BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E17 (880 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-tran... 24 5.3 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 23 9.3 >AY070254-1|AAL59653.1| 225|Anopheles gambiae glutathione S-transferase E4 protein. Length = 225 Score = 24.2 bits (50), Expect = 5.3 Identities = 17/65 (26%), Positives = 30/65 (46%) Frame = -3 Query: 650 YPTGTSLEAPPEKAFHFNSGYLVFPFPSYRFHHPMA*HQGE*RTXQ*ELVS*TSXQHMLS 471 YP+ A A HF+SG L F +RF+ + G T Q ++ + +L+ Sbjct: 88 YPSDVVQRAKVNAALHFDSGVL---FARFRFYLEPILYYGATETPQEKIDNLYRAYELLN 144 Query: 470 NVLLE 456 + L++ Sbjct: 145 DTLVD 149 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 23.4 bits (48), Expect = 9.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 181 SFSQLNIWFKSLRPLGGF 128 ++ +LN W++S R L GF Sbjct: 179 NYPRLNAWYESCRVLKGF 196 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 678,844 Number of Sequences: 2352 Number of extensions: 12890 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 94266828 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -