BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E07 (827 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 131 8e-31 SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 29 4.6 SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_33149| Best HMM Match : DSL (HMM E-Value=5.60519e-45) 28 8.0 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 131 bits (316), Expect = 8e-31 Identities = 64/110 (58%), Positives = 82/110 (74%) Frame = +1 Query: 433 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIRKKMCEIITRDVTN 612 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+HTQ++AIRKKM +IITR+V+ Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITREVST 61 Query: 613 SELREVVNKLIPDSIAKDIEKACHGI*PSARCLHPKXESVEXAPLSEISK 762 ++L+EVVNKLIPDSI KDIEK+C I P +H + V P +I K Sbjct: 62 NDLKEVVNKLIPDSIGKDIEKSCQSIYP-LHDVHIRKVKVLKKPKFDIGK 110 >SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1974 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +1 Query: 265 VFEVSLADLQADTDAERSFRKFRLIAEYVQ 354 +F + +D+QA+++ FR+F L+ EYV+ Sbjct: 1176 IFNNTFSDVQANSNQIWKFRRFELVMEYVE 1205 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -1 Query: 452 MLASMRVCHFLTIHLSLSVVRSMPWKLQSTLRPCTYSAINLNLRKDLSA--SVSACR 288 ++ SM +C ++ + +SL R + + +L PC Y ++++L + + S+S CR Sbjct: 948 VVMSMSLCRYVHVVMSLCPCRYVHVVMSMSLCPCRYVVMSMSLCRYIHVVMSMSLCR 1004 >SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 326 LRKDLSASVSACRSARETSKTLPFNPSEAIFV 231 LRK L S + RE + L FNP E+ +V Sbjct: 302 LRKQLIDMASVAKDLREIDELLKFNPDESAYV 333 >SB_33149| Best HMM Match : DSL (HMM E-Value=5.60519e-45) Length = 443 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/39 (30%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +2 Query: 134 DPFTRKDWYDVKASVYV--QQEASRHHACQPYPGXRKLL 244 +P +DWY K +VY + + H++C G R L Sbjct: 338 NPVCERDWYGTKCTVYCRPRDDEEGHYSCGAVDGRRVCL 376 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,890,894 Number of Sequences: 59808 Number of extensions: 546335 Number of successful extensions: 1372 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1368 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -