BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F04 (860 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46934-11|CAE18043.1| 497|Caenorhabditis elegans Hypothetical p... 30 1.8 Z46934-10|CAD18882.1| 495|Caenorhabditis elegans Hypothetical p... 30 1.8 U28991-2|AAK68307.1| 679|Caenorhabditis elegans Kinesin-associa... 29 4.3 U13019-4|AAC24451.1| 222|Caenorhabditis elegans Hypothetical pr... 29 4.3 U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical pr... 29 4.3 AB017107-1|BAA88838.1| 679|Caenorhabditis elegans Kinesin assoc... 29 4.3 U80440-1|AAK21472.1| 4568|Caenorhabditis elegans Dynein heavy ch... 28 7.4 L33260-1|AAC37251.1| 4568|Caenorhabditis elegans dynein heavy ch... 28 7.4 Z75529-3|CAA99786.2| 1099|Caenorhabditis elegans Hypothetical pr... 28 9.8 >Z46934-11|CAE18043.1| 497|Caenorhabditis elegans Hypothetical protein ZK1320.12b protein. Length = 497 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 204 DYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCM 314 D D + EK + +KK IT++VN +IRN C+ Sbjct: 205 DIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICL 241 >Z46934-10|CAD18882.1| 495|Caenorhabditis elegans Hypothetical protein ZK1320.12a protein. Length = 495 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 204 DYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCM 314 D D + EK + +KK IT++VN +IRN C+ Sbjct: 205 DIDFSYEKVREAMSQKKRNGITSLVNYMIRNYPSICL 241 >U28991-2|AAK68307.1| 679|Caenorhabditis elegans Kinesin-associated protein protein1, isoform b protein. Length = 679 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = +3 Query: 246 EKKSEVITNVVNKLIRNNKMNCMEY---AYQLWLQGLQGTSSGIVSQLSSDLSSPKTRLS 416 +K EV TN++N I +N ME+ Y W+ ++ T + +L + + L+ Sbjct: 166 KKHFEVGTNIMNLFIGTLCVNAMEHETKRYDFWIAEMKKTDQETLRKLKTAIRKQAMLLA 225 Query: 417 LCTSATVSL 443 C + +L Sbjct: 226 ACVTFLTNL 234 >U13019-4|AAC24451.1| 222|Caenorhabditis elegans Hypothetical protein T12A2.15b protein. Length = 222 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 494 DGKDKTSPRVSWKLIALWENNKVYFKILNTERN 592 D KD+ +P VS KL+AL N +V+ K T +N Sbjct: 120 DKKDQCNPYVSVKLVALDGNKEVFKKKTPTAKN 152 >U13019-3|AAC24452.2| 713|Caenorhabditis elegans Hypothetical protein T12A2.15a protein. Length = 713 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 494 DGKDKTSPRVSWKLIALWENNKVYFKILNTERN 592 D KD+ +P VS KL+AL N +V+ K T +N Sbjct: 611 DKKDQCNPYVSVKLVALDGNKEVFKKKTPTAKN 643 >AB017107-1|BAA88838.1| 679|Caenorhabditis elegans Kinesin associated protein kap-1 protein. Length = 679 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/69 (24%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Frame = +3 Query: 246 EKKSEVITNVVNKLIRNNKMNCMEY---AYQLWLQGLQGTSSGIVSQLSSDLSSPKTRLS 416 +K EV TN++N I +N ME+ Y W+ ++ T + +L + + L+ Sbjct: 166 KKHFEVGTNIMNLFIGTLCVNAMEHETKRYDFWIAEMKKTDQETLRKLKTAIRKQAMLLA 225 Query: 417 LCTSATVSL 443 C + +L Sbjct: 226 ACVTFLTNL 234 >U80440-1|AAK21472.1| 4568|Caenorhabditis elegans Dynein heavy chain protein 1 protein. Length = 4568 Score = 28.3 bits (60), Expect = 7.4 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 4/108 (3%) Frame = +3 Query: 84 PKMKPAIVILCLFVASLYAADSD-VPNDILEEQLY--NSVVVADYDSAVEKSKH-LYEEK 251 P +K +V LC+ +LY + S + + EQLY +SV A + ++ + + EE Sbjct: 922 PTVKNVVVDLCMTAQTLYISPSTRETREKILEQLYEWHSVCTAQMRISGKRFQMVMNEEI 981 Query: 252 KSEVITNVVNKLIRNNKMNCMEYAYQLWLQGLQGTSSGIVSQLSSDLS 395 + E N++N + C+E AY + G S + LS LS Sbjct: 982 EPETYHNILN--VMPEGQACLEKAYDC----VNGIMSDLEEYLSEWLS 1023 >L33260-1|AAC37251.1| 4568|Caenorhabditis elegans dynein heavy chain protein. Length = 4568 Score = 28.3 bits (60), Expect = 7.4 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 4/108 (3%) Frame = +3 Query: 84 PKMKPAIVILCLFVASLYAADSD-VPNDILEEQLY--NSVVVADYDSAVEKSKH-LYEEK 251 P +K +V LC+ +LY + S + + EQLY +SV A + ++ + + EE Sbjct: 922 PTVKNVVVDLCMTAQTLYISPSTRETREKILEQLYEWHSVCTAQMRISGKRFQMVMNEEI 981 Query: 252 KSEVITNVVNKLIRNNKMNCMEYAYQLWLQGLQGTSSGIVSQLSSDLS 395 + E N++N + C+E AY + G S + LS LS Sbjct: 982 EPETYHNILN--VMPEGQACLEKAYDC----VNGIMSDLEEYLSEWLS 1023 >Z75529-3|CAA99786.2| 1099|Caenorhabditis elegans Hypothetical protein C44H9.4 protein. Length = 1099 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/54 (24%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 485 AYGDGKDKTSPRVSWKLIALWENNK---VYFKILNTERNQYLVLXVGTNWNGDH 637 ++G + PR ++ I+ + + YF++L+ E N+Y+++ N +G H Sbjct: 129 SWGPNFNSPKPRQVFRDISTYSYERGIRAYFRVLSAEDNKYILIACHANLHGLH 182 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,042,244 Number of Sequences: 27780 Number of extensions: 333745 Number of successful extensions: 1042 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1042 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2150453690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -