BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E24 (837 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 27 4.4 SPAC688.13 |scn1||TatD DNase family Scn1|Schizosaccharomyces pom... 26 7.6 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 26.6 bits (56), Expect = 4.4 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = +1 Query: 403 FKRVQDERTQHK-HRWRQ----VYDRREASTHHIRVIALLQGSLAVY 528 F R+ DE Q RW+Q VY + HH + I LQ + +Y Sbjct: 2679 FSRIIDECMQFSLRRWQQLPKRVYQSHVSLLHHFQEIVELQEAFGIY 2725 >SPAC688.13 |scn1||TatD DNase family Scn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 463 RREASTHHIRVIALLQGSLAVYWRDR 540 +R S H ++ ALL SLA +W R Sbjct: 179 QRAVSVHCVQTYALLYSSLAKFWDGR 204 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,277,145 Number of Sequences: 5004 Number of extensions: 66039 Number of successful extensions: 154 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 412451140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -