PP PPPP P Sbjct: 90 PPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPP-PVQNLPPPPPPPQQNVLPPPPKPQ 148 Query: 447 XPXXPPPPPPP 415 PPPPPPP Sbjct: 149 QNVMPPPPPPP 159 Score = 43.2 bits (97), Expect = 0.009 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPP 421 PPPP G P PP P P PPPPP P PPPPP Sbjct: 78 PPPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLP--PPPPP 135 Query: 420 P 418 P Sbjct: 136 P 136 Score = 42.7 bits (96), Expect = 0.011 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 PP PP PP P P A PPPPP PP P A P P PP Sbjct: 62 PPNTKVIVNKAAPPPPP----PPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPPP 115 Score = 42.3 bits (95), Expect = 0.015 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPP 422 P PP PPPPP P P PPPPP PPPP Sbjct: 110 PNPPPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQQNVMPPPPPPPQQNVM-PPPP 168 Query: 421 PPPE 410 PP + Sbjct: 169 PPAQ 172 Score = 41.9 bits (94), Expect = 0.020 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -3 Query: 539 PPPPPXXXGXXXKXXXPXXXPXPPPPPXXLXXXXNPPPPPPP 414 PPPPP K P P PP PP NPP PPPP Sbjct: 75 PPPPPPPPPPPPKGAPPPPPPRPPGPPAA-KPTSNPPNPPPP 115 Score = 41.1 bits (92), Expect = 0.035 Identities = 23/73 (31%), Positives = 25/73 (34%), Gaps = 6/73 (8%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPP------PPXXXGEXXKXPXXPXXXXXPPPPPXXX 449 A PPPP G PPP PP + P P PPPP Sbjct: 89 APPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPPKPQ 148 Query: 448 XXXXTPPPPPPPE 410 PPPPPP + Sbjct: 149 QNVMPPPPPPPQQ 161 Score = 39.9 bits (89), Expect = 0.081 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = -1 Query: 601 PPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPP---PXXXXXXXTP 431 PPPP G PPPPP G P PP P P P Sbjct: 74 PPPPPPPPPPPPPKGAP---PPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLP 130 Query: 430 PPPPPPE 410 PPPPPP+ Sbjct: 131 PPPPPPQ 137 Score = 37.9 bits (84), Expect = 0.33 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 2/80 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP P P PP P P PPP P Sbjct: 31 PPPPTNSADFQAKLAMLNQQEPGPAQTQQNAPPNTKVIVNKAAPPPPPPPPPPPPPKGAP 90 Query: 749 PXPXAGPPXP--AAPXXXPP 802 P P PP P A P PP Sbjct: 91 PPPPPRPPGPPAAKPTSNPP 110 Score = 37.1 bits (82), Expect = 0.57 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 531 PPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PP K P PPPPPP P PP PP P Sbjct: 62 PPNTKVIVNKAAPPPPPPPPPPPPPKGAPPPPPPRPPGP 100 Score = 36.3 bits (80), Expect = 1.00 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +3 Query: 609 AXXPXXP---PPPPPXXXPXPPPXXPPXXGGXXXXXXPPGXP 725 A P P PPPPP P PPP PP PP P Sbjct: 72 AAPPPPPPPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPP 113 Score = 36.3 bits (80), Expect = 1.00 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 6/62 (9%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXA---XXPXXPPPPPPXXXPXPPP---XXPPXXGGXXXXXXPPG 719 P PPPP G A P PPPP P P PPP PP PP Sbjct: 86 PKGAPPPPPPRPPGPPAAKPTSNPPNPPPPKPASQPPPPPVQNLPPPPPPPQQNVLPPPP 145 Query: 720 XP 725 P Sbjct: 146 KP 147 Score = 33.5 bits (73), Expect = 7.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 558 PXXXPPPPXXXGGGGXXAXXPXXPPPPPPXXXPXPPPXXPP 680 P PPPP G P PP PP PP PP Sbjct: 74 PPPPPPPPPPPPPKGAPPPPPPRPPGPPAAKPTSNPPNPPP 114 >UniRef50_Q16630 Cluster: Cleavage and polyadenylation specificity factor subunit 6; n=26; Euteleostomi|Rep: Cleavage and polyadenylation specificity factor subunit 6 - Homo sapiens (Human) Length = 551 Score = 56.0 bits (129), Expect = 1e-06 Identities = 32/83 (38%), Positives = 32/83 (38%), Gaps = 1/83 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPP 751 PPPP G G PPP PP GPPPP P P P PPP P Sbjct: 296 PPPPVPGYG---------PPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP 346 Query: 752 XPXAGPPXP-AAPXXXPPXXGXG 817 P A PP P P PP G Sbjct: 347 PPGAPPPAPHVNPAFFPPPTNSG 369 Score = 55.6 bits (128), Expect = 2e-06 Identities = 43/131 (32%), Positives = 43/131 (32%), Gaps = 6/131 (4%) Frame = +2 Query: 443 GXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGXXCXXXX 622 G G GG G FP GG PPPP G Sbjct: 184 GKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAG---------- 233 Query: 623 XPPPPPPXXXPGPP-PPXPPXXGGXXXP--XAPXXXAXPPPPP--XPPXPXAGPP-XPAA 784 PP PP PGPP PP PP G P P PPPP P P PP P Sbjct: 234 QTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLP 293 Query: 785 PXXXPPXXGXG 817 P PP G G Sbjct: 294 PGPPPPVPGYG 304 Score = 54.8 bits (126), Expect = 3e-06 Identities = 46/149 (30%), Positives = 46/149 (30%), Gaps = 16/149 (10%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGG 598 G GG GG G G G FP G GG PP PP G Sbjct: 187 GPPGGSSRAAFPQGGRGRGRFPGAVPGG-DRFPGPAGPGGPPPPFPAGQTPPRPPLGPPG 245 Query: 599 -----GXXCXXXXXPPP-----------PPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXP 730 G PPP PPP PG P PP G P P Sbjct: 246 PPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPL--GPLPPGPPPPVPGY 303 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPPXXGXG 817 PPP PP P GPP P P P G Sbjct: 304 GPPPGPPPPQQGPPPPPGPFPPRPPGPLG 332 Score = 54.4 bits (125), Expect = 4e-06 Identities = 32/81 (39%), Positives = 32/81 (39%), Gaps = 3/81 (3%) Frame = +2 Query: 569 PPPPPXXGGG--GXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPP 742 PPPP G G P PPPP GPPP PP G P P PP P Sbjct: 273 PPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGP-FPPRPPGPL 331 Query: 743 XPPXPXAGPP-XPAAPXXXPP 802 PP A PP P P PP Sbjct: 332 GPPLTLAPPPHLPGPPPGAPP 352 Score = 47.6 bits (108), Expect = 4e-04 Identities = 39/133 (29%), Positives = 40/133 (30%), Gaps = 5/133 (3%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGG-----GGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 G GA G G G GG G G PP G G PG Sbjct: 205 GRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPPLGPPGPP--GPPGPPPPGQVLPPP 262 Query: 633 GGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPX 454 G + PPPP G PP PP P P PPPPP Sbjct: 263 LAGPPNRGDR-PPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPG 321 Query: 453 PXXPXXPPPPPPP 415 P P P P PP Sbjct: 322 PFPPRPPGPLGPP 334 Score = 47.2 bits (107), Expect = 5e-04 Identities = 41/158 (25%), Positives = 42/158 (26%), Gaps = 4/158 (2%) Frame = -2 Query: 654 GXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX 475 G G G G + P G G P P G P P Sbjct: 178 GQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPP-PFPAGQTP 236 Query: 474 PPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPPXFFF----LXXXXXXXXXXXX 307 P PP P P P PPPP G G PP F Sbjct: 237 PRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGP 296 Query: 306 XXPXPGXXXXGXXPPPPXXXXPPRXPXTPXXPGGPGXP 193 P PG PPP PP P P PG G P Sbjct: 297 PPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPP 334 Score = 41.5 bits (93), Expect = 0.026 Identities = 23/61 (37%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXP-XPXXXXXPPPPPPXPXXPXXPPPP 424 PPPP G G PPPPP P P PPP P P P PPP Sbjct: 296 PPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGP-PPGAPPPA 354 Query: 423 P 421 P Sbjct: 355 P 355 Score = 39.5 bits (88), Expect = 0.11 Identities = 38/132 (28%), Positives = 39/132 (29%), Gaps = 1/132 (0%) Frame = -2 Query: 750 GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPXXGGGG 571 G GG A G G P G PG G GG + PP P G G Sbjct: 187 GPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPG-PAGPGGPPPPFPAGQTPPRPPLGPPG 245 Query: 570 GXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPP-PPPPXXXXXXX 394 PPPP P P PPPP P P PP P P Sbjct: 246 ----PPGPPGPPPPGQVLPPPLAGP-PNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPV 300 Query: 393 XGXGGGGXXXPP 358 G G PP Sbjct: 301 PGYGPPPGPPPP 312 Score = 34.7 bits (76), Expect = 3.0 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = -1 Query: 619 GXXAXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXX 440 G PPPP G PPPPP P P PPP Sbjct: 290 GPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPP-----HLP 344 Query: 439 XTPPPPPPP 413 PP PPP Sbjct: 345 GPPPGAPPP 353 Score = 34.3 bits (75), Expect = 4.0 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 5/67 (7%) Frame = +3 Query: 540 GXXXXXPXXXPPPPXXXGGGGXXAXXPXX--PPPPPPXXXPXPP-PXXPP--XXGGXXXX 704 G P PPP G G P PPPPP P PP P PP Sbjct: 285 GQPPLGPLPPGPPPPVPGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLP 344 Query: 705 XXPPGXP 725 PPG P Sbjct: 345 GPPPGAP 351 >UniRef50_UPI0000F1DE0A Cluster: PREDICTED: hypothetical protein; n=5; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 136 Score = 55.6 bits (128), Expect = 2e-06 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = +2 Query: 626 PPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPP 802 P P PP PP P PP AP A PPP P PP P PP PA P P Sbjct: 29 PAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAPAVP 87 Score = 50.4 bits (115), Expect = 6e-05 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 2/59 (3%) Frame = +2 Query: 632 PPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPA--APXXXPP 802 P P PP P PP AP A PPP P PP P PP PA AP PP Sbjct: 19 PASPAPAVPPPAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAPAVPPP 77 Score = 42.7 bits (96), Expect = 0.011 Identities = 22/61 (36%), Positives = 22/61 (36%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPX 754 PPP PP P P P PP P P AP A PPP P PP Sbjct: 27 PPPAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAP---AVPPPAPAPPA 83 Query: 755 P 757 P Sbjct: 84 P 84 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P P P PPP P P PP P PP Sbjct: 29 PAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAPAVPPPAPAPP 70 Score = 35.9 bits (79), Expect = 1.3 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 P P P P P PPP P P PP P PP Sbjct: 41 PAPAPPAPAVPPPAPAPPAPAVPPPAPAPPAPAVPPPAPAPP 82 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P P PPP P P PPP P Sbjct: 27 PPPAPAPPAPAVPPPAPAPPA-PAVPPPAPAPPAPAVPPPAP 67 Score = 34.3 bits (75), Expect = 4.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPP P P P P PPP P P PPP P Sbjct: 39 PPPAPAPPAPAVPPPAPAPPA-PAVPPPAPAPPAPAVPPPAP 79 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 55.6 bits (128), Expect = 2e-06 Identities = 28/64 (43%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXP-PXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAP--XXXP 799 PP P GP PP P P G P P A PPPP PP P GPP P P P Sbjct: 533 PPLVPGPPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVP 592 Query: 800 PXXG 811 P G Sbjct: 593 PPPG 596 Score = 54.0 bits (124), Expect = 5e-06 Identities = 27/63 (42%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPPPPP-PXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXP 748 PPPP C PPPPP P PPPP PP GG P P PPPP P Sbjct: 545 PPPPLP------CFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPPGAP 598 Query: 749 PXP 757 P Sbjct: 599 IGP 601 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/63 (39%), Positives = 25/63 (39%) Frame = +2 Query: 629 PPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAAPXXXPPXX 808 PPPP G PP PP G P P PPPPP P P PP P PP Sbjct: 545 PPPPLPCFAGLAPPPPPLPGAMMPPPPP-----PPPPPGGPPPPGRPPVSGVP--PPPGA 597 Query: 809 GXG 817 G Sbjct: 598 PIG 600 Score = 43.6 bits (98), Expect = 0.007 Identities = 22/60 (36%), Positives = 22/60 (36%) Frame = -2 Query: 537 PPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXPP 358 P PP G P P PPPPP P PPPPPPP G PP Sbjct: 537 PGPPG--GPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPP 594 Score = 43.6 bits (98), Expect = 0.007 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 540 PPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P P PPPPP P P PPPP P Sbjct: 545 PPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRP 586 Score = 41.9 bits (94), Expect = 0.020 Identities = 28/83 (33%), Positives = 28/83 (33%) Frame = -2 Query: 663 GGPGXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXX 484 GGP G GG PPPP G PPPPP P P Sbjct: 531 GGPPLVPGPPGG-------PLPPPPLPCFAG--------LAPPPPPLPGAMMPPPPPPPP 575 Query: 483 XXXPPPPPPXPXXPXXPPPPPPP 415 PPPP P PPPP P Sbjct: 576 PPGGPPPPGRPPVSGVPPPPGAP 598 Score = 41.1 bits (92), Expect = 0.035 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +2 Query: 653 PGPPPPXP-PXXGGXXXPXAPXXXAX-PPPPPXPPXPXAGPPXPAAPXXXPPXXG 811 PG PP P P G P P PPPPP P PP P P PP G Sbjct: 530 PGGPPLVPGPPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPG 584 Score = 40.3 bits (90), Expect = 0.061 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 4/58 (6%) Frame = +2 Query: 626 PPPPPPXXX--PGPPPPXPPXXGGXXXPXAPXXXAXP--PPPPXPPXPXAGPPXPAAP 787 PPPP P PPPP P G P P P PPPP P PP P AP Sbjct: 545 PPPPLPCFAGLAPPPPPLP----GAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPPGAP 598 Score = 39.5 bits (88), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 541 PPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PP P G P P PPPP PPPPPPP Sbjct: 533 PPLVPGPPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPPPP 575 Score = 37.9 bits (84), Expect = 0.33 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -1 Query: 538 PPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 PPPP G P P PPPP PPPP P Sbjct: 557 PPPPPLPGAMMPPPPPPPPPPGGPPPPGRPPVSGVPPPPGAP 598 Score = 37.9 bits (84), Expect = 0.33 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPP-XPPXXGGXXXPXAP 712 PPPPP G PPPPP GPPPP PP G P AP Sbjct: 557 PPPPPLPGA---MMPPPPPPPPPP----GGPPPPGRPPVSGVPPPPGAP 598 Score = 37.1 bits (82), Expect = 0.57 Identities = 24/66 (36%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = +3 Query: 534 GGGXXXXXPXXXP-PPPXXXGGGGXXAXXPXXP----PPPPPXXXPXPPPXXPPXXGGXX 698 GG P P PPP G P P PPPPP P PPP PP G Sbjct: 531 GGPPLVPGPPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPP---PPPPPGGPPPPGRPP 587 Query: 699 XXXXPP 716 PP Sbjct: 588 VSGVPP 593 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 580 GGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXTPPPPPPP 413 GG G PPPP P P PPPP PPPP P Sbjct: 531 GGPPLVPGPPGGPLPPPPLPCFAGLAPPPPPLPGAMMPPPPPPPPPPGGPPPPGRP 586 >UniRef50_Q3W0R6 Cluster: Collagen, type III, alpha 1; n=1; Frankia sp. EAN1pec|Rep: Collagen, type III, alpha 1 - Frankia sp. EAN1pec Length = 467 Score = 55.6 bits (128), Expect = 2e-06 Identities = 39/124 (31%), Positives = 40/124 (32%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GG G G GG G G P G G PP P G Sbjct: 207 GQGGHPGHPGAAATGGPPGSVGQSPADGVQPGGPGWTPGQDGEHLDTAGAGEPPAPGRTG 266 Query: 596 GGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPX 775 PPP P PG PPP P GG P AP A P P PP P + P Sbjct: 267 R-IAGYPLAAPPPDSPSGPPGYPPPERPAPGG---PAAPTPEASGGPVPSPPAPGSSVPG 322 Query: 776 PAAP 787 P Sbjct: 323 SQVP 326 Score = 43.6 bits (98), Expect = 0.007 Identities = 39/138 (28%), Positives = 39/138 (28%), Gaps = 5/138 (3%) Frame = -2 Query: 816 PXPXXGGXXXGAAGX----GGPAX-GXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPG 652 P P G G G G PA G GG G G A G G G GGPG Sbjct: 182 PGPYGGPGYPGVPGQTTPPGYPAPPGQGGHPGHPGAAATGGPPGSVGQSPADGVQPGGPG 241 Query: 651 XXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP 472 G G PP P G G PPP P P Sbjct: 242 WTPGQDGEHLDTAGAGEPPAP---GRTGRIAGYPLAAPPPDSPSGPPGYPPPERPAPGGP 298 Query: 471 PPPPPXPXXPXXPPPPPP 418 P P P PP P Sbjct: 299 AAPTPEASGGPVPSPPAP 316 Score = 37.1 bits (82), Expect = 0.57 Identities = 42/158 (26%), Positives = 42/158 (26%), Gaps = 7/158 (4%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGG--GXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P G G G P G GG G G G PP GG G GG Sbjct: 164 PGQWGVQPGPHGVQ-PGEHPGPYGGPGYPGVPGQTTPPGYPAPPGQGGHPGHPGAAATGG 222 Query: 636 GGGGXXXXXXKXPPPPXXG---GGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP 466 G P G G G PP P G P P Sbjct: 223 PPGSVGQSPADGVQPGGPGWTPGQDGEHLDTAGAGEPPAPGRTGRIAGYPLAA------P 276 Query: 465 PPPXPXXPXXPPPP--PPPXXXXXXXXGXGGGGXXXPP 358 PP P P PPP P P GG PP Sbjct: 277 PPDSPSGPPGYPPPERPAPGGPAAPTPEASGGPVPSPP 314 Score = 33.5 bits (73), Expect = 7.0 Identities = 33/135 (24%), Positives = 33/135 (24%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 APP GAA GGP G G G G G G Sbjct: 204 APPGQGGHPGHPGAAATGGP---PGSVGQSPADGVQPGGPGWTPGQDGEHLDTAGAGEPP 260 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 G G PPP G PP P G P P PP Sbjct: 261 APGRTGRIAGYPLAAPPPDSPSG------PPGYPPPERPAPGGPAAPTPEASGGPVPSPP 314 Query: 462 PPXPXXPXXPPPPPP 418 P P P P Sbjct: 315 APGSSVPGSQVPGSP 329 >UniRef50_A4TD05 Cluster: Putative uncharacterized protein precursor; n=2; Mycobacterium|Rep: Putative uncharacterized protein precursor - Mycobacterium gilvum PYR-GCK Length = 1259 Score = 55.6 bits (128), Expect = 2e-06 Identities = 60/222 (27%), Positives = 62/222 (27%), Gaps = 12/222 (5%) Frame = -2 Query: 822 APPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXX 643 AP G GAA PA G GG GG GG + G G P G GG P Sbjct: 250 APVFGEAGAAPSGAAAPVAPAAGSGGAGGAGGGSGIGGPGGGGAP--VEGTGGAVPAGAP 307 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPP 463 GG PPP G PPP P PPP Sbjct: 308 LAAAGGEV-------PPPAPPIPGAPVIGEAGVVPPPAPPAPA---PPAGGLGGAVPPPV 357 Query: 462 PPXPXXPXXPP----PPPPPXXXXXXXXGXGGGGXXXPPXFFFLXXXXXXXXXXXXXXPX 295 P P P PP P G GG P + Sbjct: 358 PGAPGVPVVDEAGVVTPPAPGGPGVPTGGEGGVVTPPAPGAPGVPVVDEAGVVTPPAPGG 417 Query: 294 PGXXXXG----XXPPPPXXXXPP----RXPXTPXXPGGPGXP 193 PG G PP P P TP PGGPG P Sbjct: 418 PGVPTGGEGGVVTPPAPGAPGAPVVDEAGVVTPPAPGGPGVP 459 Score = 55.6 bits (128), Expect = 2e-06 Identities = 43/137 (31%), Positives = 43/137 (31%), Gaps = 13/137 (9%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G GG GG G G GG GGG G G GG PPP P G Sbjct: 272 GSGGAGGAGGGSGIGGPGGGGAPVEGTGGAVPAGAPLAAAGG-------EVPPPAPPIPG 324 Query: 596 GGXXCXXXXXPPPPPPXXXPGPP------PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 PPP PP P PP PP G P PP P P Sbjct: 325 APVIGEAGVVPPPAPP--APAPPAGGLGGAVPPPVPGAPGVPVVDEAGVVTPPAPGGPGV 382 Query: 758 XAG-------PPXPAAP 787 G PP P AP Sbjct: 383 PTGGEGGVVTPPAPGAP 399 Score = 45.6 bits (103), Expect = 0.002 Identities = 30/93 (32%), Positives = 30/93 (32%), Gaps = 8/93 (8%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP------GPPPPXPPXXGGXXXPXAPXXXAXP 730 PP PP G PP PP P G PP PP G Sbjct: 108 PPVPPSPGTPASTSTRGGTPPVPPAPPAPAGTPASGATPPAPPVPGVPAVTSTGGGTPPV 167 Query: 731 PPPPXPPX--PXAGPPXPAAPXXXPPXXGXGGA 823 PP P P P A P P P P G GGA Sbjct: 168 PPVPGAPVGAPVANPGLPTPPVPGAPVFGDGGA 200 Score = 45.6 bits (103), Expect = 0.002 Identities = 34/120 (28%), Positives = 34/120 (28%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG AG GG G GG GG G GA G P G G GG GG Sbjct: 860 GGGSVAGAGAGG---GAGGAAGGAGVEGASGAVGAAGGPGAGAAPAAAGGAAPGGAPGGP 916 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP 442 P G PP P G P PP P P P Sbjct: 917 VAGGGPVGGPGALPAPGAPIVGEAGVVSPPAPGVPGGAAAVP---AGAVTPPAPGVPGAP 973 Score = 42.7 bits (96), Expect = 0.011 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 4/85 (4%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP----XXXAXPPP 736 PP PP G PP PP P P P P AP PP Sbjct: 146 PPAPPVPGVPAVTSTGGGTPPVPPVPGAPVGAPVANPGLPTPPVPGAPVFGDGGAVLPPL 205 Query: 737 PPXPPXPXAGPPXPAAPXXXPPXXG 811 PP P P GP AP P G Sbjct: 206 PPAPAGPAGGPAGLVAPPAPPVPGG 230 Score = 40.7 bits (91), Expect = 0.046 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 10/94 (10%) Frame = +2 Query: 572 PPPPXXGGGGXXCXXXXXPP-PPPPXXXPGPP-----PPXPPXXGGXXXPXAPXXXAXPP 733 P PP G PP PP P G P PP PP GG P A PP Sbjct: 185 PTPPVPGAPVFGDGGAVLPPLPPAPAGPAGGPAGLVAPPAPPVPGGPAA--VPAGVALPP 242 Query: 734 PPPXPPXP----XAGPPXPAAPXXXPPXXGXGGA 823 PP P AG A P G GGA Sbjct: 243 APPGAPGAPVFGEAGAAPSGAAAPVAPAAGSGGA 276 Score = 40.7 bits (91), Expect = 0.046 Identities = 39/135 (28%), Positives = 39/135 (28%), Gaps = 12/135 (8%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXG-XGXFXXFPXXXGGGGGXXXVXXXXXPP---PPPX 586 G GGG G GGG GG G G G G G P P Sbjct: 857 GVTGGGSVAGAGAGGGAGGAAGGAGVEGASGAVGAAGGPGAGAAPAAAGGAAPGGAPGGP 916 Query: 587 XGGGGXXCXXXXXPPPPPPXXXPG--PPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPX 760 GGG P P P PP P GG P PP P P P Sbjct: 917 VAGGGPVGGPGALPAPGAPIVGEAGVVSPPAPGVPGG--AAAVPAGAVTPPAPGVPGAPV 974 Query: 761 AG------PPXPAAP 787 G PP P P Sbjct: 975 FGEAGVVTPPAPGVP 989 Score = 39.5 bits (88), Expect = 0.11 Identities = 29/87 (33%), Positives = 29/87 (33%), Gaps = 6/87 (6%) Frame = +2 Query: 569 PPPPPXXGG--GGXXCXXXXXPPPPP--PXXXPGPP--PPXPPXXGGXXXPXAPXXXAXP 730 PP PP G G PP P P G PP PP G P P Sbjct: 165 PPVPPVPGAPVGAPVANPGLPTPPVPGAPVFGDGGAVLPPLPPAPAGPAG--GPAGLVAP 222 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPPXXG 811 P PP P P A P A P P G Sbjct: 223 PAPPVPGGPAAVPAGVALPPAPPGAPG 249 Score = 38.3 bits (85), Expect = 0.25 Identities = 27/90 (30%), Positives = 27/90 (30%), Gaps = 6/90 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXP------GPPPPXPPXXGGXXXPXAPXXXAXP 730 PP PP PP PP P G PP PP G AP Sbjct: 127 PPVPPAPPAPAGTPASGATPPAPPVPGVPAVTSTGGGTPPVPPVPGAPVG--APVANPGL 184 Query: 731 PPPPXPPXPXAGPPXPAAPXXXPPXXGXGG 820 P PP P P G P P G G Sbjct: 185 PTPPVPGAPVFGDGGAVLPPLPPAPAGPAG 214 Score = 37.1 bits (82), Expect = 0.57 Identities = 37/141 (26%), Positives = 37/141 (26%), Gaps = 6/141 (4%) Frame = -2 Query: 819 PPXPXXG--GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG--GGPG 652 PP P G G AA G P G GGG A G G G G G Sbjct: 831 PPAPVFGDAGAPVEAAAGGAPVEAAAGVTGGGSVAGAGAGGGAGGAAGGAGVEGASGAVG 890 Query: 651 XXXGGGGGGXXXXXXKXPPPPXXGG--GGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXX 478 G G G P GG GG P P G P Sbjct: 891 AAGGPGAGAAPAAAGGAAPGGAPGGPVAGGGPVGGPGALPAPGAPIVGEAG-VVSPPAPG 949 Query: 477 XPPPPPPXPXXPXXPPPPPPP 415 P P PP P P Sbjct: 950 VPGGAAAVPAGAVTPPAPGVP 970 Score = 36.7 bits (81), Expect = 0.75 Identities = 26/93 (27%), Positives = 27/93 (29%) Frame = +3 Query: 411 SGGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGGXXXXXPXXXPPPPXXX 590 +G GG GG G GGG G G GG P PP P Sbjct: 271 AGSGGAGGAGGGSGIGGPGGGGAPVEGTGGAVPAGAPLAAAGG----EVPPPAPPIPGAP 326 Query: 591 GGGGXXAXXPXXPPPPPPXXXPXPPPXXPPXXG 689 G P PP P P PP G Sbjct: 327 VIGEAGVVPPPAPPAPAPPAGGLGGAVPPPVPG 359 Score = 36.3 bits (80), Expect = 1.00 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +2 Query: 590 GGGGXXCXXXXXPPPPPPXXXPGP--PPPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXA 763 GGG P P G PPP PP G P PPP P P P A Sbjct: 290 GGGAPVEGTGGAVPAGAPLAAAGGEVPPPAPPIPGA---PVIGEAGVVPPPAPPAPAPPA 346 Query: 764 GPPXPAAPXXXPPXXG 811 G A P P G Sbjct: 347 GGLGGAVPPPVPGAPG 362 Score = 35.5 bits (78), Expect = 1.7 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +2 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPPPPXPPX 754 PP PP G PP PP G P + PP P P Sbjct: 78 PPASSSSSAGTPPVPGRPPASVVTPSSGATPPVPPSPG---TPASTSTRGGTPPVPPAPP 134 Query: 755 PXAGPPXPAAPXXXPPXXG 811 AG P A PP G Sbjct: 135 APAGTPASGATPPAPPVPG 153 Score = 35.5 bits (78), Expect = 1.7 Identities = 31/129 (24%), Positives = 31/129 (24%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G AAG G G GGG GA G GG G G GG Sbjct: 849 GAPVEAAAGVTGGGSVAGAGAGGGAGGAAGGAGVEGASGAVGAAGGPGAGAAPAAAGGAA 908 Query: 621 XXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXP 442 P GGG P P P P P P Sbjct: 909 PGGAPGGP----VAGGGPVGGPGALPAPGAPIVGEAGVVSPPAPGVPGGAAAVPAGAVTP 964 Query: 441 XXPPPPPPP 415 P P P Sbjct: 965 PAPGVPGAP 973 Score = 35.1 bits (77), Expect = 2.3 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +2 Query: 701 PXAPXXXAXPPP-PPXPPXPXAGP----PXPAAPXXXPPXXGXGGA 823 P A PPP PP P P G P PA P PP G GGA Sbjct: 307 PLAAAGGEVPPPAPPIPGAPVIGEAGVVPPPAPPAPAPPAGGLGGA 352 Score = 35.1 bits (77), Expect = 2.3 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 1/86 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXX-AXPPPPPX 745 PP P GG PP P P P AP A PP Sbjct: 983 PPAPGVPGGAAAVPAGVVTPPAPGVPGGAAAVPAGAVTPPAPGVPGAPVFGDAGVATPPV 1042 Query: 746 PPXPXAGPPXPAAPXXXPPXXGXGGA 823 P P G PAA P GGA Sbjct: 1043 PGVPGGGTTVPAASVTPPAPGVPGGA 1068 Score = 33.5 bits (73), Expect = 7.0 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 6/88 (6%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXXPGPPP------PXPPXXGGXXXPXAPXXXAXPPPP 739 PP G G PP PG P PP G P PP Sbjct: 754 PPAPGVPGAPAATEAGLATPPGPGAPGAPVVGDAGVATPPGPGVPGAPIVDEAGLATPPA 813 Query: 740 PXPPXPXAGPPXPAAPXXXPPXXGXGGA 823 P P AG P A P G GA Sbjct: 814 PVAPVEGAGGAVPPAGPPPAPVFGDAGA 841 Score = 33.5 bits (73), Expect = 7.0 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 5/85 (5%) Frame = +2 Query: 578 PPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAX---PP--PPP 742 PP G G PP PG P P AP A PP PPP Sbjct: 773 PPGPGAPGAPVVGDAGVATPPGPGVPGAPIVDEAGLATPPAPVAPVEGAGGAVPPAGPPP 832 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXG 817 P AG P AA P G Sbjct: 833 APVFGDAGAPVEAAAGGAPVEAAAG 857 Score = 33.5 bits (73), Expect = 7.0 Identities = 41/146 (28%), Positives = 41/146 (28%), Gaps = 11/146 (7%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGG-GGXXXXXGXGX------FXXFPXXXGGGGGXXXVXXXXXPP 574 GG GG G GGG GG G P G GG V P Sbjct: 905 GGAAPGGAPGGPVAGGGPVGGPGALPAPGAPIVGEAGVVSPPAPGVPGGAAAVPAGAVTP 964 Query: 575 PPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPP----PPP 742 P P G PP P PG P P P A P PP Sbjct: 965 PAPGVPGAPVFGEAGVVTPPAP--GVPGGAAAVPAGVVTPPAPGVPGGAAAVPAGAVTPP 1022 Query: 743 XPPXPXAGPPXPAAPXXXPPXXGXGG 820 P P A P A PP G G Sbjct: 1023 APGVPGA-PVFGDAGVATPPVPGVPG 1047 Score = 33.1 bits (72), Expect = 9.3 Identities = 41/160 (25%), Positives = 41/160 (25%), Gaps = 7/160 (4%) Frame = -2 Query: 819 PPXPXX-GGXXXGAAGX-GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGG---GGP 655 PP P G G AG PA G G G A G P GG G Sbjct: 964 PPAPGVPGAPVFGEAGVVTPPAPGVPG----GAAAVPAGVVTPPAPGVPGGAAAVPAGAV 1019 Query: 654 GXXXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXX 475 G G PP G GG PP P G P Sbjct: 1020 TPPAPGVPGAPVFGDAGVATPPVPGVPGGGTTVPAASVTPPAPGVPGGASTVPGNAGTPS 1079 Query: 474 PP--PPPPXPXXPXXPPPPPPPXXXXXXXXGXGGGGXXXP 361 P PP P PP PP G G P Sbjct: 1080 TPGLPPGSTDTYINYPAPPVPPTPPNSTGVSAGTPGSPAP 1119 >UniRef50_A0LQ52 Cluster: Putative uncharacterized protein; n=1; Syntrophobacter fumaroxidans MPOB|Rep: Putative uncharacterized protein - Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) Length = 335 Score = 55.6 bits (128), Expect = 2e-06 Identities = 29/64 (45%), Positives = 29/64 (45%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P G AG GGP GG GGGGG G G GG GGGG G GG Sbjct: 277 PGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGG------GGGGGGGGGGGGGG 330 Query: 636 GGGG 625 GGGG Sbjct: 331 GGGG 334 Score = 51.2 bits (117), Expect = 3e-05 Identities = 29/60 (48%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Frame = -2 Query: 798 GXXXGAAGXG-GPAXGXG-GXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G GA G G GP G G GG GG A G G GG GGGG G GGGGGG Sbjct: 271 GTGVGAPGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330 Score = 48.4 bits (110), Expect = 2e-04 Identities = 26/63 (41%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Frame = -2 Query: 810 PXXGGXXXGAA-GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG 634 P GG G G G G GG G G A G GG GGGG G GGG Sbjct: 263 PQVGGSRAGTGVGAPGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGG 322 Query: 633 GGG 625 GGG Sbjct: 323 GGG 325 Score = 41.9 bits (94), Expect = 0.020 Identities = 27/70 (38%), Positives = 27/70 (38%) Frame = -2 Query: 777 GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXP 598 G G G G G G GA G P GG GGG G GGGGGG Sbjct: 266 GGSRAGTGVGAPGSGHGPGGPSGA-GHGGP---GGSAGGGGGGGGGGGGGGGGGGGGGGG 321 Query: 597 PPPXXGGGGG 568 GGGGG Sbjct: 322 GGGGGGGGGG 331 Score = 40.7 bits (91), Expect = 0.046 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GG GG G G GGGGGG G G GGGGG Sbjct: 290 GHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 331 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGGGGG G G GGGGGG G G Sbjct: 305 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 332 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGGGGG G G GGGGGG G G Sbjct: 306 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 333 Score = 40.7 bits (91), Expect = 0.046 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXG 499 GGGGGGG G G GGGGGG G G Sbjct: 307 GGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 40.3 bits (90), Expect = 0.061 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -2 Query: 777 GXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXP 598 G GP G G G G G GG GG G GGGGGG Sbjct: 259 GARGPQVGGSRAGTGVGAPGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGG 318 Query: 597 PPPXXGGGGG 568 GGGGG Sbjct: 319 GGGGGGGGGG 328 Score = 39.9 bits (89), Expect = 0.081 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = -2 Query: 783 AAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXK 604 AA G GG G G G P G G GG GGGGGG Sbjct: 255 AADLGARGPQVGGSRAGTGVGAPGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGG 314 Query: 603 XPPPPXXGGGGG 568 GGGGG Sbjct: 315 GGGGGGGGGGGG 326 Score = 39.5 bits (88), Expect = 0.11 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +2 Query: 380 PPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 P P GG GGG G G GGGGGG G G GGGGG Sbjct: 283 PGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGG--GGGGGGGG 334 Score = 35.5 bits (78), Expect = 1.7 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGG 569 G P G P G GGG G GGGGGG G GGGG Sbjct: 284 GGPSGAG-HGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 334 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +1 Query: 406 SXXGGGGGGGXXXXXRXXGGGGGXGXXXGXXXFXXXPXXXGGGGGAXXR 552 S G GG GG GGGGG G G GGGGG R Sbjct: 287 SGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 335 Score = 34.3 bits (75), Expect = 4.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 724 GXPGGXXWXXXPPXXGGXXGGGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXG 557 G PG P G GG GGGGGG G GGGG G Sbjct: 275 GAPGSGHGPGGPSGAGHGGPGGSAGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 330 >UniRef50_Q9LY08 Cluster: Oleosin; n=13; Brassicaceae|Rep: Oleosin - Arabidopsis thaliana (Mouse-ear cress) Length = 244 Score = 55.6 bits (128), Expect = 2e-06 Identities = 27/65 (41%), Positives = 27/65 (41%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXG 640 P GG G A GGP GG GG GA G GG GGGPG G Sbjct: 134 PGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGGASG 193 Query: 639 GGGGG 625 GG GG Sbjct: 194 GGPGG 198 Score = 46.8 bits (106), Expect = 7e-04 Identities = 25/60 (41%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXG-GGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G GA+G G G G G GG GA G GG GGGPG GGG GG Sbjct: 131 GDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGPGG 190 Score = 45.2 bits (102), Expect = 0.002 Identities = 27/83 (32%), Positives = 28/83 (33%) Frame = -2 Query: 816 PXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGG 637 P GG GA+G G GG GG G G GG GGGPG GG Sbjct: 144 PGGASGGGPGGASG-GASGGASGGASGGASGGASGGGPGGASGGGPGGASGGGPGGASGG 202 Query: 636 GGGGXXXXXXKXPPPPXXGGGGG 568 G P GG G Sbjct: 203 ASGDKPEGAPGDKPGGAWGGKPG 225 Score = 42.7 bits (96), Expect = 0.011 Identities = 26/77 (33%), Positives = 27/77 (35%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G A GG G GG GG + GA G GG GG G GG GG Sbjct: 131 GDKPGGASGGGDKPGGASGGGPGGASG--GASGGASGGASGGASGGASGGGPGGASGGGP 188 Query: 618 XXXXKXPPPPXXGGGGG 568 P GG G Sbjct: 189 GGASGGGPGGASGGASG 205 Score = 41.1 bits (92), Expect = 0.035 Identities = 28/89 (31%), Positives = 31/89 (34%), Gaps = 4/89 (4%) Frame = -2 Query: 780 AGXGGPAXGX-GGXGGGG---GXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXX 613 +G GGP+ GG GGG G A G G G GG G G GGG Sbjct: 124 SGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGA 183 Query: 612 XXKXPPPPXXGGGGGXXXXXTXXXPPPPP 526 P GG GG + P P Sbjct: 184 SGGGPGGASGGGPGGASGGASGDKPEGAP 212 Score = 40.7 bits (91), Expect = 0.046 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G GA G G G GG G G GG GG G GG GG Sbjct: 121 GEMSGAGGPSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGP 180 Query: 618 XXXXKXPPPPXXGGGGG 568 P GGG G Sbjct: 181 GGASGGGPGGASGGGPG 197 Score = 40.7 bits (91), Expect = 0.046 Identities = 25/75 (33%), Positives = 26/75 (34%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG GA+G G G GG GGG G G G G PG GG GG Sbjct: 165 GGASGGASG-GASGGGPGGASGGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWGGK 223 Query: 621 XXXXXKXPPPPXXGG 577 P GG Sbjct: 224 PGKKPGHKPEGARGG 238 Score = 39.5 bits (88), Expect = 0.11 Identities = 25/81 (30%), Positives = 26/81 (32%) Frame = -2 Query: 810 PXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 P + G G G GG GA G P GG GGGPG GG Sbjct: 103 PTKADQPGASGGASGDKPGEMSGAGGPSGDKPGGASGGGDKP--GGASGGGPGGASGGAS 160 Query: 630 GGXXXXXXKXPPPPXXGGGGG 568 GG GGG G Sbjct: 161 GGASGGASGGASGGASGGGPG 181 >UniRef50_Q00ZC5 Cluster: Splicing factor 1/branch point binding protein; n=2; Ostreococcus|Rep: Splicing factor 1/branch point binding protein - Ostreococcus tauri Length = 586 Score = 55.6 bits (128), Expect = 2e-06 Identities = 30/79 (37%), Positives = 30/79 (37%), Gaps = 1/79 (1%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXAXPPP-PPX 745 PPPPP G PPPPP G PPP PP G P P PPP Sbjct: 476 PPPPPMMMPMGAPQTYISVPPPPPEDGTAGVPPP-PPEDGTAGVPPPPVMQVAPPPVVQV 534 Query: 746 PPXPXAGPPXPAAPXXXPP 802 PP P P P PP Sbjct: 535 PPPPVVQVPPPPVMNVPPP 553 Score = 41.9 bits (94), Expect = 0.020 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 5/83 (6%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPX-----PPXXGGXXXPXAPXXXAXPP 733 PPPPP G G PPPPP G PPP PP P P PP Sbjct: 495 PPPPPEDGTAGV-------PPPPPEDGTAGVPPPPVMQVAPPPV--VQVPPPPVVQVPPP 545 Query: 734 PPPXPPXPXAGPPXPAAPXXXPP 802 P P P P PP Sbjct: 546 PVMNVPPPPTDEPEEGELGDVPP 568 Score = 40.7 bits (91), Expect = 0.046 Identities = 22/74 (29%), Positives = 23/74 (31%) Frame = -2 Query: 636 GGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPP 457 G GG PPPP G + PPP G P PPPP Sbjct: 465 GAGGTMMRQAPPPPPPMMMPMGAPQTYISVPPPPPEDGTAGVPPPPPEDGTAGVPPPPVM 524 Query: 456 XPXXPXXPPPPPPP 415 P PPPP Sbjct: 525 QVAPPPVVQVPPPP 538 Score = 40.7 bits (91), Expect = 0.046 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 7/69 (10%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPP---PPPXPXXPXXPP 430 PPPP G G PPPP G P P PPP PP P PP Sbjct: 495 PPPPPEDGTAGV---------PPPPPEDGTAGVPPPPVMQVAPPPVVQVPPPPVVQVPPP 545 Query: 429 P----PPPP 415 P PPPP Sbjct: 546 PVMNVPPPP 554 Score = 38.7 bits (86), Expect = 0.19 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 5/66 (7%) Frame = -2 Query: 600 PPPPXXGGGGGXXXXXTXXXPPPP--PXXXGXXXKXPXPXXXXXPPPPPPXP---XXPXX 436 PPPP G G PPP + P P PPPP P Sbjct: 507 PPPPPEDGTAGVPPPPVMQVAPPPVVQVPPPPVVQVPPPPVMNVPPPPTDEPEEGELGDV 566 Query: 435 PPPPPP 418 PPPPPP Sbjct: 567 PPPPPP 572 Score = 37.9 bits (84), Expect = 0.33 Identities = 26/77 (33%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 569 PPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPP----PXPPXXGGXXXPXAPXXXAXPPP 736 PPPPP G G PPPP PPP P PP P P PPP Sbjct: 507 PPPPPEDGTAGV---------PPPPVMQVAPPPVVQVPPPPV---VQVPPPPVMNVPPPP 554 Query: 737 PPXPPXPXAGPPXPAAP 787 P G P P Sbjct: 555 TDEPEEGELGDVPPPPP 571 Score = 35.5 bits (78), Expect = 1.7 Identities = 21/70 (30%), Positives = 22/70 (31%), Gaps = 3/70 (4%) Frame = -1 Query: 610 AXXPPPPXXXGGGGXXXGXXXXXPPPPPXXXGEXXKXPXXPXXXXXPPPPPXXXXXXXT- 434 A PPPP G G PPP P PPPP Sbjct: 504 AGVPPPPPEDGTAGVPPPPVMQVAPPPVVQVPPPPVVQVPPPPVMNVPPPPTDEPEEGEL 563 Query: 433 --PPPPPPPE 410 PPPPPP+ Sbjct: 564 GDVPPPPPPD 573 Score = 34.7 bits (76), Expect = 3.0 Identities = 26/66 (39%), Positives = 26/66 (39%), Gaps = 7/66 (10%) Frame = +2 Query: 626 PPPPPPXXXP-GPP------PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXPXAGPPXPAA 784 PPPPPP P G P PP PP G A PPPP P AG P P Sbjct: 475 PPPPPPMMMPMGAPQTYISVPPPPPEDG----------TAGVPPPP-PEDGTAGVPPPPV 523 Query: 785 PXXXPP 802 PP Sbjct: 524 MQVAPP 529 >UniRef50_O65450 Cluster: Glycine-rich protein; n=1; Arabidopsis thaliana|Rep: Glycine-rich protein - Arabidopsis thaliana (Mouse-ear cress) Length = 396 Score = 55.6 bits (128), Expect = 2e-06 Identities = 30/61 (49%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGG---GGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGG 631 GG GAAG GG G GG GG GGG G G GG GGGG G GGGG Sbjct: 241 GGGVSGAAGGGGGGGGGGGSGGSKVGGGYGHGSGFGGGVGFGNSGGGGGGGGGGGGGGGG 300 Query: 630 G 628 G Sbjct: 301 G 301 Score = 54.4 bits (125), Expect = 4e-06 Identities = 29/78 (37%), Positives = 31/78 (39%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G +G GG G GG GGGGG G+ G G GG G GGG GG Sbjct: 277 GGVGFGNSGGGGGGGGGGGGGGGGGNGSGYGSGSGYGSGMGKGSGSGGGGGGGGGGSGGG 336 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGG G Sbjct: 337 NGSGSGSGEGYGMGGGAG 354 Score = 53.2 bits (122), Expect = 8e-06 Identities = 28/59 (47%), Positives = 28/59 (47%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G AG GG A G GG GGGGG GA G G GGG G GGGGGG Sbjct: 198 GSGAGAGAGVGGAAGGVGGGGGGGG-GEGGGANGGSGHGSGSGAGGGVSGAAGGGGGGG 255 Score = 50.8 bits (116), Expect = 4e-05 Identities = 29/81 (35%), Positives = 30/81 (37%), Gaps = 3/81 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGG---G 631 GG G G GG + G G G G G G G GG GGGG G GG G Sbjct: 139 GGGGGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGGGGGGGGGEGGGANGGSGHG 198 Query: 630 GGXXXXXXKXPPPPXXGGGGG 568 G GGGGG Sbjct: 199 SGAGAGAGVGGAAGGVGGGGG 219 Score = 50.0 bits (114), Expect = 8e-05 Identities = 29/79 (36%), Positives = 29/79 (36%), Gaps = 1/79 (1%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGX-GGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG G G GG G GG G G G G G GG GGGG G GG G Sbjct: 175 GGAGGGGGGGGGEGGGANGGSGHGSGAGAGAGVGGAAGGVGGGGGGGGGEGGGANGGSGH 234 Query: 624 XXXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 235 GSGSGAGGGVSGAAGGGGG 253 Score = 47.2 bits (107), Expect = 5e-04 Identities = 26/77 (33%), Positives = 27/77 (35%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G G A G GG GGG G G+ G GG G GGGGGG Sbjct: 165 GAGAGVGGSSGGAGGGGGGGGGEGGGANGGSGHGSGAGAGAGVGGAAGGVGGGGGGGGGE 224 Query: 618 XXXXKXPPPPXXGGGGG 568 G G G Sbjct: 225 GGGANGGSGHGSGSGAG 241 Score = 47.2 bits (107), Expect = 5e-04 Identities = 27/78 (34%), Positives = 28/78 (35%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G G G G + G GG GGGG G GGG G Sbjct: 212 GGVGGGGGGGGGEGGGANGGSGHGSGSGAGGGVSGAAGGGGGGGGGGGSGGSKVGGGYGH 271 Query: 621 XXXXXKXPPPPXXGGGGG 568 GGGGG Sbjct: 272 GSGFGGGVGFGNSGGGGG 289 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G G G GG GGGGG G G G G G GGGGGG Sbjct: 272 GSGFGGGVGFGNSGGGGGGGGGGGGGGGGGNGSGYGSGSGYGSGMGKGSGSGGGGGGGG 330 Score = 46.4 bits (105), Expect = 0.001 Identities = 29/80 (36%), Positives = 30/80 (37%), Gaps = 2/80 (2%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXG-GXGGG-GGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 GG G G GG G G G G G GG + G GG GGGG G G Sbjct: 251 GGGGGGGGGSGGSKVGGGYGHGSGFGGGVGFGNSGGGGGGGGGGGGGGGGGNGSGYGSGS 310 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G K GGGGG Sbjct: 311 GYGSGMGKGSGSGGGGGGGG 330 Score = 46.0 bits (104), Expect = 0.001 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 GG GA G GG G GG GG G GG GGGG G GG GGG Sbjct: 171 GGSSGGAGGGGGGGGGEGGGANGGSGHGSGAGAGAGVGGAAGGVGGGGGG--GGGEGGG 227 Score = 45.6 bits (103), Expect = 0.002 Identities = 29/80 (36%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXG-GXGG--GGPGXXXGGGGG 628 G G +G GG G G GG GG + G G G G GG GG G GGGGG Sbjct: 86 GAGAGMSGYGGVGGGGGRGGGEGGGSSANGGSGHGSGSGAGAGVGGTTGGVGGGGGGGGG 145 Query: 627 GXXXXXXKXPPPPXXGGGGG 568 G G G G Sbjct: 146 GGEGGGSSGGSGHGSGSGAG 165 Score = 45.6 bits (103), Expect = 0.002 Identities = 24/61 (39%), Positives = 25/61 (40%), Gaps = 2/61 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXG--AXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G AG GG G GG GGGGG G + G G G G G GG GG Sbjct: 120 GSGSGAGAGVGGTTGGVGGGGGGGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGG 179 Query: 627 G 625 G Sbjct: 180 G 180 Score = 45.6 bits (103), Expect = 0.002 Identities = 27/78 (34%), Positives = 28/78 (35%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G G GG G GG G GGG + G G GG G GGGGGG Sbjct: 130 GGTTGGVGGGGG---GGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGGGGGGGGG 186 Query: 621 XXXXXKXPPPPXXGGGGG 568 G G G Sbjct: 187 EGGGANGGSGHGSGAGAG 204 Score = 45.6 bits (103), Expect = 0.002 Identities = 26/65 (40%), Positives = 26/65 (40%), Gaps = 6/65 (9%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGG------XGGGGPGXXXG 640 G G G A G GG GGGGG G GG GGGG G G Sbjct: 235 GSGSGAGGGVSGAAGGGGGGGGGGGSGGSKVGGGYGHGSGFGGGVGFGNSGGGGGGGGGG 294 Query: 639 GGGGG 625 GGGGG Sbjct: 295 GGGGG 299 Score = 45.2 bits (102), Expect = 0.002 Identities = 26/77 (33%), Positives = 27/77 (35%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXX 619 G G G G G GG GGG G G+ GG G G GGGGGG Sbjct: 202 GAGAGVGGAAGGVGGGGGGGGGEGGGANGGSGHGSGSGAGGGVSGAAGGGGGGGGGGGSG 261 Query: 618 XXXXKXPPPPXXGGGGG 568 G GGG Sbjct: 262 GSKVGGGYGHGSGFGGG 278 Score = 44.8 bits (101), Expect = 0.003 Identities = 25/78 (32%), Positives = 26/78 (33%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 GG G GG + GG G G G G G GG GGGG G G GG Sbjct: 98 GGGGGRGGGEGGGSSANGGSGHGSGSGAGAGVGGTTGGVGGGGGGGGGGGEGGGSSGGSG 157 Query: 621 XXXXXKXPPPPXXGGGGG 568 GG G Sbjct: 158 HGSGSGAGAGAGVGGSSG 175 Score = 44.8 bits (101), Expect = 0.003 Identities = 24/59 (40%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXGGGGGG 625 G G+ GG + GG GGGGG G+ G GGG G G GGGGGG Sbjct: 233 GHGSGSGAGGGVSGAAGGGGGGGGGGGSGGSKVGGGYGHGSGFGGGVGFGNSGGGGGGG 291 Score = 43.6 bits (98), Expect = 0.007 Identities = 22/59 (37%), Positives = 23/59 (38%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGG 625 G G G G G GG GG GG + G G GG G GGGGGG Sbjct: 126 GAGVGGTTGGVGGGGGGGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGGGGGGG 184 Score = 43.6 bits (98), Expect = 0.007 Identities = 25/61 (40%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGX-GGGGG-XAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G AG GG + G GG GGGGG G G G GG G GGGGG Sbjct: 161 GSGAGAGAGVGGSSGGAGGGGGGGGGEGGGANGGSGHGSGAGAGAGVGGAAGGVGGGGGG 220 Query: 627 G 625 G Sbjct: 221 G 221 Score = 42.7 bits (96), Expect = 0.011 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 4/82 (4%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXGGG--- 634 GG G G GG G G G G G G G GG GGG G G GG Sbjct: 60 GGGGGGGGGGGGGGEGGDGYGHGEGYGAGAGMSGYGGVGGGGGRGGGEGGGSSANGGSGH 119 Query: 633 GGGXXXXXXKXPPPPXXGGGGG 568 G G GGGGG Sbjct: 120 GSGSGAGAGVGGTTGGVGGGGG 141 Score = 42.7 bits (96), Expect = 0.011 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGG-XAXXXGAXGXXXPPXXG-GXGGGGPGXXXGGGGGG 625 G G G G G GG GGGGG G G G G G GG GGGGGG Sbjct: 124 GAGAGVGGTTGGVGGGGGGGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGGGGGG 183 Score = 42.3 bits (95), Expect = 0.015 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GG G G G G GGGGG Sbjct: 286 GGGGGGGGGGGGGGGGNGSGYGSGSGYGSGMGKGSGSGGGGG 327 Score = 41.9 bits (94), Expect = 0.020 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G G G GG G GG GG G G GG GGGG G G GGG Sbjct: 54 GAKRYGGGGGGGGGGGGGGGEGGDGYGHGEGYGAGAGMSGYGGVGGGG-GRGGGEGGG 110 Score = 41.5 bits (93), Expect = 0.026 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Frame = -2 Query: 786 GAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXG--GXGGGGPGXXXGGGGGG 625 GA GG G GG GGGGG G G G GG G G GGG GG Sbjct: 54 GAKRYGGGGGGGGGGGGGGGEGGDGYGHGEGYGAGAGMSGYGGVGGGGGRGGGEGG 109 Score = 41.5 bits (93), Expect = 0.026 Identities = 24/77 (31%), Positives = 26/77 (33%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGX 622 G G++G G G GG GGG G GG GG G GGGG G Sbjct: 167 GAGVGGSSGGAGGGGGGGGGEGGGANGGSGHGSGAGAGAGVGGAAGGVGGGGGGGGGEGG 226 Query: 621 XXXXXKXPPPPXXGGGG 571 GGG Sbjct: 227 GANGGSGHGSGSGAGGG 243 Score = 41.5 bits (93), Expect = 0.026 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GGG G G F GGGGG Sbjct: 249 GGGGGGGGGGGSGGSKVGGGYGHGSGFGGGVGFGNSGGGGGG 290 Score = 41.1 bits (92), Expect = 0.035 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G GGGG G G G G GGG Sbjct: 285 GGGGGGGGGGGGGGGGGNGSGYGSGSGYGSGMGKGSGSGGG 325 Score = 41.1 bits (92), Expect = 0.035 Identities = 23/58 (39%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXG-GXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G G+ G G G G GGGGG G G G GGG G GGGGG Sbjct: 305 GYGSGSGYGSGMGKGSGSGGGGGGGGGGSGGGNGSGSGSGEGYGMGGGAGTGNGGGGG 362 Score = 40.3 bits (90), Expect = 0.061 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GG G G G G GGGGG Sbjct: 61 GGGGGGGGGGGGGEGGDGYGHGEGYGAGAGMSGYGGVGGGGG 102 Score = 39.9 bits (89), Expect = 0.081 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G GG G G G G GGGGG Sbjct: 216 GGGGGGGGEGGGANGGSGHGSGSGAGGGVSGAAGGGGGGGGG 257 Score = 39.5 bits (88), Expect = 0.11 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G GG G G G G GGGGG Sbjct: 179 GGGGGGGGEGGGANGGSGHGSGAGAGAGVGGAAGGVGGGGGG 220 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G G GG G G G G GGG Sbjct: 59 GGGGGGGGGGGGGGGEGGDGYGHGEGYGAGAGMSGYGGVGGG 100 Score = 39.1 bits (87), Expect = 0.14 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G G G G G G GGGGG Sbjct: 288 GGGGGGGGGGGGGGNGSGYGSGSGYGSGMGKGSGSGGGGGGG 329 Score = 39.1 bits (87), Expect = 0.14 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 798 GXXXGAAGXGGPAXGXGGXGGGGGXAXXXG-AXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G G+ GG G GG GGG G G G G GGGG G G G G Sbjct: 315 GMGKGSGSGGGGGGGGGGSGGGNGSGSGSGEGYGMGGGAGTGNGGGGGVGFGMGIGFG 372 Score = 38.3 bits (85), Expect = 0.25 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G GG G G G GG GG Sbjct: 138 GGGGGGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGG 179 Score = 38.3 bits (85), Expect = 0.25 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G G GGG G G GGGGGG G + G GGG GG Sbjct: 237 GSGAGGGVSGAAGGGGGGGGGGGSGGSKVGGGYGHGSGFGGGVGFGNSGGGGGGGGGGGG 296 Query: 596 GG 601 GG Sbjct: 297 GG 298 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 419 GGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G GG G G G GGGGG Sbjct: 215 GGGGGGGGGEGGGANGGSGHGSGSGAGGGVSGAAGGGGGGG 255 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGG G G GGGGGG G G G G G Sbjct: 282 GNSGGGGGGGGGGGGGGGGGNGSGYGSGSGYGSGMGKGSGSG 323 Score = 37.9 bits (84), Expect = 0.33 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G GGGGG G GG G G G G GGGGG Sbjct: 321 GSGGGGGGGGGGSGGGNGSGSGSGEGYGMGGGAGTGNGGGGG 362 Score = 37.1 bits (82), Expect = 0.57 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G GG G G G G GGGG Sbjct: 140 GGGGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGGGG 181 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G GG GG G G GGGGG Sbjct: 212 GGVGGGGGGGGGEGGGANGGSGHGSGSGAGGGVSGAAGGGGG 253 Score = 36.7 bits (81), Expect = 0.75 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGGG G G G G G G GGGGG Sbjct: 290 GGGGGGGGGGGGNGSGYGSGSGYGSGMGKGSGSGGGGGGGGG 331 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G G G G G G GGGGG Sbjct: 142 GGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGGGGGG 183 Score = 36.3 bits (80), Expect = 1.00 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGGGGG G G G G G G G GGGGG Sbjct: 181 GGGGGGEGGGANGGSGHGSGAGAGAGVGGAAGGVGGGGGGGG 222 Score = 35.5 bits (78), Expect = 1.7 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = -2 Query: 771 GGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPP 592 G A GG GGGGG G G G G G GG GGG + Sbjct: 52 GKGAKRYGGGGGGGGGGGGGGGEGGDGYGHGEGYGAGAGMSGYGGVGGGGGRGGGEGGGS 111 Query: 591 PXXGGGG 571 GG G Sbjct: 112 SANGGSG 118 Score = 35.1 bits (77), Expect = 2.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G G GGG G G GGG G G G G GGG Sbjct: 319 GSGSGGGGGGGGGGSGGGNGSGSGSGEGYGMGGGAGTGNGGG 360 Score = 34.7 bits (76), Expect = 3.0 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 414 GGGGGGGVXXXXXXXGGGGGXXXXXGXXGFXLXSPXXXGGGGG 542 GGGGGGG GG G G GF GGGGG Sbjct: 252 GGGGGGGGSGGSKVGGGYGHGSGFGGGVGFGNSGGGGGGGGGG 294 Score = 34.7 bits (76), Expect = 3.0 Identities = 19/58 (32%), Positives = 21/58 (36%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGG 628 G +G GG G GG GGG + G G GGG G G G G Sbjct: 313 GSGMGKGSGSGGGGGGGGGGSGGGNGSGSGSGEGYGMGGGAGTGNGGGGGVGFGMGIG 370 Score = 34.3 bits (75), Expect = 4.0 Identities = 30/116 (25%), Positives = 32/116 (27%), Gaps = 3/116 (2%) Frame = +2 Query: 203 GPPGXXGVXGXRGGXXXXGGGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXXXPPP 382 G GV G GG GGGG G GG Sbjct: 200 GAGAGAGVGGAAGGVGGGGGGGGGEGGGANGGSGHGSGSGAGGGVSGAAGGGGGGGGGGG 259 Query: 383 PXPXXXXXXFXGGGGGGGXXGXX---GXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 + G G GG G G GGGGGG G G + G G G Sbjct: 260 SGGSKVGGGYGHGSGFGGGVGFGNSGGGGGGGGGGGGGGGGGNGSGYGSGSGYGSG 315 Score = 34.3 bits (75), Expect = 4.0 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG G G G G GGGGGG G G G G G Sbjct: 276 GGGVGFGNSGGGGGGGGGGGGGGGGGNGSGYGSGSGYGSGMG 317 Score = 34.3 bits (75), Expect = 4.0 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 3/62 (4%) Frame = -2 Query: 801 GGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG---GPGXXXGGGG 631 G G G GG + G G G G G G GG G G G G GGG Sbjct: 321 GSGGGGGGGGGG-SGGGNGSGSGSGEGYGMGGGAGTGNGGGGGVGFGMGIGFGIGIGGGS 379 Query: 630 GG 625 GG Sbjct: 380 GG 381 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GGG GGG G G G G G G GGGGG Sbjct: 145 GGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGGGGGGGGG 186 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGGG G GG GG G G GG GG Sbjct: 175 GGAGGGGGGGGGEGGGANGGSGHGSGAGAGAGVGGAAGGVGG 216 Score = 33.9 bits (74), Expect = 5.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGG 538 GGGGGGG G G G G G G GGGG Sbjct: 292 GGGGGGGGGGNGSGYGSGSGYGSGMGKGSGSGGGGGGGGGG 332 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 GG GGG G GG G G G G GGGGG Sbjct: 101 GGRGGGEGGGSSANGGSGHGSGSGAGAGVGGTTGGVGGGGGG 142 Score = 33.1 bits (72), Expect = 9.3 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGG 595 G G G G G G GGGGG G G G G G GG Sbjct: 122 GSGAGAGVGGTTGGVGGGGGGGGGGGEGGGSSGGSGHGSGSGAGAGAGVGGSSGGAGGGG 181 Query: 596 GG 601 GG Sbjct: 182 GG 183 Score = 33.1 bits (72), Expect = 9.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G G G G G G GGGGG G G G G G Sbjct: 163 GAGAGAGVGGSSGGAGGGGGGGGGEGGGANGGSGHGSGAGAG 204 Score = 33.1 bits (72), Expect = 9.3 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G G G G G GGGGGG G G GGG G Sbjct: 313 GSGMGKGSGSGGGGGGGGGGSGGGNGSGSGSGEGYGMGGGAG 354 >UniRef50_Q58MX6 Cluster: Phage tail fiber-like protein; n=1; Cyanophage P-SSM2|Rep: Phage tail fiber-like protein - Cyanophage P-SSM2 Length = 559 Score = 55.6 bits (128), Expect = 2e-06 Identities = 49/164 (29%), Positives = 50/164 (30%), Gaps = 10/164 (6%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGG-XGGGGPGXXX 643 PP P G G GP+ G G G G GA G P G GG GP Sbjct: 247 PPGPTGPTGPTGPTGPTGPSGGTGPTGPAGADG-SDGADGGTGPTGPAGPTGGDGPPGPT 305 Query: 642 GGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXP--- 472 G GG G PP G GG PP PP G P Sbjct: 306 GPGGTGPTGPTGDDGPPGPPGPGG-----TGPAGPPGPPGADGDDGGSGPPGPPGSDGSD 360 Query: 471 ----PPPPPXPXXPXXPPPP--PPPXXXXXXXXGXGGGGXXXPP 358 PP PP P PP P P GG G PP Sbjct: 361 GGSGPPGPPGPTGGDGPPGPGGTGPTGPTGPTGPSGGSGPPGPP 404 Score = 48.4 bits (110), Expect = 2e-04 Identities = 46/148 (31%), Positives = 47/148 (31%), Gaps = 12/148 (8%) Frame = +2 Query: 416 GGGGGGGXXGXXGXGG--GGGGXXXXXGXGXFXXFPXXXGGGG-GXXXVXXXXXPPPPPX 586 GG G G G G G GG G G P G GG G PP PP Sbjct: 267 GGTGPTGPAGADGSDGADGGTGPTGPAGPTGGDGPPGPTGPGGTGPTGPTGDDGPPGPPG 326 Query: 587 XGGGGXXCXXXXXPPPPP----PXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPXP- 748 GG G PP PP GPP PP G P P PP P Sbjct: 327 PGGTGPA-----GPPGPPGADGDDGGSGPPGPPGSDGSDGGSGPPGPPGPTGGDGPPGPG 381 Query: 749 ---PXPXAGPPXPAAPXXXPPXXGXGGA 823 P GP P+ P G GA Sbjct: 382 GTGPTGPTGPTGPSGGSGPPGPPGTSGA 409 Score = 48.0 bits (109), Expect = 3e-04 Identities = 53/186 (28%), Positives = 54/186 (29%), Gaps = 3/186 (1%) Frame = +2 Query: 194 GXPGPPGXXGVXGXRGGXXXXG-GGGXXPXXXXPGXXXXXXXXXXXXXXXXKKKKXGGXX 370 G GPPG G G G G GG P P GG Sbjct: 243 GPAGPPGPTGPTGPTGPTGPTGPSGGTGP--TGPAGADGSDGADGGTGPTGPAGPTGGDG 300 Query: 371 XPPPPXPXXXXXXFXGGGGGGGXXGXXGXGG--GGGGXXXXXGXGXFXXFPXXXGGGGGX 544 P P P GG G G G G G G GG G P G GG Sbjct: 301 PPGPTGP--------GGTGPTGPTGDDGPPGPPGPGGTGPAGPPGP----PGADGDDGG- 347 Query: 545 XXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAPXXXA 724 PP PP G P PP P GPP P G P P + Sbjct: 348 ------SGPPGPPGSDGSD---GGSGPPGPPGPTGGDGPPGPGGTGPTGPTGPTGPSGGS 398 Query: 725 XPPPPP 742 PP PP Sbjct: 399 GPPGPP 404 Score = 42.3 bits (95), Expect = 0.015 Identities = 45/161 (27%), Positives = 47/161 (29%), Gaps = 8/161 (4%) Frame = +2 Query: 362 GXXXPPPPXPXXXXXXFXGGGGGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGG 541 G PP P G G G G G G G G G P GG G Sbjct: 243 GPAGPPGPTGPTGPTGPTGPTGPSGGTGPTGPAGADGSDGADGGTGPTG--PAGPTGGDG 300 Query: 542 XXXVXXXXXPPPPPXXGGGGXXCXXXXXPPPPPPXXXPGPPPPXPPXXGGXXXPXAP--- 712 PP P GG G P P GPP P P G P P Sbjct: 301 ---------PPGPTGPGGTG----------PTGPTGDDGPPGPPGPGGTGPAGPPGPPGA 341 Query: 713 ---XXXAXPPPPPXPPXP--XAGPPXPAAPXXXPPXXGXGG 820 + PP PP +GPP P P G GG Sbjct: 342 DGDDGGSGPPGPPGSDGSDGGSGPPGPPGPTGGDGPPGPGG 382 Score = 37.9 bits (84), Expect = 0.33 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 4/67 (5%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGGGXAXXXGAXGXXXPP----XXGGXGGGGPG 652 PP P G G AG GP G G GG G G PP G GG GP Sbjct: 62 PPGPGGPGGGTGPAGPPGPPGNDGADGSDGG-TGTPGPAGPPGPPGNDGADGNDGGSGPT 120 Query: 651 XXXGGGG 631 G G Sbjct: 121 GPTGPTG 127 Score = 37.9 bits (84), Expect = 0.33 Identities = 35/105 (33%), Positives = 36/105 (34%), Gaps = 3/105 (2%) Frame = -2 Query: 819 PPXPXXGGXXXGAAGXGGPAXGXGGXGGGG--GXAXXXGAXGXXXPPXXGGX-GGGGPGX 649 PP P G G AG GP G GG G G G+ G PP G GG GP Sbjct: 321 PPGPPGPGGT-GPAGPPGPPGADGDDGGSGPPGPPGSDGSDGGSGPPGPPGPTGGDGPP- 378 Query: 648 XXGGGGGGXXXXXXKXPPPPXXGGGGGXXXXXTXXXPPPPPXXXG 514 G GG P P G G PP PP G Sbjct: 379 ----GPGGTGPTGPTGPTGPSGGSG-----------PPGPPGTSG 408 Score = 35.5 bits (78), Expect = 1.7 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 10/95 (10%) Frame = -2 Query: 768 GPAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGG-GPGXXXG--------GGGGGXXX 616 GP G G G G G G PP GG GGG GP G G GG Sbjct: 37 GPQ-GAPGPTGPAGPTGPSGPTGGDGPPGPGGPGGGTGPAGPPGPPGNDGADGSDGGTGT 95 Query: 615 XXXKXPP-PPXXGGGGGXXXXXTXXXPPPPPXXXG 514 PP PP G G P P G Sbjct: 96 PGPAGPPGPPGNDGADGNDGGSGPTGPTGPTGPTG 130 Score = 35.1 bits (77), Expect = 2.3 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = -1 Query: 718 PGGXXWXXXPPXXGGXXG--GGXGXXXGGGGGGXXGXXAXXPPPPXXXGGGGXXXGXXXX 545 P G P G G GG G GG GG G A P PP G G G Sbjct: 38 PQGAPGPTGPAGPTGPSGPTGGDGPPGPGGPGGGTGP-AGPPGPPGNDGADGSDGGTGTP 96 Query: 544 XPPPPPXXXG 515 P PP G Sbjct: 97 GPAGPPGPPG 106 Score = 33.9 bits (74), Expect = 5.3 Identities = 35/131 (26%), Positives = 36/131 (27%) Frame = -2 Query: 765 PAXGXGGXGGGGGXAXXXGAXGXXXPPXXGGXGGGGPGXXXGGGGGGXXXXXXKXPPPPX 586 P+ G G G G A G G GG G GPG G GGG P Sbjct: 34 PSSGPQGAPGPTGPAGPTGPSGPT-----GGDGPPGPG---GPGGGTGPAGPPGPPGNDG 85 Query: 585 XGGGGGXXXXXTXXXPPPPPXXXGXXXKXPXPXXXXXPPPPPPXPXXPXXPPPPPPPXXX 406 G G PP PP G P P P P P P P Sbjct: 86 ADGSDGGTGTPGPAGPPGPPGNDGADGN-----DGGSGPTGPTGPTGPTGPTGPTGPAGA 140 Query: 405 XXXXXGXGGGG 373 G G Sbjct: 141 RNYTITNSGSG 151 Score = 33.5 bits (73), Expect = 7.0 Identities = 32/112 (28%), Positives = 32/112 (28%), Gaps = 1/112 (0%) Frame = +2 Query: 425 GGGGXXGXXGXGGGGGGXXXXXGXGXFXXFPXXXGGGGGXXXVXXXXXPPPPPXXGGGGX 604 G G G G G G G G P G GGG PP PP G Sbjct: 37 GPQGAPGPTGPAGPTGPSGPTGGDGP----PGPGGPGGGTGPAG----PPGPPGNDGADG 88 Query: 605 XCXXXXXPPPPPPXXXPGPP-PPXPPXXGGXXXPXAPXXXAXPPPPPXPPXP 757 P P P PGPP G P P P P P P Sbjct: 89 SDGGTGTPGPAGP---PGPPGNDGADGNDGGSGPTGPTGPTGPTGPTGPTGP 137 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,378,863 Number of Sequences: 1657284 Number of extensions: 33141057 Number of successful extensions: 1334437 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 70358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537201 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 76243001646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -