BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E09 (850 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schi... 31 0.21 SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyc... 29 0.83 SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pomb... 29 1.1 SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 28 1.9 SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr ... 27 2.5 SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 27 2.5 SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosac... 27 3.4 SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|S... 27 4.4 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 4.4 SPAC1F5.09c |shk2|pak2|PAK-related kinase Shk2 |Schizosaccharomy... 26 5.9 >SPCC576.13 |swc5||chromatin remodeling complex subunit Swc5|Schizosaccharomyces pombe|chr 3|||Manual Length = 215 Score = 31.1 bits (67), Expect = 0.21 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = +2 Query: 167 LEEQLYNSVVVADYDSAVE--KSKH--LYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLW 334 L E + V D +S E K KH + + +KS + ++ K+++ NK+N +E A Q W Sbjct: 110 LAESNSSVAVEGDENSYAETPKKKHSLIRKRRKSPLDSSSAQKVLKKNKLNTLEQAQQNW 169 >SPBPB2B2.09c |||2-dehydropantoate 2-reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 29.1 bits (62), Expect = 0.83 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = +3 Query: 519 VSWKLIALWENNKVYFKILNTERNQYLVLGVGTNWNG 629 + +K I L++NN+ KILN R V+ VGT NG Sbjct: 254 IFFKCIPLFKNNEEAEKILNVNRLLDRVMFVGTKVNG 290 >SPAC22F3.04 |mug62||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1428 Score = 28.7 bits (61), Expect = 1.1 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 422 VHKLNRVFGEDKSELNWETIPDDVL 348 +H + EDKS+L +ETIPD VL Sbjct: 9 IHPVRHSKYEDKSKLPFETIPDPVL 33 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 27.9 bits (59), Expect = 1.9 Identities = 24/66 (36%), Positives = 32/66 (48%) Frame = +1 Query: 325 STLAPGAPRTSSGIVSQLSSDLSSPKTRLSLCTSATVSL*R*AMMFKATMADLPTATART 504 ST+AP + TSSG + SS T LS T A S + F T + LPT++A T Sbjct: 612 STVAPTSTFTSSGFNTTSGLPTSSASTPLSNSTVAPTSTFT-SSGFNTT-SGLPTSSAST 669 Query: 505 RQARES 522 + S Sbjct: 670 PSSNSS 675 >SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 774 Score = 27.5 bits (58), Expect = 2.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 248 KKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGL 346 K+ +T+ NKL+ ++ + +YAY L LQ L Sbjct: 35 KREAQLTDTPNKLLTDHDQSASDYAYALKLQQL 67 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 27.5 bits (58), Expect = 2.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 176 QLYNSVVVADYDSAVEKSKHLYEEKKS 256 QL N DY+ E++K LY+E+KS Sbjct: 184 QLQNENFKDDYEKIKEENKRLYKERKS 210 >SPAC12G12.01c ||SPAC630.02|ubiquitin-protein ligase E3|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 504 KTSPRVSWKLIALWENNKVYFKILNTERNQYLVLGVGTN 620 K SP+V+WK +W + K K +++ +LG G++ Sbjct: 28 KASPKVNWKTHIIWRSLK-NVKCIDSFHGNNEILGAGSS 65 >SPBC119.13c |prp31||U4/U6 x U5 tri-snRNP complex subunit Prp31|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 26.6 bits (56), Expect = 4.4 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 367 VSQLSSDLSSPKTRLSLCTSATV 435 VS L +DL + KT+LS SATV Sbjct: 166 VSSLLNDLDNSKTKLSFLPSATV 188 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 26.6 bits (56), Expect = 4.4 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 346 PRTSSGIVSQLSSDLSSP-KTRLSLCTSATVS 438 P T S + S LSS SSP T LS+ +S+T S Sbjct: 570 PSTFSSVSSILSSSTSSPSSTSLSISSSSTSS 601 >SPAC1F5.09c |shk2|pak2|PAK-related kinase Shk2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 589 Score = 26.2 bits (55), Expect = 5.9 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 153 TSESAAYRDATKRHRITIAGFIFGASSPVCYPRTNCQ 43 ++ S + RDA K H++T +G + C P+T Q Sbjct: 209 STTSYSIRDADKHHKLTTSGVTKMNITERCKPKTTIQ 245 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,149,240 Number of Sequences: 5004 Number of extensions: 59772 Number of successful extensions: 231 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 231 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -