BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E15 (880 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P50725 Cluster: Attacin-A precursor; n=14; Obtectomera|... 39 0.15 UniRef50_O96361 Cluster: Putative attacin; n=1; Hyphantria cunea... 35 2.4 >UniRef50_P50725 Cluster: Attacin-A precursor; n=14; Obtectomera|Rep: Attacin-A precursor - Trichoplusia ni (Cabbage looper) Length = 254 Score = 39.1 bits (87), Expect = 0.15 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = +2 Query: 554 HAGFKKFDTPFYXSSWEPHCGI 619 +AGFKKFDTP + S+WEP+ G+ Sbjct: 223 NAGFKKFDTPVFKSNWEPNFGL 244 >UniRef50_O96361 Cluster: Putative attacin; n=1; Hyphantria cunea|Rep: Putative attacin - Hyphantria cunea (Fall webworm) Length = 233 Score = 35.1 bits (77), Expect = 2.4 Identities = 20/58 (34%), Positives = 24/58 (41%) Frame = +3 Query: 459 LXAXXXXXIXXIDYXXXXIXNLFRSPSSSLDFTPASRSSIRLFTDLRGSPTVGFSFSK 632 L A + DY NLFR+PS+SLDF S+ F P G SK Sbjct: 174 LGASRTPFLQRTDYSANGNLNLFRNPSTSLDFNAGVSKSVSPFMQSSWLPNFGLRLSK 231 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 422,138,753 Number of Sequences: 1657284 Number of extensions: 4231292 Number of successful extensions: 6452 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6451 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 78702453312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -