BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F03 (856 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U31961-5|AAA84404.1| 424|Drosophila melanogaster protein ( Dros... 29 8.1 BT024389-1|ABC86451.1| 122|Drosophila melanogaster IP05464p pro... 29 8.1 AE014297-2268|AAF55361.3| 417|Drosophila melanogaster CG10349-P... 29 8.1 AE014296-2379|AAF49745.1| 102|Drosophila melanogaster CG13482-P... 29 8.1 >U31961-5|AAA84404.1| 424|Drosophila melanogaster protein ( Drosophila melanogasterbithorax complex (BX-C), complete sequence. ). Length = 424 Score = 29.1 bits (62), Expect = 8.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 500 ESANARGEAVCVLGALPLPRSLTRCARSFGCG 595 ES +VC G LP+P L C + GCG Sbjct: 340 ESYQTTSASVCHSGWLPVPGHLAGCGQRRGCG 371 >BT024389-1|ABC86451.1| 122|Drosophila melanogaster IP05464p protein. Length = 122 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 740 PPPPLXEHHKNPPXKSXGGPXP 805 PPPP+ HH + P GP P Sbjct: 60 PPPPVHHHHHHGPPMHHHGPPP 81 >AE014297-2268|AAF55361.3| 417|Drosophila melanogaster CG10349-PA protein. Length = 417 Score = 29.1 bits (62), Expect = 8.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 Query: 500 ESANARGEAVCVLGALPLPRSLTRCARSFGCG 595 ES +VC G LP+P L C + GCG Sbjct: 333 ESYQTTSASVCHSGWLPVPGHLAGCGQRRGCG 364 >AE014296-2379|AAF49745.1| 102|Drosophila melanogaster CG13482-PA protein. Length = 102 Score = 29.1 bits (62), Expect = 8.1 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 740 PPPPLXEHHKNPPXKSXGGPXP 805 PPPP+ HH + P GP P Sbjct: 40 PPPPVHHHHHHGPPMHHHGPPP 61 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,310,815 Number of Sequences: 53049 Number of extensions: 579869 Number of successful extensions: 1637 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1410 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1619 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4106450400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -