BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_F01 (952 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 25 0.86 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 6.1 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 8.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 8.0 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 8.0 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 25.0 bits (52), Expect = 0.86 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 809 GAPPXPXXXPPXGGXGRXGXXGPXXPP 729 G PP PP GG G P PP Sbjct: 59 GIPPHHYGGPPSGGQPPQGMPYPRFPP 85 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 443 GGXXGGGGGGXXGXXGG 493 GG GGG G G GG Sbjct: 92 GGGRGGGRDGDRGDGGG 108 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 471 PPPPPPXXPPP 439 PPPP P PP Sbjct: 736 PPPPHPHHQPP 746 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 8.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 471 PPPPPPXXPPP 439 PPPP P PP Sbjct: 628 PPPPHPHHQPP 638 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.8 bits (44), Expect = 8.0 Identities = 11/30 (36%), Positives = 11/30 (36%), Gaps = 1/30 (3%) Frame = -2 Query: 528 PXXXPPXXXXXXPPXXPXXPPPP-PPXXPP 442 P P P P PP P PP PP Sbjct: 162 PALPPTGFLCNNYPPLPQVPPLPLPPIFPP 191 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,839 Number of Sequences: 336 Number of extensions: 2378 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26789147 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -