BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F02 (954 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 39 0.007 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 38 0.012 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 36 0.064 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 35 0.084 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 35 0.084 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 35 0.084 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.22 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.45 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.45 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 32 0.79 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.0 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 31 1.0 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 31 1.4 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 31 1.4 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 31 1.8 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.4 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.4 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 4.2 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 29 4.2 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 7.3 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 28 9.7 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 SPP PP PP P P PPPPPPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 SPP PP PP P P PPPPPPP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 SPP P PP P P PPPPPPP Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P P PPPPPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP P PP P P PPPPPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP P P PPPP PPPPPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P P PPPPPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPP PPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PP PPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 P PP PP P P PPPPPPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP P PP PPPPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P P PPPPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P P PPPPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 378 PPPPPPPPP--PSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPP PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPP PP P PP PPPPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP P PP P PP PPPPPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP P PP P P PPPPP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP P PP P P PPPP PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPP PP P PP PP PPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP P PP P PP P PPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP P P PPPPPPP Sbjct: 406 PPPPPP------------PPPPPPPAPPPPPPPPPPPP 431 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G G PPPP PPPPPP Sbjct: 712 PPPPPPPPPG---CAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 35.1 bits (77), Expect = 0.084 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP G P PP PPPPPP Sbjct: 712 PPPPPPPPP---GCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP PP PP P P PPPPP P Sbjct: 680 PPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP P P G PPPP PPPPP Sbjct: 679 PPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPP 716 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 PP PP G G PPPP PPPPP Sbjct: 726 PPPPPSPQPG---CAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = +3 Query: 405 KKXXXPPXXXXXKKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 KK PP + PPP PP P PP PPPPP Sbjct: 674 KKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +1 Query: 463 PPXPPP---XXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPP 717 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PP P P Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 467 PXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 P PP PP P PPPPPPP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PP P P Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 420 PPXXXXXKKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPP 572 PP PPPP P G P PP PPPPP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSP---QPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 476 PPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P PPPPPP Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 +PP PP PP P P PPPPPPP Sbjct: 952 APPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G PP P PPPPPP Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P G P P PPPPPP Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPPXXXXXXXXXGGG 611 PPPP PP P PPPPP GGG Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG 969 Score = 29.1 bits (62), Expect = 5.5 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 4/53 (7%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXP----PPPPPXXXXXXXXXGGG 612 P PPP G PPPP P PPPPP GGG Sbjct: 920 PPPPPPPGGNAPL---PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG 969 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.5 bits (78), Expect = 0.064 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G PPPP PPPPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPP---PPLPGGAAPPPPPP 694 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPP---PPLPGGAAPPPPPP 694 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 508 GXPPPPXXXXXXXXXXXPPPPPP 576 G PPPP PPPPPP Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPP 681 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 35.1 bits (77), Expect = 0.084 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 472 PPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PPP G PPPP PPPPPP Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 420 PPXXXXXKKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP K PP PP G P PP PPPPPP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 392 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPPP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPPP Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGG-PPPPPP 376 Score = 28.7 bits (61), Expect = 7.3 Identities = 20/74 (27%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +1 Query: 364 SXPXKXPPGXXXXXKKXKXPXXXGXXKKXXXFFPPX---PPPXXXGXXXXXGXPPPPXXX 534 S P PPG + P + PP PPP G PPP Sbjct: 213 SGPPPPPPGRGPSQRSLAPPPTGS--SRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAP 270 Query: 535 XXXXXXXXPPPPPP 576 PPPPP Sbjct: 271 PPPKRGSSNPPPPP 284 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 35.1 bits (77), Expect = 0.084 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 472 PPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PPP G PPPP PPPPPP Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 420 PPXXXXXKKXXXFFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP K PP PP G P PP PPPPPP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPP 304 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPPP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPPP Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGG-PPPPPP 288 Score = 28.7 bits (61), Expect = 7.3 Identities = 20/74 (27%), Positives = 22/74 (29%), Gaps = 3/74 (4%) Frame = +1 Query: 364 SXPXKXPPGXXXXXKKXKXPXXXGXXKKXXXFFPPX---PPPXXXGXXXXXGXPPPPXXX 534 S P PPG + P + PP PPP G PPP Sbjct: 125 SGPPPPPPGRGPSQRSLAPPPTGS--SRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAP 182 Query: 535 XXXXXXXXPPPPPP 576 PPPPP Sbjct: 183 PPPKRGSSNPPPPP 196 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 35.1 bits (77), Expect = 0.084 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G PPPP PPPPPP Sbjct: 363 PPPPPPPPVGGPPP---PPPPIEGRPPSSLGNPPPPPP 397 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP +PP PP PP P PPPPPPP Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP--PPIEGRPPSSLGNPPPPPPP 398 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +1 Query: 463 PPXPPPXXXGXXXXX---GXPPPP--XXXXXXXXXXXPPPPPP 576 PP PPP G PPPP PPPPPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 368 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.7 bits (61), Expect(2) = 0.22 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 23.8 bits (49), Expect(2) = 0.22 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 557 PPPPPPP 577 PPPPPPP Sbjct: 138 PPPPPPP 144 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP + P PP PPPPPP Sbjct: 50 PPPPPPPRFY---DNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 50 PPPPPPPRF---YDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPPXXXXXXXXXGGG 613 PP P P PPPPPPP GG Sbjct: 198 PPPPPPPGFPGGAPPPPPPPFGAPPPPALNGG 229 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPP 574 S P PP PP P P PPPPPP Sbjct: 300 SAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP G PPPP PPPPPP Sbjct: 290 PVPPPPPADG--SAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 476 PPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P PPPPPPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGE 460 GGGGGGG G G GG GG GG+ Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGD 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 75 GGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 73 GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G GG GG GG Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 31.9 bits (69), Expect = 0.79 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP + PP PP PP P P PPPP PP Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP-PNAPYPPPPYPPPPNPP 186 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 460 FPPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 +PP PPP PPPP PPPP Sbjct: 99 YPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 458 FSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 + PP PP PP P P PP PP P Sbjct: 94 YPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 467 PXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 P PP PP P P PP PPPP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPP 136 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/55 (29%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPP--PPPP 577 PP + PP PP P P P PPP PPPP Sbjct: 111 PPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP 165 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 +PP PP P P P PP PPPP Sbjct: 153 NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 458 FSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 + PP PP PP P P PPPP PP Sbjct: 156 YPPPLYPPPPNPPPPNAPYPPP-PYPPPPNPPYPPPPNPP 194 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +2 Query: 458 FSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 + PP PP P P P PP PPPP Sbjct: 187 YPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 Query: 458 FSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 + PP PP PP P P PP PPPP Sbjct: 161 YPPPPNPPPPNAPYPPPPYPPP-PNPPYPPPPNPPYPPPP 199 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 459 FPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 +PPPP PP P PP PP PPP Sbjct: 179 YPPPPNPPYP---PPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 458 FSP-PXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 FSP P PP PP P P P PPPP Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 PP PPP PPPP PPPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP P PP PPPP P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 P PP PP P P PPPP PP Sbjct: 131 PYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP P PP PP PPP Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 P PP PP P P PP PPPP Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 456 FFPPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 F P PP PP + P PP P PPP Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/53 (26%), Positives = 15/53 (28%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP + PP P P P P PPPP PP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PP P PP P PP PPPP P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 P PP PP P PP PP PPP Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPP P Sbjct: 204 PPPPNPPYPPPPNAPNPPYPP--PPNAPNPPYPPPPNP 239 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPP 483 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPP 484 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPP 485 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPP 486 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPP 487 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 +PP PP PP P P PPPPP P Sbjct: 463 APPPPPPPPPPPPP-----PPPPPPPPPPPFPPPPPPTP 496 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPP 1179 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 1161 PPPPPPPPSSPSPPPPPPPP 1180 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 1162 PPPPPPPSSPSPPPPPPPPP 1181 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 1165 PPPPSSPSPPPPPPPPPPPP 1184 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 1157 PPPPPPP----------PPPPPSSPSPPPPPPPPPPPP 1184 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P P PPPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPP 1177 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPP Sbjct: 1159 PPPPPPPPPPSSPSPPPPPP 1178 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 1163 PPPPPPSSPSPPPPPPPPPP 1182 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 1164 PPPPPSSPSPPPPPPPPPPP 1183 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 303 PPPPPLPAGVPAPPPPPPPP 322 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 6/43 (13%) Frame = +1 Query: 463 PPXPPPXXXGXXXXX------GXPPPPXXXXXXXXXXXPPPPP 573 PP PPP G PPPP PPPPP Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 758 PPPPAVPGEGARPPPPPPPP 777 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPPP Sbjct: 216 PPPPPPPSPSPPRPPPPPPP 235 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 476 PPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P PPPPP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPP P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPP P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGG 852 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GGGG Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGG 854 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGG G G GG GG GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGG GG GG G GG GGGG Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G GG GG GG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 792 GGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G GG GG GG Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGG 853 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG GG Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G GG GG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 574 GGGGGGXXXXXXXXXXXGGXGXPXXXXXXXXGGXGGGG 461 GGGGGG GG G GG GG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G PPPP PPPPPP Sbjct: 138 PPPPPPIAPATG---GPPPPP---PIAPATGGPPPPPP 169 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP PP P P PPPPPPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPP 201 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPPP Sbjct: 124 PSPPPPPTSPATRAPPPPPP----IAPATGGPPPPPP 156 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 466 PXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPP 573 P PPP P PP PPPPP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PP PPPP PPPPPP Sbjct: 110 PPPPPRAPETPSQAPSPPPPP----TSPATRAPPPPPP 143 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P P PPPPP Sbjct: 111 PPPPRAPETPSQAPSPPPPP 130 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P PPPPPPP Sbjct: 189 PPPSGGPPPPPPPPPPPPPP 208 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGGE 460 GGGGGGG G G GG GG G E Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDE 170 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 460 FPPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 FPP P G G PPP PPPPPP Sbjct: 263 FPPMGMPGMGGMPPP-GMPPPMPPGGMPPNMEQPPPPPP 300 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP P + P PP PPP PP Sbjct: 533 PPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPP 570 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP P P PPPP PPP PP Sbjct: 533 PPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLPP 570 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 472 PPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PPP PPPP PPPPPP Sbjct: 200 PPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPP 234 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 P PPP PPPP PPPPP Sbjct: 196 PTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPP 233 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP P PP PPPPPP Sbjct: 683 PPPPPPP---------PPPPPPPPPPPPQPSTPPPPPP 711 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP PPPP PPPPPP Sbjct: 683 PPPPPPPP---------PPPPPPPPPPPQPSTPPPPPP 711 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 683 PPPPPPPPPPPPPPPPPPP 701 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 683 PPPPPPPPPPPPPPPPPPP 701 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPP P Sbjct: 684 PPPPPPPPPPPPPPPPPPQP 703 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +1 Query: 463 PPXPPPXXXGXXXXX----GXPPPPXXXXXXXXXXXPPPPPP 576 PP PPP G G PPPP PPPPPP Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNG------PPPPPP 409 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 +PP PP P P P PPPPPPP Sbjct: 364 TPPPPPPTNKPPPPPPPTNGPPPPPPPTNG--PPPPPPP 400 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 464 PPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP P PP P P PPPPPPP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNG---PPPPPPP 410 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP G P PP PPPPPP Sbjct: 374 PPPPPPPTN------GPPPPP-----PPTNGPPPPPPP 400 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 462 PPPPXPPXXWXXXXXGXPXPPXXXXXXXXXXXPPPPPP 575 PPPP PP G P PP PPPPPP Sbjct: 384 PPPPPPPTN------GPPPPP-----PPTNGPPPPPPP 410 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +2 Query: 461 SPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPP---PPPP 577 SPP P PP P P PPP PPPP Sbjct: 56 SPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 460 FPPXPPPXXXGXXXXXGXPPPP 525 FPP PPP G PPPP Sbjct: 662 FPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 457 FFPPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 FF PPP G PPPP P PPPP Sbjct: 648 FFGGIPPPPPGGGM----FPPPPPPPPGGGVPGPPKPPPP 683 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 419 PPXXXXXXKKXXXFSPPXXPPXXXXXXXXXXXXPPXPXXPXXXXXXPPPPPPP 577 PP F PP PP P P P PPPPPPP Sbjct: 286 PPSNTPGMFASSGFQPPPPPPTDFA---------PPPPPPEPTSELPPPPPPP 329 >SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2749 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 475 PPXXXGXXXXXGXPPPPXXXXXXXXXXXPPPPPP 576 PP G PPPP P PPPP Sbjct: 873 PPGWENEGLPEGVPPPPSLFNDDLESLPPAPPPP 906 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 862 PRPRRPPPPPPPPPPPPPP 880 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPPXXXXXXXXXGGG 613 P P P PPPPPPP GG Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPPASSTGSTPGG 895 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 84 PPPPPPPASNVPAPPPPPP 102 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P P PPPPP Sbjct: 82 PPPPPPPPPASNVPAPPPPP 101 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPPP Sbjct: 83 PPPPPPPPASNVPAPPPPPP 102 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 521 PXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 231 PAPPPPPAAAPPPPPPPPP 249 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 228 PAAPAPPPPPAAAPPPPPPP 247 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 910 PPLPLAPEPPPPLPPPPPP 928 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +1 Query: 463 PPXPPPXXXGXXXXXGXPPPPXXXXXXXXXXXPPP--PPP 576 PP PP G G PPPP PPP PPP Sbjct: 455 PPNLPPPPGGMR---GMPPPPMGMYPPPRGFPPPPFGPPP 491 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPP 574 PP P P PPPPPP Sbjct: 298 PPAPPLPNFTSPSPPPPPP 316 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGG 80 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -1 Query: 576 GGGGGGGXXXXXXGXXGXGGXXXXXXXXXXXXGGXXGG 463 GGGGGGG G G G GG GG Sbjct: 45 GGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 P P P PPPPPPP Sbjct: 122 PSGPRAPPGGPGAPPPPPPP 141 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 518 PPXPXXPXXXXXXPPPPPPP 577 PP P P PPPPP P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,559,816 Number of Sequences: 59808 Number of extensions: 334165 Number of successful extensions: 5106 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2033 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2800542235 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -