BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E02 (833 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 28 0.40 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 28 0.40 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 27 0.70 DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 26 1.2 AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylch... 24 6.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 6.6 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 8.7 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 27.9 bits (59), Expect = 0.40 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 524 LRP--PXRASQKSTLKSEVAKPDRTIKIPXVSPWEAPSCALLFPTLAAY 664 LRP P A Q+ EV + +P V+ W +P FPT +Y Sbjct: 48 LRPLIPDEAPQQPEKWEEVMADVERVIMPGVTHWHSPKFHAYFPTANSY 96 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 27.9 bits (59), Expect = 0.40 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +2 Query: 524 LRP--PXRASQKSTLKSEVAKPDRTIKIPXVSPWEAPSCALLFPTLAAY 664 LRP P A Q+ EV + +P V+ W +P FPT +Y Sbjct: 79 LRPLIPDEAPQQPEKWEEVMADVERVIMPGVTHWHSPKFHAYFPTANSY 127 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 27.1 bits (57), Expect = 0.70 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -2 Query: 460 SHVLSCVIPLILWITVLPPLSEVIPLAA 377 S +LS V+ L+L +LPP S V+PL A Sbjct: 269 SILLSLVVFLLLVSKILPPTSLVLPLIA 296 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 26.2 bits (55), Expect = 1.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 99 YIDEFGQTTTRMQ*KKCFICEICDAIALFVT 191 ++D GQ T R + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 >AY705394-1|AAU12503.1| 557|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 1 protein. Length = 557 Score = 23.8 bits (49), Expect = 6.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 491 YGSWPFAGLLLTCSFLRYPPDSVDN 417 +GSW + G ++ L+ PDS DN Sbjct: 166 FGSWTYDGYMVDLRHLQQTPDS-DN 189 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 6.6 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 Query: 179 SNSITNFTNKAFFSLHS 129 SN+I NFT KAF L S Sbjct: 520 SNNIENFTRKAFKDLPS 536 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 643 QESARGSFPGGNAWYLYSP 587 +E AR S G NAW +Y P Sbjct: 595 EEHARISGDGYNAWAVYQP 613 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 782,702 Number of Sequences: 2352 Number of extensions: 15286 Number of successful extensions: 41 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -