BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E11 (875 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical ... 32 0.62 Z49937-6|CAA90185.2| 453|Caenorhabditis elegans Hypothetical pr... 31 1.1 Z81542-10|CAB04419.4| 411|Caenorhabditis elegans Hypothetical p... 30 1.9 Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical pr... 29 4.4 AF077534-3|AAC26290.1| 389|Caenorhabditis elegans Hypothetical ... 29 5.8 AC006663-2|AAF39900.2| 603|Caenorhabditis elegans Hypothetical ... 28 7.6 >AF047657-7|AAK18943.1| 424|Caenorhabditis elegans Hypothetical protein F37B4.7 protein. Length = 424 Score = 31.9 bits (69), Expect = 0.62 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 705 IDWRKGVRRSLSQNDVMSYFMEDVDLNTYMYYLHM 809 ++W++ + L N+V E VD ++YM YL M Sbjct: 183 VEWKEAYEKKLEDNNVQGNLKEIVDQSSYMDYLRM 217 >Z49937-6|CAA90185.2| 453|Caenorhabditis elegans Hypothetical protein F14F3.3 protein. Length = 453 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 221 ILQPTMFEDIKEIAKEYNIEKSCDKYMNVDVVK-QFMEMYKMGMLPRGETFVHTNELQME 397 I+ PT ++ NIE S D +N+D+ K +F + ++ GM + L + Sbjct: 272 IMGPTDLNAFDKLKTRENIEMSSDAIVNLDIPKVEFSDGFRDGMKAWNRSVQTWLALYVH 331 Query: 398 EAVKVFRV 421 VKV RV Sbjct: 332 SRVKVMRV 339 >Z81542-10|CAB04419.4| 411|Caenorhabditis elegans Hypothetical protein F49A5.7 protein. Length = 411 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +3 Query: 483 STEACSSTLLLPRASTEPTARVS-TCPLLTRSIPTSSLTAMSSVKPL 620 + EA SST LL ST TA +S T ++RSI + TA ++++PL Sbjct: 91 TNEASSSTKLL---STSSTAEISSTTRTVSRSIKPETSTASTTIRPL 134 >Z77657-6|CAB01150.2| 607|Caenorhabditis elegans Hypothetical protein F08H9.1 protein. Length = 607 Score = 29.1 bits (62), Expect = 4.4 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -2 Query: 463 RSPHENIEVLSVVEDSEDFD 404 R+P+ENI++L +DSED D Sbjct: 581 RAPYENIDLLLSTDDSEDID 600 >AF077534-3|AAC26290.1| 389|Caenorhabditis elegans Hypothetical protein K07D4.6 protein. Length = 389 Score = 28.7 bits (61), Expect = 5.8 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +3 Query: 480 GSTEACSS---TLLLPRASTEPTARVSTCPLLTRSIPTSSLTAMSSVKPL**R*LKPPRT 650 G+TE S+ T +TEPT ST T ++PTS+ T ++ T Sbjct: 257 GTTEETSTEPETTTTSTTTTEPTTTTSTTTQTTTTVPTSTSTISTT--------STTTTT 308 Query: 651 RSSGNTTASRVTDDNLV 701 ++ TT S T D+L+ Sbjct: 309 PTTTTTTTSTTTSDDLL 325 >AC006663-2|AAF39900.2| 603|Caenorhabditis elegans Hypothetical protein H24K24.4 protein. Length = 603 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -3 Query: 729 GGLPYASQSLPNCRQ*PVMP*YFQRTGSLAALVIF 625 GG PY +SL +CR P +FQ T S AA V++ Sbjct: 332 GGTPYIYESLLDCRFRVSPPAFFQ-TNSQAAAVLY 365 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,651,731 Number of Sequences: 27780 Number of extensions: 345247 Number of successful extensions: 862 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2202903780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -