BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F04 (860 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schi... 31 0.21 SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyc... 30 0.49 SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr ... 27 2.6 SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 27 2.6 SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 27 3.4 SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c... 27 3.4 SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|S... 27 4.5 SPBP23A10.07 |rpa2||DNA-directed RNA polymerase I complex subuni... 26 6.0 SPAC694.04c |||conserved eukaryotic protein|Schizosaccharomyces ... 26 7.9 >SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schizosaccharomyces pombe|chr 3|||Manual Length = 215 Score = 31.1 bits (67), Expect = 0.21 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = +3 Query: 168 LEEQLYNSVVVADYDSAVE--KSKH--LYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLW 335 L E + V D +S E K KH + + +KS + ++ K+++ NK+N +E A Q W Sbjct: 110 LAESNSSVAVEGDENSYAETPKKKHSLIRKRRKSPLDSSSAQKVLKKNKLNTLEQAQQNW 169 >SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 29.9 bits (64), Expect = 0.49 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +2 Query: 521 VSWKLIALWENNKVYFKILNTERNQYLVLXVGTNWNG 631 + +K I L++NN+ KILN R V+ VGT NG Sbjct: 254 IFFKCIPLFKNNEEAEKILNVNRLLDRVMFVGTKVNG 290 >SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 774 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 249 KKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGL 347 K+ +T+ NKL+ ++ + +YAY L LQ L Sbjct: 35 KREAQLTDTPNKLLTDHDQSASDYAYALKLQQL 67 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 27.5 bits (58), Expect = 2.6 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 177 QLYNSVVVADYDSAVEKSKHLYEEKKS 257 QL N DY+ E++K LY+E+KS Sbjct: 184 QLQNENFKDDYEKIKEENKRLYKERKS 210 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 424 VHKLNRVFGEDKSELNWETIPDDV 353 +H + EDKS+L +ETIPD V Sbjct: 9 IHPVRHSKYEDKSKLPFETIPDPV 32 >SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 27.1 bits (57), Expect = 3.4 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = -3 Query: 702 YLAGCRYQWALKLWTLLT---PKAIWSPFQLVPTXN 604 +LA + LK+W L T K+I PF+ +PT N Sbjct: 198 FLASQSFDHTLKVWKLSTFGVEKSIAKPFEQMPTGN 233 >SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 26.6 bits (56), Expect = 4.5 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 369 VSQLSSDLSSPKTRLSLCTSATV 437 VS L +DL + KT+LS SATV Sbjct: 166 VSSLLNDLDNSKTKLSFLPSATV 188 >SPBP23A10.07 |rpa2||DNA-directed RNA polymerase I complex subunit Rpa2|Schizosaccharomyces pombe|chr 2|||Manual Length = 1227 Score = 26.2 bits (55), Expect = 6.0 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Frame = +3 Query: 243 EEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGLQGTSSGIVSQLSSD--LSSPKTRLS 416 E ++ VI + + L+++ MNC +YA Q W+ G+ I+S +S + S+ + R Sbjct: 1111 EMERDAVIGHGTSFLMQDRLMNCSDYA-QSWVCRDCGSIISIMSTISMNGVGSASEVRCR 1169 Query: 417 LCTSATVSL 443 C + L Sbjct: 1170 SCAKPALGL 1178 >SPAC694.04c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 324 Score = 25.8 bits (54), Expect = 7.9 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = +3 Query: 183 YNSVVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNK--MNCMEYAYQLWLQGLQGT 356 +N Y + + + +Y+ EVI V+ +L N + E YQ +++GL Sbjct: 71 FNDTFSPKYSTRLSSAGLIYKHFGREVIHAVLPQLKINEQDLETLYEKVYQSFVEGLDAN 130 Query: 357 SSGIVSQLSSDLSSPKTRLSL 419 +GI + + S K +SL Sbjct: 131 DNGISAYPAGLKPSFKAAMSL 151 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,051,745 Number of Sequences: 5004 Number of extensions: 56199 Number of successful extensions: 207 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -