BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E08 (840 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 27 0.22 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 6.1 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 22 8.1 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 27.1 bits (57), Expect = 0.22 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 38 DLNVGH-TPLCCSPVRISSALSLSTVHHGRQVRSSLRLH 151 DL++G T L CS R LS+S + GR + S R+H Sbjct: 621 DLHLGERTTLTCSVTRGDLPLSISWLKDGRAMGPSERVH 659 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 6.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 176 HHRSLGQSDAGEENYELGGHDVL 108 HH+ + AG + L GH VL Sbjct: 920 HHQIQVSTSAGLQTIRLSGHSVL 942 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 21.8 bits (44), Expect = 8.1 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 399 LEQSRQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQES-QKLAKKVSS 557 +EQ QN++ + H ++KNA +K + ++Q+S +KL K S Sbjct: 48 MEQDDQNLKCYLKCFMTKHGILDKNAEVDVQKALRHLPRSMQDSTKKLFNKCKS 101 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,172 Number of Sequences: 438 Number of extensions: 2675 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26945694 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -