BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E06 (838 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0444 + 3141018-3141503,3141967-3142066,3142940-3142980 31 0.86 03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838,235... 29 6.1 12_01_0378 - 2946916-2947590 28 8.0 >06_01_0444 + 3141018-3141503,3141967-3142066,3142940-3142980 Length = 208 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/84 (23%), Positives = 35/84 (41%), Gaps = 1/84 (1%) Frame = +3 Query: 471 DDGRPAYGDGKDKTSPRVSWKLIALWENNKVYFKILNTERNQYLVL-GVGTNWNGDHMAF 647 DD R +D+ S +W + L N + + +YL +WN + + Sbjct: 24 DDDRSGVSLQQDRASVHAAWAVHILHFNGGDVLMLHSAANGRYLAAYRAEGSWNVERL-- 81 Query: 648 GVNSVDSFRAQWYLQPAKYDNDVL 719 +N + S WY ++Y +DVL Sbjct: 82 NLNRLPSLTFSWYALGSRYGDDVL 105 >03_01_0300 + 2350232-2352274,2352349-2352669,2352752-2352838, 2353031-2353708,2353800-2353964,2354139-2354433, 2354581-2354795,2354885-2355190,2355269-2355332, 2355426-2355665,2355783-2355886 Length = 1505 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 60 LGNTQDSTLQR*SPL*LFYVFSWHLCMLQIPTSLTTFWRSSFTIASSSPITTV 218 LG +T+Q + + +W + +L +P ++ W + IASS +T + Sbjct: 1059 LGGFASTTIQLLGIVAVMSKVTWQVLILIVPMAVACMWMQRYYIASSRELTRI 1111 >12_01_0378 - 2946916-2947590 Length = 224 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 74 GLDAPKMKPAIVILCLFVASLYAADSDVPNDILEEQLYNSVVVADYD 214 G+ ++P +++L ASL AA++ VP + ++ +VV D+D Sbjct: 87 GVHYDAIRPRLLLLLAGGASLGAANATVPGVFHQPRMSTTVVAIDFD 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,851,804 Number of Sequences: 37544 Number of extensions: 372059 Number of successful extensions: 1072 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1072 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2315199948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -