BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E12 (850 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3138| Best HMM Match : Transaldolase (HMM E-Value=0) 211 5e-55 SB_56029| Best HMM Match : SEA (HMM E-Value=4.7) 30 2.1 SB_54543| Best HMM Match : ResIII (HMM E-Value=1.9) 30 2.7 SB_50794| Best HMM Match : Cys_knot (HMM E-Value=2.2) 30 2.7 SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044) 29 3.6 SB_49926| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_19016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 >SB_3138| Best HMM Match : Transaldolase (HMM E-Value=0) Length = 224 Score = 211 bits (516), Expect = 5e-55 Identities = 104/150 (69%), Positives = 117/150 (78%), Gaps = 1/150 (0%) Frame = +1 Query: 376 LSFDKDASIAKAIKFINLFAEHGIKKERILIKLASTWEGIQAAKELEKKHGIHCNLTLLF 555 LSFD +AS+AKA+KFI L+ E GI KER+LIKL+STWEGIQAA+ LE+ HGIHCNLTLLF Sbjct: 2 LSFDVEASVAKALKFIELYKEAGISKERVLIKLSSTWEGIQAARILERDHGIHCNLTLLF 61 Query: 556 SLYQAIACAEANVTLISPFVGRILDWYVEHT-KKTYEGKEXPGVVSVTKIYNYYKKFGYX 732 + QA+ACAEA VTLISPFVGRI DWYV T +K YE E PGV SVT IYNYYKKFGY Sbjct: 62 AFVQAVACAEAGVTLISPFVGRIYDWYVAKTGQKEYEPHEDPGVKSVTAIYNYYKKFGYK 121 Query: 733 TQVMGCHPFRNTGEIRELXGCDC*PISPQI 822 T VMG FRN G+I L GCD ISP + Sbjct: 122 TVVMGA-SFRNVGQITGLTGCDKLTISPSL 150 >SB_56029| Best HMM Match : SEA (HMM E-Value=4.7) Length = 111 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = +1 Query: 319 GCEILKIIPGRVSVEVDARLSFDKDASIA 405 GCE+L+ PG SV VDA + FDK A+++ Sbjct: 50 GCEVLRFRPG--SVVVDAIVYFDKVANVS 76 >SB_54543| Best HMM Match : ResIII (HMM E-Value=1.9) Length = 521 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 497 KQPKSWRRSMESIVILHCCSLCTKLLPVL 583 K + WR S E I+I CC + TK+L V+ Sbjct: 199 KPIEEWRLSWEVIIIDECCKVQTKVLRVI 227 >SB_50794| Best HMM Match : Cys_knot (HMM E-Value=2.2) Length = 396 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 497 KQPKSWRRSMESIVILHCCSLCTKLLPVL 583 K + WR S E I+I CC + TK+L V+ Sbjct: 60 KPIEEWRLSWEVIIIDECCKVQTKVLRVI 88 >SB_36758| Best HMM Match : NACHT (HMM E-Value=0.00044) Length = 899 Score = 29.5 bits (63), Expect = 3.6 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Frame = +1 Query: 364 VDARLSFDKDASIAKAIKFINLFAEHGIKKERILIKLASTWEGIQAAKELEKKHGIHCNL 543 +D + D +I K + L + + +LIKLA T E +ELE K I C+L Sbjct: 597 IDGDVMCDVLDAINKNTSLMRLSLYTPVTSDELLIKLAETIEQRTLIEELELK--ISCSL 654 Query: 544 TLLFSLYQAIACAEAN-VTLISPFVGR 621 T Y A A + N + + P++ + Sbjct: 655 THNAWSYFARALSTNNSIKALQPYINK 681 >SB_49926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 429 Score = 28.7 bits (61), Expect = 6.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -3 Query: 488 SQVEANLIKILSFLIPCSANKLINLIAFAMLASLSNDN 375 + V ANLI + F + S +LINL + ++A S +N Sbjct: 228 NNVAANLISSMRFYVMDSIGRLINLNGYRIVADNSGEN 265 >SB_19016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 28.7 bits (61), Expect = 6.3 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -2 Query: 708 VVNFCHGNYSGXFLALISLLCMFNIPIQYTTNKW*Y*CNIC 586 V+N+ N + LA S+ F+IP+Q KW Y N+C Sbjct: 4 VMNYFLVNLAVCDLAFTSVCLPFDIPVQENGFKWPYHPNLC 44 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,279,382 Number of Sequences: 59808 Number of extensions: 553868 Number of successful extensions: 1254 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1252 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -