BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E19 (840 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_472| Best HMM Match : Cas1p (HMM E-Value=0) 31 1.5 SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) 29 3.6 >SB_472| Best HMM Match : Cas1p (HMM E-Value=0) Length = 932 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 6/101 (5%) Frame = -3 Query: 430 ARKTLTAXSIWSSLVWTKVSPRGSMPILYISMNCLTTSTFMYLXQLFSMLYSLAISLMS- 254 A +T+ W V+ V P+ L+ +C+ ++YL + L + I + Sbjct: 774 AAALVTSVGFWWCHVF--VLPKFDYNKLHPYYSCIPLLAYIYLRNILPSLRTRYIHMFCW 831 Query: 253 SNMVGLEDMVKQLH-----DAKLLHLHVQGLPLVTLVKTIV 146 + LE + QLH DAK+L +++ G PL+ V Sbjct: 832 LGRITLETYISQLHVYLQADAKMLIVYIPGYPLLNFALATV 872 >SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) Length = 768 Score = 29.5 bits (63), Expect = 3.6 Identities = 20/62 (32%), Positives = 30/62 (48%) Frame = -3 Query: 433 GARKTLTAXSIWSSLVWTKVSPRGSMPILYISMNCLTTSTFMYLXQLFSMLYSLAISLMS 254 GA+K SI L W V+ R IL I+ L Y+ +L + Y+ ++SL S Sbjct: 650 GAKKRDAITSILKELHWLPVASRIDFKILTITHKALHNQAPEYITELLTP-YTPSLSLRS 708 Query: 253 SN 248 +N Sbjct: 709 AN 710 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,930,050 Number of Sequences: 59808 Number of extensions: 381510 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -