BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E07 (827 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 3.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 3.9 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 22 5.2 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 22 5.2 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 22 5.2 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 Query: 413 GWLKNGRLSS 442 GWLK G+LSS Sbjct: 124 GWLKKGKLSS 133 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -2 Query: 523 SRSPYW*NQCRRHVERIHRLSSHQC 449 + P+ ++CR R H L H+C Sbjct: 243 NEKPFECDKCRGRFRRRHHLVHHKC 267 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 295 LVDQPG-KLRKLFPSILPKQFSXPWVRLTSVV 203 LV +P +LRK F +L K W+ L + V Sbjct: 136 LVTRPSYRLRKFFDELLFKCMKEKWIPLCNSV 167 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 295 LVDQPG-KLRKLFPSILPKQFSXPWVRLTSVV 203 LV +P +LRK F +L K W+ L + V Sbjct: 369 LVTRPSYRLRKFFDELLFKCMKEKWIPLCNSV 400 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.2 bits (45), Expect = 5.2 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 295 LVDQPG-KLRKLFPSILPKQFSXPWVRLTSVV 203 LV +P +LRK F +L K W+ L + V Sbjct: 369 LVTRPSYRLRKFFDELLFKCMKEKWIPLCNSV 400 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,856 Number of Sequences: 336 Number of extensions: 4076 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -