BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E19 (840 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G8.13c |mst2||histone acetyltransferase Mst2|Schizosacchar... 27 3.3 SPCC162.11c |||uridine kinase |Schizosaccharomyces pombe|chr 3||... 26 5.8 >SPAC17G8.13c |mst2||histone acetyltransferase Mst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 407 Score = 27.1 bits (57), Expect = 3.3 Identities = 24/82 (29%), Positives = 34/82 (41%) Frame = +3 Query: 270 AKEYNIEKSCXKYMNVDVVKQFMEMYKMGMLPRGETFVHTNELQMEXAVKVFRAPLLR*G 449 AK I +SC KYMN D V Q +M P G+ E+ + + +F R Sbjct: 128 AKNLYICESCLKYMNSDHVLQRHKMKCSWSYPPGD------EIYRDKNISIFEVDGQRQP 181 Query: 450 LRCFHEDCVLDERKDHGGMFVY 515 + C C+L + H M Y Sbjct: 182 IYC-QNLCLLAKMFLHSKMLYY 202 >SPCC162.11c |||uridine kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 454 Score = 26.2 bits (55), Expect = 5.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 Query: 155 LHQGNQW*TLXMKMKELCIMKLL 223 LH GNQW L M KELC + +L Sbjct: 305 LHNGNQWEGLQM-AKELCGVSVL 326 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,706,486 Number of Sequences: 5004 Number of extensions: 45944 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 414453330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -