BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E07 (827 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 24 2.0 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 24 2.0 AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. 23 3.4 AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. 23 3.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 4.6 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 6.0 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 139 WVDNLLLNTFFTALRQAFIF 80 +++++ LNT++ LRQAF F Sbjct: 223 FIEDIGLNTYYFFLRQAFPF 242 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = -2 Query: 139 WVDNLLLNTFFTALRQAFIF 80 +++++ LNT++ LRQAF F Sbjct: 223 FIEDIGLNTYYFFLRQAFPF 242 >AY703618-1|AAU12614.1| 136|Apis mellifera wingless protein. Length = 136 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 737 KPPFPRSXXLMEPSP 781 KPP P+ +EPSP Sbjct: 70 KPPGPKDLVYLEPSP 84 >AY222546-1|AAP69221.1| 135|Apis mellifera wingless protein. Length = 135 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 737 KPPFPRSXXLMEPSP 781 KPP P+ +EPSP Sbjct: 71 KPPGPKDLVYLEPSP 85 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 4.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 332 LNLRKDLSASVSACRSARE 276 LNLR D+S+S S+ S+ E Sbjct: 365 LNLRTDISSSSSSISSSEE 383 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.2 bits (45), Expect = 6.0 Identities = 14/46 (30%), Positives = 18/46 (39%) Frame = -2 Query: 208 VVPTCLLLNIDGGLDIVPIFASEWVDNLLLNTFFTALRQAFIFPDR 71 V+P LL I G I WV +L+ + L I DR Sbjct: 94 VMPMALLYEISGNWSFGTIMCDLWVSFDVLSCTASILNLCMISVDR 139 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 223,444 Number of Sequences: 438 Number of extensions: 4470 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26460186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -