BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E19 (840 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 30 0.076 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 30 0.076 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 30 0.076 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 30 0.076 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 5.0 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 30.3 bits (65), Expect = 0.076 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +1 Query: 433 LYYAKDFDVFMRTACWMRERITEACSSTLLLXRAXTKXTARVSTWPAPYXIYP 591 LY + D+D + + W R+ I E +L + + PA Y IYP Sbjct: 115 LYNSADWDTYYKNMIWARDNINEGMFIYVLHLTVMHRPDLQGIVLPAIYEIYP 167 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 30.3 bits (65), Expect = 0.076 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +1 Query: 433 LYYAKDFDVFMRTACWMRERITEACSSTLLLXRAXTKXTARVSTWPAPYXIYP 591 LY + D+D + + W R+ I E +L + + PA Y IYP Sbjct: 115 LYNSADWDTYYKNMIWARDNINEGMFIYVLHLTVMHRPDLQGIVLPAIYEIYP 167 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 30.3 bits (65), Expect = 0.076 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +1 Query: 433 LYYAKDFDVFMRTACWMRERITEACSSTLLLXRAXTKXTARVSTWPAPYXIYP 591 LY + D+D + + W R+ I E +L + + PA Y IYP Sbjct: 115 LYNSADWDTYYKNMIWARDNINEGMFIYVLHLTVMHRPDLQGIVLPAIYEIYP 167 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 30.3 bits (65), Expect = 0.076 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +1 Query: 433 LYYAKDFDVFMRTACWMRERITEACSSTLLLXRAXTKXTARVSTWPAPYXIYP 591 LY + D+D + + W R+ I E +L + + PA Y IYP Sbjct: 115 LYNSADWDTYYKNMIWARDNINEGMFIYVLHLTVMHRPDLQGIVLPAIYEIYP 167 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 5.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 433 GARKTLTAXSIWSSLVWTKVSPRGSMPILY 344 GA + IW+S +W V G M I Y Sbjct: 592 GALVAVFRIDIWTSFLWNGVPLAGFMAICY 621 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,442 Number of Sequences: 2352 Number of extensions: 12693 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -