BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F02 (954 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 39 0.007 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 38 0.012 12_02_0299 - 17051570-17052474,17053542-17053755 34 0.15 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 34 0.15 12_02_1174 - 26696869-26698191 34 0.19 05_04_0011 + 17139322-17139451,17139552-17140174 34 0.19 03_01_0515 - 3864796-3865425 34 0.19 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 34 0.19 01_01_0715 - 5542648-5543219,5543352-5543544 34 0.19 02_05_0686 - 30900748-30902167,30903442-30904742 33 0.25 06_03_1326 - 29355467-29355817 33 0.33 06_01_0178 + 1386981-1387505 33 0.33 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 33 0.44 12_01_0252 + 1868670-1869200,1870167-1871120 32 0.59 11_01_0252 + 1934505-1935032,1936001-1936957 32 0.59 07_01_0080 + 587674-588510 32 0.59 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 32 0.59 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 32 0.59 07_03_0890 - 22332768-22333382 32 0.77 06_03_0790 - 24636805-24637770 32 0.77 06_01_0102 + 834660-834911,835460-835568,835891-836006,836116-83... 32 0.77 04_04_0201 - 23555336-23556008,23556097-23556258,23556353-235572... 26 0.97 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 31 1.0 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 31 1.0 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 31 1.0 07_03_1136 + 24218601-24218734,24218769-24219906 31 1.0 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 1.0 02_05_0149 + 26290236-26290880 31 1.0 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 31 1.0 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 31 1.0 01_01_0929 - 7344911-7345978 31 1.0 08_01_0202 - 1638978-1639571 31 1.4 07_03_0560 + 19479597-19480667 31 1.4 07_03_0559 + 19475893-19476783 31 1.4 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 31 1.4 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 31 1.4 03_05_0630 + 26260159-26260272,26260520-26260894 31 1.4 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 1.4 03_01_0023 + 198414-198968 31 1.4 02_04_0400 - 22608519-22608844,22609044-22609122 31 1.4 01_01_0570 - 4231100-4232560 31 1.4 08_01_0059 - 394001-394708 31 1.8 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 31 1.8 07_03_1751 - 29215074-29216270 31 1.8 07_03_0177 - 14770777-14772045 31 1.8 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 31 1.8 02_01_0381 - 2764331-2764342,2768966-2769907 31 1.8 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 25 2.1 08_02_1084 - 24232968-24234779 30 2.4 06_01_0893 - 6834350-6834464,6835042-6835218,6835301-6835350,683... 30 2.4 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 30 2.4 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 30 2.4 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 30 2.4 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 28 2.7 09_04_0112 - 14757947-14758972 24 3.0 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 30 3.1 07_03_1382 - 26170563-26170631,26171151-26171843 30 3.1 06_03_0729 + 23927656-23927661,23927774-23927923,23928316-239285... 30 3.1 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 30 3.1 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 30 3.1 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 30 3.1 09_02_0543 + 10427321-10428315,10428440-10429154 24 3.7 11_01_0133 + 1121392-1122731,1123417-1123858 29 4.1 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 29 4.1 08_02_0864 + 21994286-21994989,21996257-21996958,21997221-219973... 29 4.1 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 29 4.1 07_03_0558 + 19461369-19462448 29 4.1 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 29 4.1 06_02_0127 + 12140843-12140966,12141170-12141567 29 4.1 06_01_0561 - 3983308-3983564,3983652-3983775 29 4.1 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 29 4.1 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 29 4.1 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 4.1 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 4.1 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 29 5.5 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 29 5.5 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 5.5 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 5.5 01_03_0005 + 11568545-11569119,11569179-11569191 29 5.5 12_02_1219 + 27096477-27096590,27096704-27097078 29 7.2 12_01_0841 - 7873458-7874225 29 7.2 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 7.2 10_08_0216 - 15942379-15942852,15942956-15943033 29 7.2 09_04_0368 + 17005231-17005437,17005707-17005963,17006061-170061... 29 7.2 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 7.2 09_02_0603 - 11150739-11150746,11150791-11151340 29 7.2 08_02_1256 + 25645085-25645396 29 7.2 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 29 7.2 07_03_1636 + 28290642-28291574 29 7.2 07_01_0974 + 8211602-8212051 29 7.2 06_01_0941 + 7241050-7241331 29 7.2 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 7.2 04_03_0212 + 12697854-12698549,12698655-12698930,12698991-126990... 29 7.2 03_02_0865 - 11895257-11895340,11896004-11896069,11896297-118963... 29 7.2 03_02_0765 + 11000724-11002496 29 7.2 02_04_0371 + 22434710-22435102,22435428-22435624,22435707-224358... 29 7.2 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 7.2 01_06_0317 + 28425408-28426079,28426286-28426351 29 7.2 01_05_0490 + 22672241-22674679 29 7.2 01_05_0386 - 21683909-21685334,21685513-21685541 29 7.2 12_02_0478 + 19514509-19514940,19515749-19515820,19515954-195159... 28 9.5 12_01_0838 - 7830944-7831444 28 9.5 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 28 9.5 08_02_0937 + 22801526-22802461 28 9.5 08_02_0796 - 21300251-21300373,21300846-21301721 28 9.5 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 28 9.5 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 28 9.5 07_01_0516 - 3850252-3852870 28 9.5 06_01_0576 - 4073261-4073821,4073891-4074145 28 9.5 06_01_0486 - 3455030-3455770 28 9.5 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 28 9.5 05_05_0334 + 24156532-24156565,24156681-24156782,24157145-241572... 28 9.5 04_04_1687 - 35365766-35366356,35367137-35368135 28 9.5 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 28 9.5 04_01_0034 - 401208-402923 28 9.5 02_01_0016 + 110796-110979,111252-111768,111847-112213 28 9.5 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +1 Query: 457 FFPPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 ++ P PPP G PPPP PPPPPP Sbjct: 89 YYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPP 128 Score = 35.5 bits (78), Expect = 0.063 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 456 FFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 ++ PPP PP P PP PPPPPP Sbjct: 89 YYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPP 128 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPX---PXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 58 PPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPP 98 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPP 570 PP PPP PPPP PPPP Sbjct: 108 PPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 PP PPP PPPP PPPP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXX---PPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 57 PPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPP 97 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPP 569 PPPP PP P PP PPPP Sbjct: 108 PPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/71 (28%), Positives = 21/71 (29%) Frame = +1 Query: 364 SXPXKXPPGXXXXXKKXKXPXXXGXXKKXXXFFPPXPPPXXXGXXXXXGXPPPPXXXXXX 543 S P PP + P PP PPP PPPP Sbjct: 601 SPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGN 660 Query: 544 XXXXXPPPPPP 576 PPPPPP Sbjct: 661 KFPAPPPPPPP 671 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 586 PPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPP 623 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 587 PPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPP 624 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 586 PPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPP 623 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 588 PPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Score = 35.5 bits (78), Expect = 0.063 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 587 PPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPP 624 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P + P PP PPPPPP Sbjct: 571 PPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPP 608 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP PP P PPPPPPP Sbjct: 620 PPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPP 672 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP P PPPP Sbjct: 568 PPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPP 605 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP P PPPP Sbjct: 568 PPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPP 605 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P P PPPPP Sbjct: 569 PPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPP 606 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPP PPPPPP Sbjct: 732 PPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPP 769 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PP PPPP PPPPPP Sbjct: 570 PPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPP 607 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +3 Query: 420 PPXXXXXKKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP PPPP PP P PP PPPPP Sbjct: 571 PPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPP 622 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP P PP P P PPPPPPP Sbjct: 571 PPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPP 608 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP P PP P P PPPPPPP Sbjct: 589 PPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPP 626 Score = 33.1 bits (72), Expect = 0.33 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 PP PPP PPPP PPPPP Sbjct: 747 PPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPP 783 Score = 32.7 bits (71), Expect = 0.44 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G PPPP PPPPPP Sbjct: 547 PPPPPPPPSGNKPAFSPPPPP----------PPPPPPP 574 Score = 32.7 bits (71), Expect = 0.44 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 420 PPXXXXXKKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP F PPPP PP P PP PPPPPP Sbjct: 549 PPPPPPSGNKPAFSPPPPPPP----------PPPPPLPQSNYASSQPPPPPP 590 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P P PP PPPPPP Sbjct: 588 PPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPP 625 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P P PP PPPPPP Sbjct: 589 PPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPP 626 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPP Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPP 622 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P P P PPPP PPPPPP Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPP 571 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPP 572 PP P PP P PP PPPPP Sbjct: 747 PPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPP 783 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 420 PPXXXXXKKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP F PPP PP P PP PPPPPP Sbjct: 548 PPPPPPPSGNKPAFSPPPPPPP--------PPPPPLPQSNYASSQPPPPPPP 591 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PP P PP PPP Sbjct: 715 PPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPP 752 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 544 PPPPPPP----------PPPPSGNKPAFSPPPPPPPPP 571 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXP---XXXXXXPPPPPPP 577 SPP PP PP P P PPPPPPP Sbjct: 601 SPPPPPPPPPILPNRSV--PPPPPPPPPLPNHSVLPPPPPPP 640 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXX-PPXPXXPXXXXXXPPPPPPP 577 PP FSPP PP PP P P P PPPPP Sbjct: 271 PPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPP 324 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P P PPPPPPP Sbjct: 290 PPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPP 327 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +3 Query: 420 PPXXXXXKKXXXFFPP--PPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP F PP PP PP + P P PPPPPP Sbjct: 272 PPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPP 325 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PP P PPPPPP Sbjct: 289 PPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPP 325 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P + PP PPPPPP Sbjct: 292 PPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPP 329 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 1/39 (2%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXX-PXXXXXXPPPPPPP 577 PP P PP P P PPPPPPP Sbjct: 293 PPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPP 331 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P P PPPPPP Sbjct: 310 PPPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPPP 347 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP P P PPPPPP Sbjct: 310 PPPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPPP 347 >12_02_1174 - 26696869-26698191 Length = 440 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P PPPPPPP Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPP 161 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPP PPPPPP Sbjct: 123 PPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPP 160 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P P PPPPPP Sbjct: 158 PPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 162 PPPPRPPSVKPPVVQPKPQPP----PSLQPPSPPPPPP 195 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPP 574 SPP PP P P PPPPPP Sbjct: 189 SPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPP 226 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P P P PPPPPP Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPP 161 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P P PPPPPP Sbjct: 123 PPPPPPPRT--RTRVEPPHRPPPVKPQPPPSLPPPPPP 158 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPP 571 P PP PP P P PPPPP Sbjct: 270 PSPLPPPPEDYWSPTAVTPPEPTKPKPPPPSPPPPP 305 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 456 FFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 F PPPP PP G P PPPPPP Sbjct: 137 FQPPPPSPPNGGNVIGDGKRLTPTGPDPIHNEFQPPPPPP 176 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP G P PPPPPP Sbjct: 71 PPPPSPPNGGNVIGNGKRLTPTGPDPIHNEFQPPPPPP 108 Score = 31.9 bits (69), Expect = 0.77 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +1 Query: 370 PXKXPPGXXXXXKKXKXPXXXGXXKKXXXFFPPXPPPXXXGXXXXXGXPPPPXXXXXXXX 549 P PP K G F PP P P G G P Sbjct: 108 PPPSPPNGGKVIGDGKRLTPTGPDPVHNKFQPPPPSPPNGGNVIGDGKRLTPTGPDPIHN 167 Query: 550 XXXPPPPPP 576 PPPPPP Sbjct: 168 EFQPPPPPP 176 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P PPPPPPP Sbjct: 72 PPPSPPNGGNVIGNGKRLTPTGPDPIHNEFQPPPPPPP 109 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P PPPPPPP Sbjct: 140 PPPSPPNGGNVIGDGKRLTPTGPDPIHNEFQPPPPPPP 177 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 456 FFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 F PPPP PP G P PPPP P Sbjct: 205 FPPPPPSPPNGANVIGDGKRLTPTGPDPVHNEFQPPPPSP 244 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP G P PPPP P Sbjct: 107 PPPPSPPNGGKVIGDGKRLTPTGPDPVHNKFQPPPPSP 144 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP G P PPPP P Sbjct: 175 PPPPSPPNGANVIGDGKRLTPIGPDPIHNEFPPPPPSP 212 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP P P G G P PPPPPP Sbjct: 71 PPPPSPPNGGNVIGNGKRLTPTGPDPIHNEFQPPPPPP 108 >03_01_0515 - 3864796-3865425 Length = 209 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPP PPP Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPP 108 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP P PPPP Sbjct: 72 PPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPP 109 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPP 572 PPPP PP P PP PPPPP Sbjct: 84 PPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 472 PPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PPP G PPP PPPPPP Sbjct: 61 PPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPP 95 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/52 (28%), Positives = 15/52 (28%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPP 574 PP P PP PP P P PPPPPP Sbjct: 53 PPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PP PPPP PPPPP Sbjct: 83 PPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P P PP P PPPP Sbjct: 72 PPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPP 109 >02_05_1057 + 33809982-33810366,33810436-33810687,33810727-33810926, 33811021-33811122 Length = 312 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGGG GGGG P GGG GG Sbjct: 15 GGGGGGTAGACCPGAAGGGGGGVGGVFIPGIIGGGGGG 52 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G G GGGG Sbjct: 51 GGGGGGTGDACSPGTAEGGCGGGCGGENDDTGNGGGGG 88 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 615 P PPP G P PP PPPPPP GG Sbjct: 159 PSPPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPPAGGNFTAPSPAGG 208 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 465 PPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 614 P P PP P PP PPPPPP GG Sbjct: 159 PSPPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPPAGGNFTAPSPAGG 208 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPPP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 32.7 bits (71), Expect = 0.44 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 465 PPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPP PP P PP PPPPPP Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 326 PPPPPPPKAAP-----PPPPPKGPPPPPPAKGPPPPPP 358 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 336 PPPPPPKGPPPPPPAKGPPPP---PPPKGPSPPPPPPP 370 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 326 PPPPPPPKA-----APPPPPPKGPPPPPPAKGPPPPPP 358 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PP G PPPP PPPPPP Sbjct: 328 PPPPPKAAPPPPPPKGPPPPP------PAKGPPPPPPP 359 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPP 574 +PP PP PP P P PPPPPP Sbjct: 335 APPPPPPKGPPPPPPAKGPPPPP--PPKGPSPPPPPPP 370 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PP P PP PPPPPP Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 P PP PP P PP PPPPP Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPP 348 >06_03_1326 - 29355467-29355817 Length = 116 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGGK 459 GGGGGG GGGG GGG GGK Sbjct: 7 GGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGK 45 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGEK 457 GGGGGGG G G GG GG GG K Sbjct: 6 GGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGK 45 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 14 GGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGG 51 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGG GG G G GG GG GG Sbjct: 25 GGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGG 62 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGGKXXXFFXXXXXXGG 419 GGGGGG G G GG GG GK + GG Sbjct: 16 GGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGG 67 >06_01_0178 + 1386981-1387505 Length = 174 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGGK 458 GGGGGG GG G GG GGGGK Sbjct: 41 GGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGK 79 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGEK 457 GGGGGGG G G GG GG GG K Sbjct: 40 GGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGK 79 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGEK 457 GGGGGGG G G GG GG G K Sbjct: 43 GGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRK 82 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG G GG Sbjct: 37 GGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGG 74 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G G GGGG Sbjct: 38 GGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGG 75 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG G GG Sbjct: 93 GGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGG 130 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 32.7 bits (71), Expect = 0.44 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 472 PPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 615 PPP PPPP PPPPPP GGGG Sbjct: 53 PPPPPQVIRVFAAAPPPP---PAAFFAAVPPPPPPPFEYYPAVGGGGG 97 Score = 31.9 bits (69), Expect = 0.77 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +3 Query: 468 PPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 614 PP PP P PP PPPPPP GGGG Sbjct: 53 PPPPPQVIRVFAAAPPPPP----AAFFAAVPPPPPPPFEYYPAVGGGGG 97 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPPXXXXXXXXXGGGGAA 622 P P PPPPPPP GGG A Sbjct: 67 PPPPPAAFFAAVPPPPPPPFEYYPAVGGGGGFGA 100 Score = 28.7 bits (61), Expect = 7.2 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 476 PPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPPXXXXXXXXXGGGGA 619 PP PP P PPPPPP GG GA Sbjct: 53 PPPPPQVIRVFAAAPPPPPAAFFAAVPPPPPPPFEYYPAVGGGGGFGA 100 >12_01_0252 + 1868670-1869200,1870167-1871120 Length = 494 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 615 PPPPXXXXXXXXXGGGGGGGXXXXXXGXXGXGG 517 PPPP GGGGGG G G GG Sbjct: 63 PPPPPPPPLNWPTAGGGGGGSGGGGRGGAGGGG 95 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 615 PPPPXXXXXXXXXGGGGGGGXXXXXXGXXGXGG 517 PPPP GGGGGG G G GG Sbjct: 64 PPPPPPPLNWPTAGGGGGGSGGGGRGGAGGGGG 96 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGGA 619 PPPPPPP GGGG+ Sbjct: 63 PPPPPPPPLNWPTAGGGGGGS 83 >11_01_0252 + 1934505-1935032,1936001-1936957 Length = 494 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 615 PPPPXXXXXXXXXGGGGGGGXXXXXXGXXGXGG 517 PPPP GGGGGG G G GG Sbjct: 63 PPPPPPPLNWPMAGGGGGGSGGGGRGGAGGGGG 95 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 611 PPPXXXXXXXXXGGGGGGXXXXXXXXXXXGGGGXP 507 PPP GGGGG GGGG P Sbjct: 63 PPPPPPPLNWPMAGGGGGGSGGGGRGGAGGGGGAP 97 >07_01_0080 + 587674-588510 Length = 278 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 476 PPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P PPPPPPP Sbjct: 79 PPRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPP 112 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 458 FSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 F P PP PP P P PPPPPPP Sbjct: 88 FRRPPPPPPPPPSSGSPPPPPPPPPPP------PPPPPPP 121 Score = 28.3 bits (60), Expect = 9.5 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G PPPP PPPPPP Sbjct: 91 PPPPPPPPPSS----GSPPPPPPP--------PPPPPP 116 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P P PP PPPPPP Sbjct: 57 PPPPPLPTPTVTTPTPPPPPPAPRPPRRHHRIPPPPPP 94 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPP Sbjct: 57 PPPPPLPTPTVTTPTPPPPPPAPRPPRRHHRIPPPPP 93 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 615 PP P P G PPPP P P P GGGG Sbjct: 333 PPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGG 383 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGG 612 PP P P G G PPPP P PPPP G G Sbjct: 304 PPHPLPPGAGAGAGTGAPPPP-----PAHPAAPAPPPPAPSPSAAGAGSG 348 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 614 PPPP P G P PP P P P GGGG Sbjct: 333 PPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGG 383 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 472 PPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGG 612 PPP PP P PPPPPP G G Sbjct: 321 PPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPG 367 Score = 28.3 bits (60), Expect = 9.5 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 615 P PPP G PPP PP P P G GG Sbjct: 331 PAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGG 381 >07_03_0890 - 22332768-22333382 Length = 204 Score = 31.9 bits (69), Expect = 0.77 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 472 PPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PPP PPPP PPPPPP Sbjct: 76 PPPPAEATPPPPPPPPPPERAVPEAADTPPPPPPP 110 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 472 PPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PPP PPPP PPPPPP Sbjct: 75 PPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPP 109 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 468 PPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP PP P PP PPPPPP Sbjct: 75 PPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPPP 110 >06_03_0790 - 24636805-24637770 Length = 321 Score = 31.9 bits (69), Expect = 0.77 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGE 460 GGGGGGG G G GG GG GG+ Sbjct: 113 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGD 151 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGGK 458 GGGGGG GG G GG GGGG+ Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGR 121 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 123 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 124 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGE 460 GGGGGGG G G GG GG G + Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDD 152 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG G Sbjct: 112 GGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG G GG Sbjct: 131 GGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGG 168 >06_01_0102 + 834660-834911,835460-835568,835891-836006,836116-836235, 836398-836436,836678-836811,837035-837299,837615-837698, 837943-838003,838748-838810,839174-839216,839632-839711, 839831-840267 Length = 600 Score = 31.9 bits (69), Expect = 0.77 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPPXXXXXXXXXGGGGA 619 PP P P PP PPP GGGGA Sbjct: 23 PPPPPPPKILLAKPPLPPPSSSGADDDGGGGGGA 56 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPPXXXXXXXXXGGGGAA 622 P P P PP PPP GGGG A Sbjct: 23 PPPPPPPKILLAKPPLPPPSSSGADDDGGGGGGA 56 >04_04_0201 - 23555336-23556008,23556097-23556258,23556353-23557206, 23557452-23557613,23558197-23558649,23559729-23559788, 23559983-23560058,23561546-23561593,23561948-23562022, 23562067-23562494 Length = 996 Score = 25.8 bits (54), Expect(2) = 0.97 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGG 616 PPPPPPP G GG Sbjct: 906 PPPPPPPPSASALAVAGLGG 925 Score = 24.2 bits (50), Expect(2) = 0.97 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 536 PXXXXXXPPPPPPP 577 P PPPPPPP Sbjct: 900 PALRGLPPPPPPPP 913 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 30 PPVPPDPYGADLSPPPPPPP 49 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 929 PPPPPPPGKPGGPPPPPPPP 948 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPP 572 PPPP PP G P PP PPPPP Sbjct: 920 PPPPRPP--------GAPPPPPPPGKPGGPPPPPPPP 948 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPPXXXXXXXXXGG 610 P P P PPPPPPP GG Sbjct: 929 PPPPPPPGKPGGPPPPPPPPGSLPRNLAGG 958 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 73 PPPPQTPPSPPPPPPPPPPP 92 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 74 PPPQTPPSPPPPPPPPPPPP 93 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 76 PQTPPSPPPPPPPPPPPPPP 95 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 572 GGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGG GGGG P GGG GG Sbjct: 174 GGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGLGG 210 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGGG GGG P GGG GG Sbjct: 321 GGGGGGEIAGTVDLRGGGGGAGGVFPPTPDLGGGGGGG 358 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 174 GGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGLGGG 211 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 264 GGGGGGGGTDRNKGGGGGGGGALENAREDGAEGGGGGG 301 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 265 GGGGGGGTDRNKGGGGGGGGALENAREDGAEGGGGGGG 302 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 611 PPPXXXXXXXXXGGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 P P GGGGGG GGG P P GGG GG Sbjct: 98 PGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARP-----PAPGGGGGGG 142 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGGG GGGG GGG GG Sbjct: 320 GGGGGGGEIAGTVDLRGGGGGAGGVFPPTPDLGGGGGG 357 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGGG GGGG P GG GG Sbjct: 319 GGGGGGGGEIAGTVDLRGGGGGAGGVFPPTPDLGGGGG 356 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -2 Query: 611 PPPXXXXXXXXXGGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 PP GGGG GGGG P GGG GG Sbjct: 346 PPTPDLGGGGGGGGGGTKVRVCAPKDISGGGGGGGGMLDKPDEAGGGGGG 395 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 Query: 182 GGGXPPRXGXGVLGXPPKXVFPXKMGGGPLXFFXPXGEXPGG 307 GG PP G G G P+ V GGG L P G GG Sbjct: 128 GGARPPAPGGGGGGGAPRRVLGGGGGGGALA--RPPGGGRGG 167 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPP 570 PP PPP PPPP PPPP Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPP 299 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 468 PPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP P G P PP PPPPPP Sbjct: 250 PPAAPGTLPNGSGGPPRPPPPQVPPPPPQAPPPPPP 285 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P PPPPPPP Sbjct: 276 PPQAPPPPPPNAPMGM--PPRIPPPPVGGTQPPPPPPP 311 >02_05_0149 + 26290236-26290880 Length = 214 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGGK 458 GGGGGG G G P GG GGGG+ Sbjct: 105 GGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGGGR 143 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 135 GGGGGGGGRNYGGGSGGIGGYGNYGGGYNGEPGGGGGG 172 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 104 GGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGG 141 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGEKXXXFFXXXXXXGGF 415 GGGGGGG G GG GG GG + GG+ Sbjct: 102 GGGGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGGGRNYGGGSGGIGGY 155 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +2 Query: 467 PXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPPXXXXXXXXXGGGGAA 622 P PP PP P P PPPPPP GGGG++ Sbjct: 33 PPPPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPP------FPKGGGGSS 78 Score = 29.9 bits (64), Expect = 3.1 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 614 PPPP PP P PP PPPPP GGGG Sbjct: 33 PPPPPPPL--FPAMSARPQPPRPAHPARFVKPMPPPPP-----PFPKGGGG 76 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 PP PPP PP P PPPPP Sbjct: 33 PPPPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPP 69 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 360 PPPPPPPPPPPPRPPPPPPP 379 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PP P PPP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPP 572 PPPP PP P PP PP PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P P PPP PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >01_01_0929 - 7344911-7345978 Length = 355 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 20 PPLPPSPPSKTRRPPPPPPP 39 >08_01_0202 - 1638978-1639571 Length = 197 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 92 GGGGGGGRYGGDRGYGGGGGGYGGGDRGYGGGGGYGGG 129 >07_03_0560 + 19479597-19480667 Length = 356 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 167 GGGGGGGFGGDGGGGLGGGGGKEGGFGAGGGVGGGAGG 204 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGE 460 GGGGG G G G GG GG GGE Sbjct: 82 GGGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGE 120 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGGKXXXFFXXXXXXGG 419 GGGGG GG G GG GGGG F GG Sbjct: 183 GGGGGKEGGFGAGGGVGGGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGG 234 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXG 466 GGGGGGG G G GG GG G Sbjct: 125 GGGGGGGLGGGGGGGVGGGGGQGGGFGAGGGVGGGSG 161 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 201 GAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGG 238 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 235 GAGGGGGLGGGGGGGMGGGGGGGMGGGAGGGFGGGAGG 272 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 251 GGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGG 288 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG G G GG GGGG Sbjct: 252 GGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGG 289 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 571 GGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGG GG G GG GGGG Sbjct: 100 GGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGG 136 >07_03_0559 + 19475893-19476783 Length = 296 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 162 GGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGG 199 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXG 466 GGGGGGG G G GG GG G Sbjct: 120 GGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSG 156 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGG 77 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGG 78 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 42 GGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGG 79 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 43 GGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGG 80 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGG GG G G GG GG GG Sbjct: 47 GGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGG 84 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 148 GGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGG 185 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 149 GGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGG 186 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 150 GGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGG 187 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 151 GGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGG 188 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 153 GGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGG 190 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G GG GG GG Sbjct: 147 GGGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGG 184 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 152 GGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGG 189 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG G G GG GGGG Sbjct: 154 GGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGG 191 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 113 GGGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRGG 150 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 349 PPPPPPPPP-----PPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 349 PPPPPPPPPPPP-----PPPPPKLNTAPKPPPPPPPPP 381 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 SP P PP P P P PPPPP Sbjct: 339 SPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPP 377 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPP Sbjct: 359 PPPPPPPKLNTAPKPPPPPP 378 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 360 PPPPPPKLNTAPKPPPPPPP 379 >03_01_0023 + 198414-198968 Length = 184 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 38 GGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGG 75 Score = 29.9 bits (64), Expect = 3.1 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = -3 Query: 610 PPPXXXXXXXXXGGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 P P GGGGGG G G GG GGGG Sbjct: 33 PSPGGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGG 82 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGG G G G GG GG GG Sbjct: 53 GGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGG 90 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 61 GSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGG 98 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 71 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 72 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 73 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 74 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 75 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 76 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 77 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 78 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 79 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 80 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 81 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGGKXXXFF 443 GGGGGG GG G GG GGGG ++ Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYY 94 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 >01_01_0570 - 4231100-4232560 Length = 486 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 88 GGGGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGGVGGG 125 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGG GG GG G GG GGGG Sbjct: 257 GGGAGGGMGGDIGGGAGGGVGGGGGGGMGGGGGFGGGG 294 >08_01_0059 - 394001-394708 Length = 235 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPP Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPP 38 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 PP PPP PPP PPPPP Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPP 38 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/52 (26%), Positives = 15/52 (28%) Frame = +3 Query: 420 PPXXXXXKKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP PPPP P + P P PPPP P Sbjct: 20 PPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSP 71 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 SPP PP P P P PP P PP Sbjct: 29 SPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPP 67 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 P PP P P P PPPPPPP Sbjct: 1150 PSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPP 1187 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P P PPP P Sbjct: 1165 PPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLP 1202 >07_03_1751 - 29215074-29216270 Length = 398 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 130 GGGGGGGAGGGLGGGAGGGAGAGVGGGAGAGGGAGGGG 167 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGEKXXXFFXXXXXXGG 418 GGG G G G G GG GG GG K F GG Sbjct: 258 GGGAGAGGGLGAGGGAGGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGG 310 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGG GGG G G GG GG GG Sbjct: 142 GGGAGGGAGAGVGGGAGAGGGAGGGGGLGGGAGGGAGG 179 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGG GGG G G GG GG GG Sbjct: 170 GGGAGGGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGG 207 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGG GGG G G GG GG GG Sbjct: 174 GGGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGGGAGG 211 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 184 GSGGGGGLGGGAGGGAGVGGGAGGGAGGGGGLGGGAGG 221 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 208 GAGGGGGLGGGAGGGAGGGGGLGGGAGGGHGGGGGLGG 245 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 222 GAGGGGGLGGGAGGGHGGGGGLGGGAGGGAGVGGGAGG 259 >07_03_0177 - 14770777-14772045 Length = 422 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGEKXXXFFXXXXXXGGF 415 GGGGGGG G G GG GG G K GGF Sbjct: 70 GGGGGGGGGFGGGGGFGGGGGGGLGGGGGGGLGGGGGFGKGGGVGGGFGKGGGF 123 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPP 574 PP PP PP P P PPP PP Sbjct: 72 PPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPPVPP 108 >02_01_0381 - 2764331-2764342,2768966-2769907 Length = 317 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 513 PXPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 614 P PP PPPPPP GGGG Sbjct: 48 PAPPSSSAAEAASDLPPPPPPPPNQPSAGGGGGG 81 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 514 PPPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGGG 615 P PP PPPPPP GGGG Sbjct: 48 PAPPSSSAAEAASDLPPPPPPPPNQPSAGGGGGG 81 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 24.6 bits (51), Expect(2) = 2.1 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGGA 619 PPPPPPP GG+ Sbjct: 20 PPPPPPPPLRRLLTATRSGGS 40 Score = 24.2 bits (50), Expect(2) = 2.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 536 PXXXXXXPPPPPPP 577 P PPPPPPP Sbjct: 12 PAPPPPPPPPPPPP 25 >08_02_1084 - 24232968-24234779 Length = 603 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 P PPP PPPP PPPPP Sbjct: 62 PSLPPPLPQKQPPSQQLPPPPQQQQPPPQHSLPPPPP 98 >06_01_0893 - 6834350-6834464,6835042-6835218,6835301-6835350, 6836348-6836416,6836495-6836593,6836681-6836759, 6837604-6837704,6838645-6838713,6839548-6839588, 6839793-6841159,6841472-6841575,6841914-6842351, 6843040-6843567 Length = 1078 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 618 APPPPXXXXXXXXXGGGGGGG 556 APPPP GGGGGGG Sbjct: 22 APPPPVSKKGGGGGGGGGGGG 42 >03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021, 5103670-5104577 Length = 538 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PP G G PPP P PPPP Sbjct: 186 PPPPADEDGTSASAGAPPPQAPLPPPAPVPAPAPPPP 222 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGGG GGGG GGG GG Sbjct: 286 GGGGGGGNTGGGIGGSTGGGGRGAGAGVGGITGGGDGG 323 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGG GGGG GGG GG Sbjct: 84 GGGGGNTGGGGGEVTGGGGGGVAEGTGIGGGGGGGDGG 121 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGGG GGGG GGG GG Sbjct: 55 GGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGG 92 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -3 Query: 571 GGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGGK 458 GGGGG GG G GG GGGG+ Sbjct: 53 GGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGR 90 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGG 464 GGGGGG GG G GG GGG Sbjct: 213 GGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRGGG 249 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 413 PPPPTHTHGPPPPPPPPPPP 432 Score = 27.9 bits (59), Expect(2) = 2.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 514 PPPPXXXXXXXXXXXPPPPPP 576 PPPP PPPPPP Sbjct: 413 PPPPTHTHGPPPPPPPPPPPP 433 Score = 20.6 bits (41), Expect(2) = 2.7 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPP 522 PP PPP PPP Sbjct: 354 PPAPPPPPPFAPTLPPPPPP 373 >09_04_0112 - 14757947-14758972 Length = 341 Score = 24.2 bits (50), Expect(2) = 3.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 536 PXXXXXXPPPPPPP 577 P PPPPPPP Sbjct: 288 PFNPPTSPPPPPPP 301 Score = 24.2 bits (50), Expect(2) = 3.0 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGGAA 622 PPPPPPP G AA Sbjct: 296 PPPPPPPPHATDFNINGTATAA 317 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P P PPPPPP Sbjct: 10 PPPPPPPQL--EASGSDPDDPLLRDRVVVIAPPPPPPP 45 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 508 GXPPPPXXXXXXXXXXXPPPPPP 576 G PPPP PPPPPP Sbjct: 183 GPPPPPPPQPSGDANENPPPPPP 205 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 187 PPPPQPSGDANENPPPPPPP 206 >06_03_0729 + 23927656-23927661,23927774-23927923,23928316-23928567, 23929072-23929209,23931213-23932730 Length = 687 Score = 29.9 bits (64), Expect = 3.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP-PXXXXXXXXXGGGG 616 PP P PPPPPP P GGGG Sbjct: 202 PPSSDAPSPPPPSPPPPPPSPAAHRRCSSSGGGG 235 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 355 PPPPPPP---------PPPPPVYYSSYVMLDRPPPPPP 383 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 355 PPPPPPPP---------PPPPVYYSSYVMLDRPPPPPP 383 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGG 616 PPPPPPP GGGG Sbjct: 8 PPPPPPPPQHPPPPQAGGGG 27 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGG 616 PPPPPPP GGGG Sbjct: 9 PPPPPPPQHPPPPQAGGGGG 28 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPP 569 PPPP PP P PP PPPP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPP 154 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 24.2 bits (50), Expect(2) = 3.7 Identities = 11/38 (28%), Positives = 12/38 (31%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPP 574 +PP P PP P P PPP P Sbjct: 25 TPPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPPAP 62 Score = 23.8 bits (49), Expect(2) = 3.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 557 PPPPPPP 577 PPPPPPP Sbjct: 96 PPPPPPP 102 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP PP PPPP P Sbjct: 134 PPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPPQP 171 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 328 PPAPPPP----------PPPPSRFNNTTPKPPPPPPPP 355 >08_02_0864 + 21994286-21994989,21996257-21996958,21997221-21997374, 21997494-21997838,21998323-21999240,21999312-21999640, 21999709-21999832,21999901-22000071,22000188-22001648, 22002647-22002910,22003866-22004189 Length = 1831 Score = 29.5 bits (63), Expect = 4.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 536 PXXXXXXPPPPPPPXXXXXXXXXGGGGAA 622 P PPPP PP GGGGAA Sbjct: 21 PRRGDHSPPPPLPPPPASQVGAGGGGGAA 49 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 29.5 bits (63), Expect = 4.1 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = +2 Query: 380 NPXGXXXXXKXXXPPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXP 559 +P G PP K SPP P PP P P P Sbjct: 543 HPVGSLSESTPMQPPVMPPPIPKL--LSPPA-PQAPMPPLKASPVPPPEPSPPPAPKAAP 599 Query: 560 PPPPP 574 PPPPP Sbjct: 600 PPPPP 604 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPP 570 P PPP PPPP PPPP Sbjct: 583 PVPPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPP 617 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPP 570 PP PPP G G P PP PPPP Sbjct: 599 PPPPPPKSTGP----GPPRPPPPAMPGSSKTRPPPP 630 >07_03_0558 + 19461369-19462448 Length = 359 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGEKXXXFFXXXXXXGGF 415 GGGGGGG G G G GG GG GGF Sbjct: 102 GGGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLGGGGGHGGGF 155 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -1 Query: 573 GGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGG G G GG GG GG Sbjct: 67 GGGGGGLGGGHGGGFGGGGGLGGGASGGVGGGGGFGG 103 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 176 GGGGGGGLGGGHGGGFGGGAGVGGGAGGGVGGGGGFGG 213 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGG G G G GG GG GG Sbjct: 212 GGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGGG 249 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 244 GGGGGGGLGGGHGGGFGGGAGVGSGAGGGVGGGGGFGG 281 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 316 GGGGGGGLGGGHGGGFGAGAGVGGGAGGGVGGGGGFGG 353 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 251 PPPPPPP----------PGPPPREIVPGQTLLPPPPPP 278 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGEKXXXFFXXXXXXGGF 415 GGGGGGG G G GG G GG F GG+ Sbjct: 105 GGGGGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGGGGGGYSKGFGGGYGGGGY 158 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 29.5 bits (63), Expect = 4.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGGAA 622 PPPPPPP GGG+A Sbjct: 33 PPPPPPPPSGAAAGEDNGGGSA 54 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPPXXXXXXXXXGGGGA 619 PP P P P PPPPP GGGG+ Sbjct: 49 PPRPPPPPPPPTQPAPPPPP----PARSGGGGGS 78 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.5 bits (63), Expect = 4.1 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPPXXXXXXXXXGGGG 616 +PP PP P P P PPPPP GG G Sbjct: 1183 APPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLPAPPGGRG 1234 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P PPPPPPP Sbjct: 1082 PPLPPPLPPTLGDYGVAPPP----PSIGAGAPPPPPPP 1115 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 29.5 bits (63), Expect = 4.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 459 FPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 F PPP PP W P PP PP P P Sbjct: 121 FQPPPQPPRAWDP----SPPPPPPAPAAPVLVPPPAPAP 155 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +2 Query: 443 KKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 +K F PP PP PP P P PPP P P Sbjct: 116 RKKPQFQPPPQPPRAWDPSP-----PPPPPAPAAPVLVPPPAPAP 155 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 8/46 (17%) Frame = +1 Query: 463 PPXPPPXXXGXXXXX--------GXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G G PPPP PPPPP Sbjct: 129 PPPPPPPFKGDHYGGVYQNWQQNGPPPPPDHVLKKVPSHPSPPPPP 174 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 514 PPPPXXXXXXXXXXXPPPPPPXXXXXXXXXGG 609 PPPP PPPPPP GG Sbjct: 112 PPPPPPHLLHYYGHPPPPPPPPPPFKGDHYGG 143 Score = 28.3 bits (60), Expect = 9.5 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +3 Query: 441 KKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 K+ PPPP PP G P PP PPPPPP Sbjct: 104 KRHHHHHPPPPPPPH--LLHYYGHPPPP-----------PPPPPP 135 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = -2 Query: 614 PPPPXXXXXXXXXGGGGGGXXXXXXXXXXXGGG----GXPXXXXXPXXXGGGXGG 462 P PP GGGGGG GGG G P GG GG Sbjct: 82 PSPPFPSGNTRGGGGGGGGSSMQQQQPGGGGGGVQQFGAVAPEMSPFSPAGGGGG 136 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 609 PPXXXXXXXXXGGGGGGGXXXXXXGXXGXGG 517 PP GGGGGGG G G GG Sbjct: 9 PPGYTSGGGGGGGGGGGGGRGNGGGGFGGGG 39 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -1 Query: 612 PPPXXXXXXXXXGGGGGGGXXXXXXGXXGXGG 517 PP GGGGGGG G G GG Sbjct: 9 PPGYTSGGGGGGGGGGGGGRGNGGGGFGGGGG 40 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 SPP P PP P P P PP PP Sbjct: 58 SPPPASPPLPSATPPLAASPPPPPPPPPPRNSPSPPKPP 96 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 S P P PP P PPPPPPP Sbjct: 45 SNPNATPADTTPTSPPPASPPLPSATPPLAASPPPPPPP 83 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 +P PP P P P PPPPPPP Sbjct: 18 NPFNLPPWLRSLRCPFTFLCPPPPPPPPPPPPPPPPPPP 56 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 4/54 (7%) Frame = -2 Query: 611 PPPXXXXXXXXXGGGGGGXXXXXXXXXXXGGGGXP----XXXXXPXXXGGGXGG 462 PPP GGGGG GGGG P GGG GG Sbjct: 70 PPPPSYPSGGGGGGGGGTVMYTSPPPPYSGGGGGSSTGGGGIYYPPPTGGGGGG 123 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -2 Query: 575 GGGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGGK 459 GGGGGG GGGG GGG G + Sbjct: 113 GGGGGGGYGQRREGGYGGGGGYGGGRGGGGGYGGGYGSR 151 >12_01_0841 - 7873458-7874225 Length = 255 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG G GG Sbjct: 31 GGGGGGGEGGGGGGGEGGGGGSGYGEGYGQGGGASGGG 68 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 148 PPPPPPQESTPPPPPPPPP 166 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG G G P GG GG G Sbjct: 81 GGGGGGGGYGYGAGGGYGQAGGPYYGPYASGGGGGGAG 118 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 82 GGGGGGGYGYGAGGGYGQAGGPYYGPYASGGGGGGAGG 119 >09_04_0368 + 17005231-17005437,17005707-17005963,17006061-17006115, 17006196-17006276,17006357-17006453,17006560-17006627, 17006788-17006886,17007008-17007049,17007124-17007263, 17007882-17008018,17008275-17008444 Length = 450 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 615 PPPPXXXXXXXXXGGGGGGG 556 PPPP GGGGGGG Sbjct: 17 PPPPPPGSSSGRGGGGGGGG 36 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 140 PPPPHVPKAAPPPPPPPPP 158 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +1 Query: 460 FPPXPPPXXXGXXXXX-GXPPPPXXXXXXXXXXXP--PPPPP 576 FPP PPP G PPPP PPPPP Sbjct: 43 FPPPPPPGSTFVPLPQSGVPPPPPLGSFFVPPPQSRVPPPPP 84 >08_02_1256 + 25645085-25645396 Length = 103 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 61 PPPPPPPPPLPSPPPPPPP 79 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 61 PPPPPPPPPLPSPPPPPPP 79 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 425 PPPPPLPPPPPPPPPPPPP 443 >07_03_1636 + 28290642-28291574 Length = 310 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +3 Query: 465 PPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPP PP + P P PP PPP Sbjct: 151 PPPPPPQLFETAPPSPPYVPPPPDAYLRKPSPPSPPP 187 >07_01_0974 + 8211602-8212051 Length = 149 Score = 28.7 bits (61), Expect = 7.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 621 AAPPPPXXXXXXXXXGGGGGGG 556 AAP PP GGGGGGG Sbjct: 88 AAPSPPGVYNYSAPSGGGGGGG 109 >06_01_0941 + 7241050-7241331 Length = 93 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 615 PPPPXXXXXXXXXGGGGGGG 556 PPPP GGGGGGG Sbjct: 20 PPPPSSSSGKRSGGGGGGGG 39 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 208 PAPGTPVTPQPPPPPPPPP 226 >04_03_0212 + 12697854-12698549,12698655-12698930,12698991-12699038, 12699659-12699715,12700965-12701163,12702267-12702373, 12702586-12702759,12702844-12703083,12703638-12703693, 12704499-12704622 Length = 658 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 611 PPPXXXXXXXXXGGGGGGXXXXXXXXXXXGGGGXP 507 PPP GGGGGG GG G P Sbjct: 43 PPPLAISSPGCDGGGGGGGGGGGGGWWRQGGSGPP 77 >03_02_0865 - 11895257-11895340,11896004-11896069,11896297-11896355, 11896470-11896557,11897158-11897328,11897406-11897564, 11897653-11897835,11897931-11898012,11898753-11898959, 11899099-11899170,11901948-11902055,11902460-11902506 Length = 441 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 191 PTPPLPSQVPAPPPPPPPP 209 >03_02_0765 + 11000724-11002496 Length = 590 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGG GGG G G GG GG GG Sbjct: 147 GGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGVGG 184 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGG GGG G G GG GG GG Sbjct: 187 GGGAGGGLGSGAGGGGGLGGGAGGGGGLGGGAGGGLGG 224 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 197 GAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGG 234 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGG GGG G G GG GG GG Sbjct: 215 GGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGLGGGAGG 252 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 277 GAGGGGGLGGGTGGGGGLGGGTGGGGGLGGGAGGGLGG 314 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 327 GAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGG 364 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 G GGGGG G G GG GG GG Sbjct: 367 GAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGG 404 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 G GGGG GG G GG GGGG Sbjct: 175 GAGGGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGGG 212 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 G GGGG GG G GG GGGG Sbjct: 207 GAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGG 244 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 G GGGG GG G GG GGGG Sbjct: 225 GAGGGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGG 262 >02_04_0371 + 22434710-22435102,22435428-22435624,22435707-22435824, 22436458-22436574,22436702-22436803,22437431-22437487, 22437976-22438044,22438423-22438533,22438597-22438791, 22439023-22439121,22439656-22440222,22440344-22440568, 22441036-22441338,22441640-22441707,22441947-22442105, 22442230-22442475,22442549-22442680,22443243-22443351, 22444131-22444283,22444359-22444601,22444695-22444862, 22445013-22445156,22445238-22445699,22446495-22446791, 22446867-22447024,22447139-22447246,22447474-22447732 Length = 1752 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 14 PLPVLPGTFTTPPPPPPPP 32 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPP--PPPP 577 PP PP PP P P PP PPPP Sbjct: 966 PPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPPPP 1005 >01_06_0317 + 28425408-28426079,28426286-28426351 Length = 245 Score = 28.7 bits (61), Expect = 7.2 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 115 PEPETPPAPAPLPPPPPPP 133 >01_05_0490 + 22672241-22674679 Length = 812 Score = 28.7 bits (61), Expect = 7.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 +PP PP P P P PPPPPPP Sbjct: 637 APPQPPPPPPPTTRRSRKPPQPPSRP-----APPPPPPP 670 >01_05_0386 - 21683909-21685334,21685513-21685541 Length = 484 Score = 28.7 bits (61), Expect = 7.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGGA 619 PPPPPPP GGGA Sbjct: 170 PPPPPPPAFATAAASVDGGGA 190 >12_02_0478 + 19514509-19514940,19515749-19515820,19515954-19515986, 19516169-19516830,19516905-19517045,19518634-19518830, 19518878-19518965,19518987-19519041,19519501-19519571, 19519709-19519763,19519881-19519896,19520286-19520361, 19521202-19521240,19521312-19521333 Length = 652 Score = 28.3 bits (60), Expect = 9.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 557 PPPPPPPXXXXXXXXXGGGGAA 622 PPPPPPP GGG A Sbjct: 82 PPPPPPPQQQQQREAARGGGVA 103 >12_01_0838 - 7830944-7831444 Length = 166 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG G G GG GGGG Sbjct: 112 GGGGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGGGG 149 >11_06_0188 + 21036465-21036627,21036735-21036883,21037369-21037484, 21037939-21038101 Length = 196 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 571 GGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGG GG G GG GGGG Sbjct: 6 GGGGGRFGGGGGGRFGGGGGRGGRFGGGGRGGRGGGG 42 >08_02_0937 + 22801526-22802461 Length = 311 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 61 PPEPEEEEEVSSPPPPPPPP 80 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 91 PEAPPSPPLLALPPPPPPPP 110 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 52 PTLPPPPPRTLPPPPPPPPP 71 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 572 GGGGGXXXXXXXXXXXGGGGXPXXXXXPXXXGGGXGG 462 GGGGG GG G P GGG GG Sbjct: 25 GGGGGRGRGRDGAPYSGGRGRGQDGSYPGGRGGGYGG 61 >07_01_0516 - 3850252-3852870 Length = 872 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 16 PPQPPPTSRPLPPPPPPPPP 35 >06_01_0576 - 4073261-4073821,4073891-4074145 Length = 271 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 621 AAPPPPXXXXXXXXXGGGGGGG 556 AAPP P GGGGGGG Sbjct: 222 AAPPRPKTFFRSLSVGGGGGGG 243 >06_01_0486 - 3455030-3455770 Length = 246 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/53 (26%), Positives = 15/53 (28%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP + PP PP P P P PPP PP Sbjct: 86 PPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPP 138 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPPP Sbjct: 1923 PKQPPPHAPPPPP----PPPPVEGKPKPPPHAPPPPPP 1956 >05_05_0334 + 24156532-24156565,24156681-24156782,24157145-24157274, 24157361-24157445,24157525-24157666,24157762-24157894, 24157993-24158254,24158331-24158519,24158596-24158721, 24158809-24159195,24159288-24159398,24159629-24160423, 24161114-24161255,24161350-24162518,24162609-24162818, 24163010-24163478,24164037-24164464 Length = 1637 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G GG GG GG Sbjct: 1531 GGGGGGGNSGGWTDNIGSGGGGWGTGGGSSWAGGGDGG 1568 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 4 PPAATAPPPPPPPPPPPPPP 23 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 28.3 bits (60), Expect = 9.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGGK 458 GGGG G GG G GG GGGG+ Sbjct: 36 GGGGVGGRGGRGPPGGGGGRGYEPGGGRGYGGGGGGGGR 74 >04_01_0034 - 401208-402923 Length = 571 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 309 PPPPQQQRAKPSRPPPPPPP 328 >02_01_0016 + 110796-110979,111252-111768,111847-112213 Length = 355 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 205 PTPPSLPVDTMPPPPPPPPP 224 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,912,020 Number of Sequences: 37544 Number of extensions: 654841 Number of successful extensions: 22453 Number of sequences better than 10.0: 116 Number of HSP's better than 10.0 without gapping: 3019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10730 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2752963900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -