BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E16 (831 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g19830.1 68416.m02512 C2 domain-containing protein low simila... 29 2.9 At5g45050.2 68418.m05524 disease resistance protein-related simi... 29 5.0 At5g45050.1 68418.m05523 disease resistance protein-related simi... 29 5.0 At3g50370.1 68416.m05508 expressed protein 28 6.6 At3g20830.1 68416.m02634 protein kinase family protein contains ... 28 6.6 At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 28 6.6 >At3g19830.1 68416.m02512 C2 domain-containing protein low similarity to GLUT4 vesicle protein [Rattus norvegicus] GI:4193489; contains Pfam profile PF00168: C2 domain Length = 666 Score = 29.5 bits (63), Expect = 2.9 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 425 KRPGTVKRPRCWRFSIGSAPLNEHHKNRRSSQR 523 K+P V+R +FS+G PL+ + RR+S+R Sbjct: 238 KKPDYVQRVEIKQFSLGDEPLSVRNVERRTSRR 270 >At5g45050.2 68418.m05524 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1344 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 287 PLPRSLTRCARSFGCGERYQLTQRR 361 P PRS RCA S GC R Q+ + R Sbjct: 1169 PYPRSYYRCASSKGCFARKQVERSR 1193 >At5g45050.1 68418.m05523 disease resistance protein-related similar to NL27 [Solanum tuberosum] GI:3947735; contains Pfam profiles PF03106: WRKY DNA -binding domain, PF00931: NB-ARC domain, PF00560: Leucine Rich Repeat Length = 1372 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 287 PLPRSLTRCARSFGCGERYQLTQRR 361 P PRS RCA S GC R Q+ + R Sbjct: 1197 PYPRSYYRCASSKGCFARKQVERSR 1221 >At3g50370.1 68416.m05508 expressed protein Length = 2179 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 475 LRPPERASQKSTLKSEVAKPDXTIKIPGVS 564 L PP+ + QK++ +SEV P + I G++ Sbjct: 794 LPPPQESRQKTSFRSEVEHPGPSTSIGGIN 823 >At3g20830.1 68416.m02634 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 408 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 278 PIRKPPLPARWPIH*CRKNLPHL 210 P PP P R P H CRKN P + Sbjct: 384 PSSAPPSPLRSPPHVCRKNDPFI 406 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 425 KRPGTVKRPRCWRFSIGSAPLNEHHKNRRSSQR 523 K+P V+R +FS+G PL+ + R++S+R Sbjct: 226 KKPDYVQRVEIKQFSLGDEPLSVRNVERKTSRR 258 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,760,277 Number of Sequences: 28952 Number of extensions: 307091 Number of successful extensions: 805 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -