BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_E01 (862 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 52 1e-07 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 50 4e-07 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 47 3e-06 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 43 5e-05 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 42 1e-04 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 42 1e-04 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 40 5e-04 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 39 8e-04 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 38 0.002 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 35 0.013 SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M... 34 0.030 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 34 0.030 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 33 0.039 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 32 0.091 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 29 0.64 SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1... 26 1.9 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 28 2.0 SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pom... 27 2.6 SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyc... 27 2.6 SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizos... 27 3.4 SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 27 3.4 SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|... 27 4.5 SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2... 27 4.5 SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pomb... 26 7.9 SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ... 26 7.9 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 26 7.9 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 52.0 bits (119), Expect = 1e-07 Identities = 37/126 (29%), Positives = 37/126 (29%), Gaps = 4/126 (3%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPP--PPXXAPXAXXXXX 667 PP P P P P P P P PP PP P P PP P Sbjct: 1112 PPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPV 1171 Query: 668 XXXXXXXXKXXXNXPPPXXXGXXXPPPXPPXXXPXXXXPPXP-PPXPPPPXXXPXP-PXX 841 PP PP PP P P PP PPP P P P Sbjct: 1172 PAPSS-------GIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSA 1224 Query: 842 XXPPPP 859 PP P Sbjct: 1225 GLPPVP 1230 Score = 47.6 bits (108), Expect = 2e-06 Identities = 39/139 (28%), Positives = 41/139 (29%), Gaps = 16/139 (11%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXP----PPPXXAPXAXXX 661 P P P P P P P + PP PP P P P P + A Sbjct: 1074 PSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPV 1133 Query: 662 XXXXXXXXXXKXXXNXPPPXXXGXXXPPP-----XPPXXXPXXXXPPXP------PPXPP 808 K PP P P PP P PP P PP PP Sbjct: 1134 PVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPP 1193 Query: 809 PPXXXPXP-PXXXXPPPPP 862 P P P P PP PP Sbjct: 1194 PSEAPPVPKPSVGVPPVPP 1212 Score = 44.8 bits (101), Expect = 2e-05 Identities = 32/125 (25%), Positives = 33/125 (26%) Frame = +2 Query: 488 KXPPPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPPPPXXAPXAXXXXX 667 K PP P P P P P P PP P P PP P + Sbjct: 1020 KAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAP-PPVPAPSSEIPSIPA 1078 Query: 668 XXXXXXXXKXXXNXPPPXXXGXXXPPPXPPXXXPXXXXPPXPPPXPPPPXXXPXPPXXXX 847 P P P P P P P PP P P P P Sbjct: 1079 PSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSG 1138 Query: 848 PPPPP 862 PP P Sbjct: 1139 APPVP 1143 Score = 44.8 bits (101), Expect = 2e-05 Identities = 34/132 (25%), Positives = 35/132 (26%), Gaps = 6/132 (4%) Frame = +3 Query: 480 PXXXPPPPPXPPXGXLSHXXXXXXXXPPXTRXNPPKKLFXXXXPPXPPHHPXTXXPXXAP 659 P PP P P P PP PP P P + Sbjct: 1107 PSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSV 1166 Query: 660 XFPXXPPP----PPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPPX--PPXPXPXPXX 821 P P P PP PP PP P PPP PP P P Sbjct: 1167 AAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGL 1226 Query: 822 PPXPXXXPXPPP 857 PP P PP Sbjct: 1227 PPVPVPTAKAPP 1238 Score = 42.7 bits (96), Expect = 6e-05 Identities = 32/124 (25%), Positives = 32/124 (25%), Gaps = 2/124 (1%) Frame = +3 Query: 495 PPPPXPPXGXLSHXXXXXXXXPPXTRXNPPKKLFXXXXPPXPPHHPXTXXPXXAPXFPXX 674 PP P P P PP P PP P P P Sbjct: 1022 PPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPP--PVPAPSSEIPSIPAP 1079 Query: 675 PPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPPX--PPXPXPXPXXPPXPXXXPX 848 PP PP PP P P P PP P P PP P Sbjct: 1080 SGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGA 1139 Query: 849 PPPP 860 PP P Sbjct: 1140 PPVP 1143 Score = 41.9 bits (94), Expect = 1e-04 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXP---PPPXXAP 646 PP P P P P P G P P PP T PP P P PP AP Sbjct: 1189 PPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 41.1 bits (92), Expect = 2e-04 Identities = 33/127 (25%), Positives = 34/127 (26%), Gaps = 2/127 (1%) Frame = +3 Query: 480 PXXXPPPPPXPPXGXLSHXXXXXXXXPPXTRXNPPKKLFXXXXPPXPPHHPXTXXPXXAP 659 P PP P P P PP PP P P + P Sbjct: 1126 PSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPA--PSSGIPPVPK 1183 Query: 660 XFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPP--XPPXPXPXPXXPPXP 833 PP PP P P PP PP P P PP P P PP P Sbjct: 1184 PAAGVPPVPPPSEAPPVPKPSVGV---PPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVP 1240 Query: 834 XXXPXPP 854 P Sbjct: 1241 APSSEAP 1247 Score = 40.7 bits (91), Expect = 3e-04 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +1 Query: 709 PPPPXXXXXXPP-PXPPPXXXXXPXPPXTPPXPXPXPXXP--PPPXXXPPPPPP 861 PP P PP P P P P PP P P P PPP PP P P Sbjct: 1169 PPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTP 1222 Score = 40.3 bits (90), Expect = 3e-04 Identities = 30/127 (23%), Positives = 30/127 (23%) Frame = +1 Query: 481 PXKXPPPPXPXPXXTFPTXXXXXPXLPPXPXXTPPKNXFXXXXXXXXXXXXXXSXRRXXX 660 P PP P P P P PP P P S Sbjct: 1037 PSTAPPVPIPTSTPPVPKSSSGAPSAPP-PVPAPSSEIPSIPAPSGAPPVPAPSGIPPVP 1095 Query: 661 XXXXXXXXXXXXXXKXPPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXX 840 PP P P P P P P PP P P PP P Sbjct: 1096 KPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAP 1155 Query: 841 XPPPPPP 861 PP P Sbjct: 1156 SGAPPVP 1162 Score = 39.5 bits (88), Expect = 6e-04 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 3/86 (3%) Frame = +3 Query: 612 PXPPHHPXTXXPXXAPXFPXXP-PPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPP 788 P P P P P P PP PP PP P P P Sbjct: 1077 PAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVP 1136 Query: 789 X--PPXPXPXPXXPPXPXXXPXPPPP 860 PP P P PP P PP P Sbjct: 1137 SGAPPVPKPSVAAPPVPAPSGAPPVP 1162 Score = 38.7 bits (86), Expect = 0.001 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 4/97 (4%) Frame = +3 Query: 582 PKKLFXXXXPPXPPHHPXTXXPXXA-PXFPXXPPPPPXXXXXTXPPPXXXXXXX-PPXXP 755 PK P P P P A P P PP PP PP Sbjct: 1124 PKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPK 1183 Query: 756 PXXXPXXXPPPXPPXPXPXP--XXPPXPXXXPXPPPP 860 P PPP P P P PP P PP P Sbjct: 1184 PAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVP 1220 Score = 37.9 bits (84), Expect = 0.002 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 5/54 (9%) Frame = +1 Query: 715 PPXXXXXXPPPXPPPXXXXXPXPPXT--PPXPXPXPXXPP---PPXXXPPPPPP 861 PP PP P P P PP + PP P P PP P PP P P Sbjct: 1189 PPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 37.5 bits (83), Expect = 0.002 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXP---XPXXPPPPXXXPPPPPP 861 PP P P P P P P PP P P P P P PP P P Sbjct: 1131 PPVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKP 1184 Score = 37.1 bits (82), Expect = 0.003 Identities = 30/125 (24%), Positives = 32/125 (25%), Gaps = 3/125 (2%) Frame = +2 Query: 497 PPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPP---PPXXAPXAXXXXX 667 PP P P P +P PP PP P P PP P Sbjct: 986 PPKDHPPSAPLSKPVSTSPAAPL-ARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAPPVP 1044 Query: 668 XXXXXXXXKXXXNXPPPXXXGXXXPPPXPPXXXPXXXXPPXPPPXPPPPXXXPXPPXXXX 847 + P P P P P P PP P P P P Sbjct: 1045 IPTSTPPVPKSSSGAP----SAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVA 1100 Query: 848 PPPPP 862 PP P Sbjct: 1101 APPVP 1105 Score = 37.1 bits (82), Expect = 0.003 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPX-TPPXPXPX--PXXPPPPXXXPPPPPP 861 PP P PP PP P P PP P P P P P PP P P Sbjct: 1179 PPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVP 1232 Score = 35.9 bits (79), Expect = 0.007 Identities = 31/130 (23%), Positives = 32/130 (24%), Gaps = 8/130 (6%) Frame = +2 Query: 494 PPPPXPX-RGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXP-------PPPXXAPX 649 PP P P P P P P + PP PP P P PPP AP Sbjct: 1140 PPVPKPSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPP 1199 Query: 650 AXXXXXXXXXXXXXKXXXNXPPPXXXGXXXPPPXPPXXXPXXXXPPXPPPXPPPPXXXPX 829 P P P P P P P P P Sbjct: 1200 VPKPSVGVPPVPPPSTAPPVPTPS--AGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVP 1257 Query: 830 PPXXXXPPPP 859 P P P Sbjct: 1258 SPHSNASPSP 1267 Score = 35.5 bits (78), Expect = 0.010 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 703 KXPPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPP 852 K PP P PP P P P TPP P P P P P Sbjct: 1020 KAPPVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAP 1069 Score = 33.9 bits (74), Expect = 0.030 Identities = 29/123 (23%), Positives = 32/123 (26%), Gaps = 5/123 (4%) Frame = +3 Query: 480 PXXXPPPPPXPPXGX-LSHXXXXXXXXPPXTRXNPPKKLFXXXXPPXPPHHPXTXXPXXA 656 P PP P P + P + PP PP PP P + Sbjct: 1145 PSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPS 1204 Query: 657 PXFPXXPPP---PPXXXXXTX-PPPXXXXXXXPPXXPPXXXPXXXPPPXPPXPXPXPXXP 824 P PPP PP PP PP P P P P Sbjct: 1205 VGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVPSPHSNAS 1264 Query: 825 PXP 833 P P Sbjct: 1265 PSP 1267 Score = 33.5 bits (73), Expect = 0.039 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPX-TPPXPXPXPXXPPPPXXXPPPP 855 PP P PP PP P P PP P P PP P P Sbjct: 1198 PPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 30.3 bits (65), Expect = 0.37 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +3 Query: 666 PXXPPPPPXXXXXTXP---PPXXXXXXXPPXXPPXXXPXXXPPPXPPXPXPXPXXPPXPX 836 P PPP P + P PP P P P PP P PP P Sbjct: 967 PSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPL 1026 Query: 837 XXPXPPP 857 PP Sbjct: 1027 PSADAPP 1033 Score = 30.3 bits (65), Expect = 0.37 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 712 PPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 PP PP PPP P P P P PP P P Sbjct: 1198 PPVPKPSVGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAP 1247 Score = 29.9 bits (64), Expect = 0.49 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 4/85 (4%) Frame = +3 Query: 618 PPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXP-PXXPPXXXPXXXPPPXP 794 P P P AP P P P P P P P P Sbjct: 982 PTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPLPSADAPPIPVPSTAP 1041 Query: 795 PXPXPXPXXPPXPXX---XPXPPPP 860 P P P PP P P PPP Sbjct: 1042 PVPIPTST-PPVPKSSSGAPSAPPP 1065 Score = 27.9 bits (59), Expect = 2.0 Identities = 23/94 (24%), Positives = 24/94 (25%), Gaps = 1/94 (1%) Frame = +3 Query: 582 PKKLFXXXXPPXPPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPX 761 P+ PP P P P P P T P P Sbjct: 961 PRPAAPPSIPPPLPVSNILSSPTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSK 1020 Query: 762 XXPXXXPPPXPPXPXPXPXX-PPXPXXXPXPPPP 860 P P P P P P PP P PP P Sbjct: 1021 APPVPLPSADAP-PIPVPSTAPPVPIPTSTPPVP 1053 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/50 (30%), Positives = 15/50 (30%), Gaps = 1/50 (2%) Frame = +1 Query: 715 PPXXXXXXPPPXPPPXXXXXPXP-PXTPPXPXPXPXXPPPPXXXPPPPPP 861 PP PP P P P P P P P P P P P Sbjct: 1208 PPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSSVP 1257 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 50.0 bits (114), Expect = 4e-07 Identities = 37/129 (28%), Positives = 39/129 (30%), Gaps = 7/129 (5%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXX---PPX----PXPPPPXXAPXA 652 PPPP R PP G S P PP ++ PP P PPPP AP Sbjct: 313 PPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPST 372 Query: 653 XXXXXXXXXXXXXKXXXNXPPPXXXGXXXPPPXPPXXXPXXXXPPXPPPXPPPPXXXPXP 832 PPP G P P PP P P PP P Sbjct: 373 GRQPPPLSSSRAVSNPP-APPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSL 431 Query: 833 PXXXXPPPP 859 P P P Sbjct: 432 PPSAPPSLP 440 Score = 46.0 bits (104), Expect = 7e-06 Identities = 38/134 (28%), Positives = 40/134 (29%), Gaps = 12/134 (8%) Frame = +2 Query: 497 PPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPPPPXXAPXAXXXXXXXX 676 P P R P PPP P + P PP + P P PP P Sbjct: 352 PLPPQGRSAPPPPPPRSAPSTGRQP--PPLSSSRAVSNP---PAPPPAIPGRSAPALPPL 406 Query: 677 XXXXXKXXXNXPPPXXXGXXXPPPXPPXXXP-----XXXXPPXPP--PXPPP-----PXX 820 P P PP PP P PP PP P PP P Sbjct: 407 GNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAA 466 Query: 821 XPXPPXXXXPPPPP 862 P PP PPP P Sbjct: 467 PPLPPAAPAPPPAP 480 Score = 45.6 bits (103), Expect = 9e-06 Identities = 33/117 (28%), Positives = 33/117 (28%), Gaps = 4/117 (3%) Frame = +2 Query: 524 PFPPPXXGX----PXSPXNPXKPPQKTXXXXXPPXPXPPPPXXAPXAXXXXXXXXXXXXX 691 P PPP G P SP P P P PPP A Sbjct: 255 PIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPPPSSRVSAAALAAN------- 307 Query: 692 KXXXNXPPPXXXGXXXPPPXPPXXXPXXXXPPXPPPXPPPPXXXPXPPXXXXPPPPP 862 K PPP PP PP PPP P PP PPPP Sbjct: 308 KKRPPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPP 364 Score = 45.6 bits (103), Expect = 9e-06 Identities = 41/152 (26%), Positives = 44/152 (28%), Gaps = 10/152 (6%) Frame = +3 Query: 429 PXPPXXXXFFFGXXXXFPXXXPPPPPXPPXGXLSHXXXXXXXXPPXTRXNPPKK---LFX 599 P PP G P PPP PP S NPP + Sbjct: 338 PPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPAIPG 397 Query: 600 XXXPPXPP--HHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPX 773 P PP + T P P P PP P + PP P PP P Sbjct: 398 RSAPALPPLGNASRTSTPP-VPTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSA-PI 455 Query: 774 XXP-----PPXPPXPXPXPXXPPXPXXXPXPP 854 P P PP P P PP P P P Sbjct: 456 APPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 45.2 bits (102), Expect = 1e-05 Identities = 35/128 (27%), Positives = 37/128 (28%), Gaps = 6/128 (4%) Frame = +3 Query: 492 PPPPPXPPXGXLSHXXXXXXXXPPXTRXNPPKKLFXXXXPPXPPHHPXTXXPXXAPXFPX 671 PPP P P G +S NP + PP PP A Sbjct: 253 PPPIPPPSNGTVSSPPNSPPRPIAPVSMNPA--INSTSKPPLPPPSSRVSAAALAANKKR 310 Query: 672 XPPPPPXXXXXTXPPP---XXXXXXXPPXXPPXXXPXXXPPPXPPXPXPXPXXPP---XP 833 PPPPP PP PP PP P PP P PP P Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAP 370 Query: 834 XXXPXPPP 857 PPP Sbjct: 371 STGRQPPP 378 Score = 42.3 bits (95), Expect = 9e-05 Identities = 26/87 (29%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = +3 Query: 609 PPXPPHHPXTXXPXXAPXF--PXXPP-PPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXX 779 PP PP P + P P P PP PPP + PP P P Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSK 289 Query: 780 PPPXPPXPXPXPXXPPXPXXXPXPPPP 860 PP PP P PPPP Sbjct: 290 PPLPPPSSRVSAAALAANKKRPPPPPP 316 Score = 40.3 bits (90), Expect = 3e-04 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPX-PPXTPPXPXPXPXXPPPPXXXPPPPP 858 P PP PP PP P P PP P P PP P P PP Sbjct: 418 PTPPSLPPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPP 468 Score = 39.5 bits (88), Expect = 6e-04 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = +1 Query: 709 PP--PPXXXXXXPPPXP---PPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPP 858 PP PP PP P P P P PP P P PP P P PPP Sbjct: 424 PPSAPPSLPPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPP 478 Score = 37.1 bits (82), Expect = 0.003 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +1 Query: 718 PXXXXXXPPPXPPPXXXXXPXPPXTPPXP-XPXPXXPPPPXXXPPPPPP 861 P PPP PPP PP +PP P P P PP PP Sbjct: 246 PSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPPLPP 294 Score = 35.9 bits (79), Expect = 0.007 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 3/52 (5%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXP---PXTPPXPXPXPXXPPPPXXXPPPP 855 PP PP PP P P P PP P P PP P P P Sbjct: 436 PPSLPMGAPAAPPLPPSAPIAPPLPAGMPAAPPLPPAAPAPPPAPAPAPAAP 487 Score = 34.7 bits (76), Expect = 0.017 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXP-PPPXXXPPPPPP 861 PPPP PP PP PP P PP PPPPP Sbjct: 314 PPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPP 365 Score = 32.7 bits (71), Expect = 0.069 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 712 PPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 PPP P PP TPP P P P P PP PP Sbjct: 391 PPPAIPGRSAPALPP---LGNASRTSTPPVPTPPSLPPSAPPSLPPSAPP 437 Score = 28.3 bits (60), Expect = 1.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 742 PPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 PP PP P P P P P PPP PP Sbjct: 230 PPIPPSIPSSRP-PERVPSLSAPAPPPIPPPSNGTVSSPP 268 Score = 27.1 bits (57), Expect = 3.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 740 PPPXPPXXXPXXXXPPXPPPXPPPPXXXPXPPXXXXPPPP 859 P PP P P PP PP PP PP P Sbjct: 237 PSSRPPERVPSLSAPAPPPIPPPSNGTVSSPP--NSPPRP 274 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 47.2 bits (107), Expect = 3e-06 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +1 Query: 703 KXPPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 K PPPP P P P P P P P P P P PPPPPP Sbjct: 730 KSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 39.9 bits (89), Expect = 5e-04 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +2 Query: 692 KXXXNXPPPXXXGXXXPPPXPPXXXPXXXXPPXP----PPXPPPPXXXPXPPXXXXPPPP 859 K PPP P P P P PP P PP PPPP PPPP Sbjct: 726 KLLLKSPPPPPPAVIVPTPAPA---PIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Query: 860 P 862 P Sbjct: 783 P 783 Score = 37.9 bits (84), Expect = 0.002 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 7/50 (14%) Frame = +3 Query: 675 PPPPPXXXXXTX-------PPPXXXXXXXPPXXPPXXXPXXXPPPXPPXP 803 PPPPP T PPP PP PP PPP PP P Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 36.7 bits (81), Expect = 0.004 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = +3 Query: 609 PPXPPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPP 788 PP PP P P AP PPP P PPP PP P PPP Sbjct: 732 PPPPP--PAVIVPTPAPAPIPVPPPAPIMGGPPPPPP-------PPGVAGAGPPPPPPPP 782 Query: 789 XPPXPXPXPXXPPXPXXXPXP 851 P P P P Sbjct: 783 PAVSAGGSRYYAPAPQAEPEP 803 Score = 35.9 bits (79), Expect = 0.007 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 710 PPPXXXGXXXPPPXPPXXXPXXXXPPXPPPXPPPPXXXPXPPXXXXPPP 856 PPP PPP PP P PPP PPPP P P Sbjct: 752 PPPAPIMGGPPPPPPP---PGVAGAGPPPPPPPPPAVSAGGSRYYAPAP 797 Score = 34.7 bits (76), Expect = 0.017 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSPXN----PXKPPQKTXXXXXPPXPXPPPPXXA 643 PPPP P P P P +P P PP PP P PPP A Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPPAVSA 787 Score = 29.5 bits (63), Expect = 0.64 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 488 KXPPPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPPP 631 K PPPP P P P P +P P PP PP P PPP Sbjct: 730 KSPPPPPPAVIVPTPAP------API-PVPPP--APIMGGPPPPPPPP 768 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 43.2 bits (97), Expect = 5e-05 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 4/83 (4%) Frame = -1 Query: 862 GGGG---GXGXXXGXGGXXGXGXGXGGXGG-GXXXGXXXGGXXGGXXXXXXXGGGXVXXX 695 G GG G G G GG G G GG GG G G GG G GGG Sbjct: 196 GSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGG----- 250 Query: 694 FXGGGGGXXGKXGAXXGXXVXGW 626 G GGG G G G GW Sbjct: 251 LGGFGGGPGGFGGGPGGHGGPGW 273 Score = 41.1 bits (92), Expect = 2e-04 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = -3 Query: 860 GGGGGGXXXGGGGXXGXGXGXGGVWGGXGXXXXXGGGXGGG 738 GG GGG GG G G G GG GG G GG GGG Sbjct: 224 GGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGG 264 Score = 39.9 bits (89), Expect = 5e-04 Identities = 31/90 (34%), Positives = 32/90 (35%), Gaps = 1/90 (1%) Frame = -1 Query: 823 GXXGXGXGX-GGXGGGXXXGXXXGGXXGGXXXXXXXGGGXVXXXFXGGGGGXXGKXGAXX 647 G G G G GG GG G G GG GG F GG GG G G Sbjct: 184 GHNGGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGH--GGFGGGPGGFEGGPGGFG 241 Query: 646 GXXVXGWWGGXGGXXXXXSFLGGFXRVXGG 557 G G+ GG GG GG GG Sbjct: 242 GGP-GGFGGGLGGFGGGPGGFGGGPGGHGG 270 Score = 39.1 bits (87), Expect = 8e-04 Identities = 28/77 (36%), Positives = 29/77 (37%), Gaps = 4/77 (5%) Frame = -2 Query: 645 GAXXGGGGXGXGGXXXKXVFWGGXXGXWGEX----GXPXXGGGKGXPRXGXGGGGXFXGG 478 G GG G G GG +GG G GE G GGG G G GG G GG Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGG 246 Query: 477 XGXGPQKKXXXXXGXGG 427 G G G GG Sbjct: 247 FGGGLGGFGGGPGGFGG 263 Score = 39.1 bits (87), Expect = 8e-04 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = -3 Query: 860 GGGGGGXXXGGGGXXGXGXGXGGV--WGGXGXXXXXGGGXGGGXXXXXXGGGG 708 GGG GG G GG G GG +GG G GG GGG G GG Sbjct: 187 GGGFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGG 239 Score = 38.7 bits (86), Expect = 0.001 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -2 Query: 861 GGGGGXXXXGGXGXXXGGGGXGGGXGGXXXXGXXWGGXGGGXXXP 727 GGG G G G G GG GGG GG +GG GG P Sbjct: 227 GGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGPGGHGGP 271 Score = 38.3 bits (85), Expect = 0.001 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 860 GGGGGGXXXGGGGXXGXGXGXGGVWGGXGXXXXXGGGXGGGXXXXXXGGGG 708 GGG GG G GG G G G GG G GGG GG GGG Sbjct: 194 GGGSGGPPPGPGGFGGFG-GFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGG 243 Score = 36.3 bits (80), Expect = 0.006 Identities = 24/58 (41%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = -2 Query: 630 GGGXGXGGXXXKXVFWGGXXGXWG--EXGXPXXGGGKGXPRXGXGGGGXFXGGXGXGP 463 GG G GG GG G G E G GGG G G GG G GG G GP Sbjct: 208 GGFGGFGGEGHHHGGHGGFGGGPGGFEGGPGGFGGGPGGFGGGLGGFGGGPGGFGGGP 265 Score = 34.7 bits (76), Expect = 0.017 Identities = 25/70 (35%), Positives = 27/70 (38%) Frame = -1 Query: 688 GGGGGXXGKXGAXXGXXVXGWWGGXGGXXXXXSFLGGFXRVXGGXXXXXXXXWERXPXGG 509 G GG G G G G +GG GG GGF GG +E P G Sbjct: 189 GFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGG--------FEGGPGGF 240 Query: 508 XGGGGGFXXG 479 GG GGF G Sbjct: 241 GGGPGGFGGG 250 Score = 31.5 bits (68), Expect = 0.16 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -2 Query: 552 GXPXXGGGKGXPRXGXGGGGXFXGGXGXGPQKKXXXXXGXG-GFFXXG 412 G GGG G P G GG G F G G G G G G F G Sbjct: 189 GFGGFGGGSGGPPPGPGGFGGFGGFGGEGHHHGGHGGFGGGPGGFEGG 236 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 41.9 bits (94), Expect = 1e-04 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +1 Query: 712 PPPXXXXXXPP----PXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPP 855 PP PP P PPP P PP PP P P PPPP P Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 38.7 bits (86), Expect = 0.001 Identities = 21/69 (30%), Positives = 21/69 (30%) Frame = +3 Query: 588 KLFXXXXPPXPPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXX 767 KLF P P P AP P PPP PP PP PP Sbjct: 1676 KLFGGMAPAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPL 1735 Query: 768 PXXXPPPXP 794 P P P Sbjct: 1736 PASSAPSVP 1744 Score = 38.3 bits (85), Expect = 0.001 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +2 Query: 740 PPPXPPXXXPXXXXPPXPPP----XPPPPXXXPXPPXXXXPPPPP 862 PP P P P PPP PPPP P P PPPP Sbjct: 1690 PPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 36.3 bits (80), Expect = 0.006 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 P P P P P PP P P P PP P P PPP Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 34.3 bits (75), Expect = 0.023 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +3 Query: 666 PXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPPXPPXPXPXPXXPPXPXXXP 845 P P P + PP PP PP P PP PP P P PP P Sbjct: 1683 PAHPVSTPPVRPQSAAPPQMSAPTPPP--PPMSVPP--PPSAPPMPAGPPSAPPPPLPAS 1738 Query: 846 XPP 854 P Sbjct: 1739 SAP 1741 Score = 34.3 bits (75), Expect = 0.023 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 712 PPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPP 834 PPP PPP PP PP PP P P P P Sbjct: 1707 PPPPPMSVPPPPSAPP---MPAGPPSAPPPPLPASSAPSVP 1744 Score = 33.9 bits (74), Expect = 0.030 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 7/67 (10%) Frame = +3 Query: 654 APXFPXXPPP-------PPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPPXPPXPXPX 812 AP P PP PP T PPP PP PP PP PP P P Sbjct: 1682 APAHPVSTPPVRPQSAAPPQMSAPT-PPPPPMSVPPPPSAPPM---PAGPPSAPPPPLPA 1737 Query: 813 PXXPPXP 833 P P Sbjct: 1738 SSAPSVP 1744 Score = 33.1 bits (72), Expect = 0.052 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +1 Query: 715 PPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 PP PPP PP P P P P P P P P P P Sbjct: 1699 PPQMSAPTPPP-PPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 29.5 bits (63), Expect = 0.64 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXP 625 P PP P P PP P P P PP P P P Sbjct: 1705 PTPPPPPMSVPPPPSAPPMPAGP--PSAPPPPLPASSAPSVPNP 1746 Score = 28.7 bits (61), Expect = 1.1 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPP 852 PP P P P P P P P P PP P P Sbjct: 1448 PPAPMHAVAPVQPKAPGMVTNAPAPSSAPAPPAPVSQLPPAVPNVPVP 1495 Score = 28.7 bits (61), Expect = 1.1 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSPXNPXK--PPQKTXXXXXPPXPXPPPPXXAPXA 652 P P R PP P P P PP P PPPP A A Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSA 1740 Score = 27.9 bits (59), Expect = 2.0 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPP 852 PP PPP P P P PP P P P P Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 41.9 bits (94), Expect = 1e-04 Identities = 37/136 (27%), Positives = 39/136 (28%), Gaps = 13/136 (9%) Frame = +2 Query: 494 PPPPXPXR-GXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPX--------PPPPXXAP 646 PPPP + G PPP P P PP P PPPP Sbjct: 208 PPPPMHHKPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHE 267 Query: 647 XAXXXXXXXXXXXXXKXXXNXPPPXXXGXXXPPPXPPXXXPXXXXPPXPPPXPPPPXXXP 826 + P G PPP P P PP PP P P Sbjct: 268 PGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPP-PMHHEPGEHMPP-PPMHHEPGEHMP 325 Query: 827 XPPXXXXP----PPPP 862 PP P PPPP Sbjct: 326 PPPMHHEPGEHMPPPP 341 Score = 31.9 bits (69), Expect = 0.12 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 4/55 (7%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPP----PPPP 861 PPP P PP P P P PPPP P PPPP Sbjct: 222 PPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPPMHHEPGEHMPPPP 276 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 39.9 bits (89), Expect = 5e-04 Identities = 24/82 (29%), Positives = 25/82 (30%) Frame = +3 Query: 609 PPXPPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPP 788 P P P AP P PPP P + PP P PP P Sbjct: 128 PAPPTPQSELRPPTSAPPRPSIPPPSPA----SAPPIPSKAPPIPSSLPPPAQPAAPVKS 183 Query: 789 XPPXPXPXPXXPPXPXXXPXPP 854 P P PP P P PP Sbjct: 184 PPSAPSLPSAVPPMPPKVPPPP 205 Score = 35.9 bits (79), Expect = 0.007 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 PP P P PP P P PP P PP P PPP P Sbjct: 130 PPTPQSELRPPTSAPPRPSIPPPSPASAPPIP---SKAPPIPSSLPPPAQP 177 Score = 33.9 bits (74), Expect = 0.030 Identities = 29/125 (23%), Positives = 30/125 (24%), Gaps = 4/125 (3%) Frame = +3 Query: 492 PPPPPXPPXGXLSHXXXXXXXXPPXTRXNPPKKLFXXXXPPXPPHHPXTXXPXXAPXFPX 671 PP P PP PP PP P P P + P P P Sbjct: 124 PPSAPAPPTP--QSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPV 181 Query: 672 XPPPPPXXXXXTXPPPXXXXXXXP----PXXPPXXXPXXXPPPXPPXPXPXPXXPPXPXX 839 PP PP P P P PP P P P Sbjct: 182 KSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPNR 241 Query: 840 XPXPP 854 P P Sbjct: 242 GPSIP 246 Score = 33.9 bits (74), Expect = 0.030 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +1 Query: 715 PPXXXXXXPPPXPPPXXXXXPXPPXTPPXPX--PXPXXPPPPXXXPPPPP 858 PP P PP P P PP P P P P P PP P Sbjct: 139 PPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAP 188 Score = 32.7 bits (71), Expect = 0.069 Identities = 23/81 (28%), Positives = 24/81 (29%), Gaps = 1/81 (1%) Frame = +3 Query: 618 PPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPPXPP 797 PP P P P PP P + PPP P P PP P Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRP-----SIPPPSPASAPPIPSKAPPIPSSLPPPAQPA 178 Query: 798 XP-XPXPXXPPXPXXXPXPPP 857 P P P P P PP Sbjct: 179 APVKSPPSAPSLPSAVPPMPP 199 Score = 32.7 bits (71), Expect = 0.069 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +1 Query: 712 PPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPP-PXXXPPPPP 858 PPP P P P PP P P P P P PP PP Sbjct: 150 PPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPP 199 Score = 29.9 bits (64), Expect = 0.49 Identities = 21/93 (22%), Positives = 22/93 (23%) Frame = +3 Query: 525 LSHXXXXXXXXPPXTRXNPPKKLFXXXXPPXPPHHPXTXXPXXAPXFPXXPPPPPXXXXX 704 L H P + PP P P P P A P PP Sbjct: 112 LRHIGKSSASAAPPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSL 171 Query: 705 TXPPPXXXXXXXPPXXPPXXXPXXXPPPXPPXP 803 P PP P PP P P Sbjct: 172 PPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPP 204 Score = 29.1 bits (62), Expect = 0.85 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 782 PPXPPPXPPPPXXXPXPP 835 PP PPP P P P PP Sbjct: 5 PPPPPPAPAPAAAAPAPP 22 Score = 28.3 bits (60), Expect = 1.5 Identities = 31/125 (24%), Positives = 34/125 (27%), Gaps = 2/125 (1%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPPPPXXAPXAXXXXXXX 673 PP P R PPP +P P K P PP P P +P + Sbjct: 139 PPTSAPPR-PSIPPPSPAS--APPIPSKAPP--IPSSLPPPAQPAAPVKSPPSAPSLPSA 193 Query: 674 XXXXXXKXXXNXPPPXXXGXXXPPPXPPXXX--PXXXXPPXPPPXPPPPXXXPXPPXXXX 847 K PPP P P P P P P P Sbjct: 194 VPPMPPKVP---PPPLSQAPVANTSSRPSSFAPPAGHAPNVTSESPKFPNRGPSIPSASV 250 Query: 848 PPPPP 862 PP PP Sbjct: 251 PPVPP 255 Score = 27.9 bits (59), Expect = 2.0 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 478 SPXKXPPPPXPXPXXTFPTXXXXXPXL-PPXPXXTPP 585 +P P PP P PT P + PP P PP Sbjct: 123 APPSAPAPPTPQSELRPPTSAPPRPSIPPPSPASAPP 159 Score = 26.2 bits (55), Expect = 6.0 Identities = 12/29 (41%), Positives = 12/29 (41%), Gaps = 2/29 (6%) Frame = +1 Query: 781 PPXTPPXPXPXPXXPPPPXXXPPP--PPP 861 PP P P P PP P P PPP Sbjct: 124 PPSAPAPPTPQSELRPPTSAPPRPSIPPP 152 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 39.1 bits (87), Expect = 8e-04 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 781 PPXTPPXPXPXPXXPPPPXXXPPPPP 858 PP PP P P P PP PPPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 34.3 bits (75), Expect = 0.023 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 740 PPPXPPXXXPXXXXPPXPPPXPPPP 814 PPP PP P PP PP PPPP Sbjct: 9 PPPPPP---PPGFEPPSQPPPPPPP 30 Score = 32.7 bits (71), Expect = 0.069 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 Query: 728 GXXXPPPXPPXXXPXXXXPPXPPP 799 G PPP PP P PP PPP Sbjct: 7 GNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 29.1 bits (62), Expect = 0.85 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 740 PPPXPPXXXPXXXXPPXPPPXPPPP 814 PP PP P P P PPPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPP 29 Score = 29.1 bits (62), Expect = 0.85 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 767 PXXXXPPXPPPXPPPPXXXPXPP 835 P PP PPP PP P PP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPP 28 Score = 27.9 bits (59), Expect = 2.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 657 PXFPXXPPPPPXXXXXTXPPP 719 P P PPPPP + PPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPP 26 Score = 26.6 bits (56), Expect = 4.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPP 786 PPPP PP PPP P PP Sbjct: 10 PPPPPPPGFEPPSQPPP-----PPPP 30 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTP 795 PPPP PP PPP TP Sbjct: 13 PPPPGFEPPSQPPPPPPPGYVKKRKNKTP 41 Score = 25.8 bits (54), Expect = 7.9 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 Query: 560 PXNPXKPPQKTXXXXXPPXPXPPPP 634 P NP PP P PPPP Sbjct: 6 PGNPPPPPPPPGFEPPSQPPPPPPP 30 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 37.5 bits (83), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -3 Query: 860 GGGGGGXXXGG-GGXXGXGXGXGGVWGGXGXXXXXGGGXGGG 738 GGG GG GG GG G G GG GG G GG GG Sbjct: 29 GGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 36.7 bits (81), Expect = 0.004 Identities = 27/76 (35%), Positives = 28/76 (36%) Frame = -1 Query: 862 GGGGGXGXXXGXGGXXGXGXGXGGXGGGXXXGXXXGGXXGGXXXXXXXGGGXVXXXFXGG 683 G GG G GG G G GG GGG G GG G GG G Sbjct: 6 GSRGGRGG--SRGGRGGFNGGRGGFGGGRG-GARGGGRGGARGGRGGRGGAR-----GGR 57 Query: 682 GGGXXGKXGAXXGXXV 635 GG G+ GA G V Sbjct: 58 GGSSGGRGGAKGGAKV 73 Score = 36.7 bits (81), Expect = 0.004 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = -3 Query: 860 GGGGGGXXXGGGGXXGX-GXGXGGVWGGXGXXXXXGGGXGGGXXXXXXGGGG 708 GG GG GGG G G G GG GG G GG GG GG Sbjct: 19 GGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 35.9 bits (79), Expect = 0.007 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = -3 Query: 860 GGGGGGXXXGGGGXXGXGXGXGGVWGGXGXXXXXGGGXGGGXXXXXXGGGG 708 GG GG GG G G G GG GG G G GG G G Sbjct: 12 GGSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSG 62 Score = 31.1 bits (67), Expect = 0.21 Identities = 21/60 (35%), Positives = 22/60 (36%) Frame = -2 Query: 645 GAXXGGGGXGXGGXXXKXVFWGGXXGXWGEXGXPXXGGGKGXPRXGXGGGGXFXGGXGXG 466 G GG G GG GG G G G GG+G R G GG GG G Sbjct: 12 GGSRGGRGGFNGGRGGFGGGRGGARGG-GRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 Score = 31.1 bits (67), Expect = 0.21 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = -2 Query: 861 GGGGGXXXXGGXGXXXGG--GGXGGGXGGXXXXGXXWGGXGGGXXXPXXXGGG 709 GG GG GG G GG G GGG GG GG GG GG Sbjct: 16 GGRGGFN--GGRGGFGGGRGGARGGGRGGARGGRGGRGGARGGRGGSSGGRGG 66 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 35.1 bits (77), Expect = 0.013 Identities = 30/111 (27%), Positives = 31/111 (27%), Gaps = 1/111 (0%) Frame = +2 Query: 530 PPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPPPPXXAPXAXXXXXXXXXXXXXKXXXNX 709 PPP P + P PP P PPPP A N Sbjct: 167 PPPSF----QPPSAAAPATSLPSDYNPPPPPPPPPAVEDQAADA--------------NE 208 Query: 710 PPPXXX-GXXXPPPXPPXXXPXXXXPPXPPPXPPPPXXXPXPPXXXXPPPP 859 P G P PP P P PP PPPP P P P Sbjct: 209 PDDYYSSGRAVSPEIPPTYTPKQADPLPAPPPPPPPTLPPQSTNTSQLPMP 259 Score = 33.9 bits (74), Expect = 0.030 Identities = 31/113 (27%), Positives = 32/113 (28%), Gaps = 1/113 (0%) Frame = +3 Query: 492 PPPPPXPPXGXLSHXXXXXXXXPPXTRXNPPKKLFXXXXPPXPPHHPXTXXPXXAPXFPX 671 PPPPP PP N P + P P T P A P Sbjct: 189 PPPPPPPPPAVEDQAADA----------NEPDDYYSSGRA-VSPEIPPTYTPKQADPLPA 237 Query: 672 XPPPPPXXXXXTXPPPXXXXXXXP-PXXPPXXXPXXXPPPXPPXPXPXPXXPP 827 PPPPP T PP P P P PP P PP Sbjct: 238 PPPPPP----PTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATPSQPPRPP 286 Score = 29.1 bits (62), Expect = 0.85 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 742 PPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 P P P P PP P PPPPPP Sbjct: 156 PTVSAPNSMVSPPPSFQPPSAAAPATSLPSDYNPPPPPPP 195 Score = 29.1 bits (62), Expect = 0.85 Identities = 30/126 (23%), Positives = 30/126 (23%), Gaps = 3/126 (2%) Frame = +1 Query: 493 PPPPXPXPXXTFPTXXXXXPXLPPXPXXTPPKNXFXXXXXXXXXXXXXXSXRRXXXXXXX 672 PPP P P PP P PP S R Sbjct: 167 PPPSFQPPSAAAPATSLPSDYNPPPPPPPPPAVE-DQAADANEPDDYYSSGRAVSPEIPP 225 Query: 673 XXXXXXXXXXKXPPPPXXXXXXPPPXPPPXXXXX---PXPPXTPPXPXPXPXXPPPPXXX 843 PPPP PPP PP P P PPPP Sbjct: 226 TYTPKQADPLPAPPPP------PPPTLPPQSTNTSQLPMPSRNVNNLGSQVNIPPPPATP 279 Query: 844 PPPPPP 861 PP P Sbjct: 280 SQPPRP 285 >SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||Manual Length = 500 Score = 33.9 bits (74), Expect = 0.030 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 859 GGGGXGXXXGXGGXXGXGXGXGGXGGGXXXGXXXGGXXGG 740 GGG G G GG G G G GG GGG G GG G Sbjct: 446 GGGSRGGRGGFGGRGGFG-GRGGFGGG--RGRGRGGARSG 482 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 33.9 bits (74), Expect = 0.030 Identities = 23/85 (27%), Positives = 24/85 (28%), Gaps = 2/85 (2%) Frame = +3 Query: 612 PXPPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXP-PPXXXXXXXPPXXP-PXXXPXXXPP 785 P P P AP P P P + P PP P P P P Sbjct: 542 PSAPQRPAAPVVPEAPSVPQRPAVPVVPEALSVPQPPVAPVAPEVPSVPQPPVAPVVPEA 601 Query: 786 PXPPXPXPXPXXPPXPXXXPXPPPP 860 P P P P P P P P Sbjct: 602 PSVPQPPVAPVAPEVPSVPQRPAVP 626 Score = 29.1 bits (62), Expect = 0.85 Identities = 22/83 (26%), Positives = 23/83 (27%), Gaps = 2/83 (2%) Frame = +3 Query: 612 PXPPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXP-PPXXXXXXXPPXXPPXXX-PXXXPP 785 P P P P P P P + P PP P P P Sbjct: 602 PSVPQPPVAPVAPEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPVVPEA 661 Query: 786 PXPPXPXPXPXXPPXPXXXPXPP 854 P P P P P P P PP Sbjct: 662 PSVPQPPAAPVVPEVP-SVPQPP 683 Score = 28.7 bits (61), Expect = 1.1 Identities = 21/83 (25%), Positives = 21/83 (25%) Frame = +3 Query: 612 PXPPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPPX 791 P P P P AP P P P PP P P P Sbjct: 581 PVAPEVPSVPQPPVAPVVPEAPSVPQ-------PPVAPVAPEVPSVPQRPAVPVVPEAPS 633 Query: 792 PPXPXPXPXXPPXPXXXPXPPPP 860 P P P P P P P Sbjct: 634 VPQPPAAPVVPEVPSVPQRPAVP 656 Score = 27.1 bits (57), Expect = 3.4 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 PP P PP P P P P P P P PP P Sbjct: 592 PPVAPVVPEAPSVPQPPVAPVAPEVPSVPQRP-AVPVVPEAPSVPQPPAAP 641 Score = 26.2 bits (55), Expect = 6.0 Identities = 25/107 (23%), Positives = 27/107 (25%), Gaps = 3/107 (2%) Frame = +2 Query: 551 PXSPXNPXKP--PQKTXXXXXPPXPXPPPPXXAPXAXXXXXXXXXXXXXKXXXNXPPPXX 724 P P P P P+ P P P AP + P Sbjct: 512 PSVPQPPAAPVVPEAPSVHQPPAAPVAPEVPSAPQRPAAPVVPEAPSVPQRPAVPVVPEA 571 Query: 725 XGXXXPPPXP-PXXXPXXXXPPXPPPXPPPPXXXPXPPXXXXPPPPP 862 PP P P PP P P P P PP P P Sbjct: 572 LSVPQPPVAPVAPEVPSVPQPPVAPVVPEAPSV-PQPPVAPVAPEVP 617 Score = 26.2 bits (55), Expect = 6.0 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 712 PPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPPPP 861 P P P P P P P P P P P P P PP Sbjct: 635 PQPPAAPVVPEVPSVPQRPAVPVVPEAPSVPQP-PAAPVVPEVPSVPQPP 683 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 33.5 bits (73), Expect = 0.039 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 675 PPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPPXPPXPXP 809 PPPPP PP PP PP P P P P Sbjct: 1883 PPPPPMALPKAGPPSAAPTSALPPAGPPAGATAISGNPGMPAPVP 1927 Score = 29.1 bits (62), Expect = 0.85 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +2 Query: 497 PPPXPXRGXPFPPPXXGXPXSPXNPXKPPQ-KTXXXXXPPXPXPPP 631 PPP P P P P S P PP T P P P P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPPAGATAISGNPGMPAPVP 1927 Score = 27.5 bits (58), Expect = 2.6 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 742 PPXPPPXXXXXPXPPXTPPXPXPXPXXPP 828 PP PPP PP P P PP Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPP 1910 Score = 27.1 bits (57), Expect = 3.4 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 740 PPPXPPXXXPXXXXPPXPPPXPPPPXXXP 826 PPP PP P P P PP P Sbjct: 1882 PPPPPPMALPKAGPPSAAPTSALPPAGPP 1910 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 32.3 bits (70), Expect = 0.091 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -3 Query: 860 GGGGGGXXXGGGGXXGXGXGXGGVWGGXGXXXXXGGGXGGGXXXXXXGG 714 GG GG GG G G G +GG G GGG GG GG Sbjct: 138 GGRGGFRGGRGGSRGGFGGNSRGGFGG-GSRGGFGGGSRGGSRGGFRGG 185 Score = 29.9 bits (64), Expect = 0.49 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 861 GGGGGXXXXGGXGXXXG--GGGXGGGXGGXXXXGXXWGGXGG 742 G GG GG G G GG GG GG G G GG Sbjct: 136 GRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGG 177 Score = 28.3 bits (60), Expect = 1.5 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -2 Query: 582 GGXXGXWGEXGXPXXGGGKGXPRXGXGGG--GXFXGGXGXG 466 G G G G GG+G R G GG G F GG G Sbjct: 129 GARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGG 169 Score = 27.9 bits (59), Expect = 2.0 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = -2 Query: 582 GGXXGXWGEXGXPXXGGGKGXPRXGXGGG--GXFXGGXGXGPQKKXXXXXGXGGF 424 GG G G G G G G R G GGG G F GG G + GGF Sbjct: 138 GGRGGFRGGRGGSRGGFG-GNSRGGFGGGSRGGF-GGGSRGGSRGGFRGGSRGGF 190 Score = 27.1 bits (57), Expect = 3.4 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 4/53 (7%) Frame = -3 Query: 860 GGGGGGXXXGG-GGXXGXGXGXGGVWGGXGXXXXXG---GGXGGGXXXXXXGG 714 G G GG GG G G G +GG G GG GGG GG Sbjct: 129 GARNGPAGRGGRGGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGG 181 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 29.5 bits (63), Expect = 0.64 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 791 PPPXPPPPXXXPXPPXXXXPPPPP 862 P P PP P P PPPPP Sbjct: 725 PQVTPAPPTPAPTPAVKHHPPPPP 748 Score = 26.6 bits (56), Expect = 4.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 781 PPXTPPXPXPXPXXPPPPXXXPPPPP 858 P TP P P P P PPPPP Sbjct: 725 PQVTPAPPTPAP--TPAVKHHPPPPP 748 >SPAC1F5.04c |cdc12||formin Cdc12|Schizosaccharomyces pombe|chr 1|||Manual Length = 1841 Score = 25.8 bits (54), Expect = 7.9 Identities = 15/49 (30%), Positives = 15/49 (30%), Gaps = 3/49 (6%) Frame = +3 Query: 666 PXXPPPPPXXXXX---TXPPPXXXXXXXPPXXPPXXXPXXXPPPXPPXP 803 P PPPPP T P P PPP PP P Sbjct: 905 PTPPPPPPLPVKTSLNTFSHPDSVNIVANDTSVAGVMPAFPPPPPPPPP 953 Score = 25.0 bits (52), Expect(2) = 1.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 480 PXXXPPPPPXPP 515 P PPPPP PP Sbjct: 942 PAFPPPPPPPPP 953 Score = 21.0 bits (42), Expect(2) = 1.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 Query: 495 PPPPXPPXGXLS 530 PPPP PP +S Sbjct: 945 PPPPPPPPPLVS 956 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 27.9 bits (59), Expect = 2.0 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 1/81 (1%) Frame = +3 Query: 621 PHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPP-XXXPXXXPPPXPP 797 P P T P F PP P P PP PP P P P P Sbjct: 484 PFIPGTSAPLPPTTFA--PPGVPLPPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFPG 541 Query: 798 XPXPXPXXPPXPXXXPXPPPP 860 P P P P P P Sbjct: 542 YP-AVPAMPGIPGATAPPGAP 561 Score = 25.8 bits (54), Expect = 7.9 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +2 Query: 494 PPPPXPXRGXPFPPPXXGXPXSP-XNPXKPPQKTXXXXXPPXPXPPPP 634 PP G P PP G P P N +PP PP P P Sbjct: 494 PPTTFAPPGVPL-PPIPGAPGMPNLNMSQPPMVPPGMALPPGMPAPFP 540 >SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 204 Score = 27.5 bits (58), Expect = 2.6 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 709 PPPPXXXXXXPPPXPPPXXXXXPXPPXTPPXPXPXPXXPPPP 834 PPPP PP PPP P TP P P Sbjct: 48 PPPPSVDHSAPPSGPPP-SYSNSAAPATPAASASSAAPAPAP 88 >SPCC830.07c |psi1|psi|DNAJ domain protein Psi1|Schizosaccharomyces pombe|chr 3|||Manual Length = 379 Score = 27.5 bits (58), Expect = 2.6 Identities = 20/52 (38%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = -3 Query: 848 GGXXXGGGGXXGXGXGXGG------VWGGXGXXXXXGGGXGGGXXXXXXGGG 711 G GGGG G G GG + GG G GGG GG GGG Sbjct: 130 GHAFAGGGGMGGGMGGMGGMDDDMDMDGGFG-TRTRGGGMPGGFANMFGGGG 180 >SPBC557.04 |ppk29||Ark1/Prk1 family protein kinase Ppk29|Schizosaccharomyces pombe|chr 2|||Manual Length = 872 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 3/27 (11%) Frame = +3 Query: 780 PPPXPPXPXP---XPXXPPXPXXXPXP 851 PPP PP P P P P P P P Sbjct: 356 PPPPPPMPAPIYNVPNVPTVPTVSPNP 382 Score = 26.6 bits (56), Expect = 4.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 782 PPXPPPXPPPPXXXPXPPXXXXPPPPP 862 PP PPP P P P P P P Sbjct: 356 PPPPPPMPAPIYNVPNVPTVPTVSPNP 382 >SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 800 Score = 27.1 bits (57), Expect = 3.4 Identities = 19/86 (22%), Positives = 22/86 (25%) Frame = +2 Query: 536 PXXGXPXSPXNPXKPPQKTXXXXXPPXPXPPPPXXAPXAXXXXXXXXXXXXXKXXXNXPP 715 P G +P P PP T P PPP + + PP Sbjct: 292 PPTGNSTTPVTPTVPPTSTSSTSTP----PPPASTSSTGTSSSPLPSTSTSCTTSTSIPP 347 Query: 716 PXXXGXXXPPPXPPXXXPXXXXPPXP 793 P PP PP P Sbjct: 348 TGNSTTPVTPTVPPTSTSSTSTPPPP 373 >SPAC20G4.02c |fus1||formin Fus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1372 Score = 26.6 bits (56), Expect = 4.5 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 814 PXXPPPPXXXPPPPPP 861 P PPP PPP PP Sbjct: 802 PFKAPPPAPLPPPAPP 817 >SPBC146.13c |myo1||myosin type I|Schizosaccharomyces pombe|chr 2|||Manual Length = 1217 Score = 26.6 bits (56), Expect = 4.5 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +2 Query: 524 PFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPPPPXXAP 646 P P SP N KP P PPPP P Sbjct: 1062 PAPSTVTSAASSPSNISKPSAPVANNVSKPSAVPPPPPPPP 1102 >SPAC2F3.14c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 331 Score = 25.8 bits (54), Expect = 7.9 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +2 Query: 500 PPXPXRGXPFPPPXXGXPXSPXNPXKPPQKTXXXXXPPXPXPPPP 634 PP P P P P P P +P + PP P P P Sbjct: 107 PPLPNE----PVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVP 147 Score = 25.8 bits (54), Expect = 7.9 Identities = 12/38 (31%), Positives = 12/38 (31%) Frame = +3 Query: 744 PXXPPXXXPXXXPPPXPPXPXPXPXXPPXPXXXPXPPP 857 P P P PP P P P P P P P Sbjct: 110 PNEPVPEEPLPGEPPLPDEPVPEEPLPGEPPLPNEPVP 147 >SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 296 Score = 25.8 bits (54), Expect = 7.9 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 742 PPXPPPXXXXXPXPPXTPPXPXPXPXXPPPPXXXPPPP 855 PP PPP P + P P PP P PP Sbjct: 206 PPPPPPQQNYPPAASSSAP-PMQYQQTAYPPQQAPYPP 242 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 25.8 bits (54), Expect = 7.9 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +3 Query: 609 PPXPPHHPXTXXPXXAPXFPXXPPPPPXXXXXTXPPPXXXXXXXPPXXPPXXXPXXXPPP 788 PP PP T P PPP T PP PP P P P Sbjct: 908 PPPPPTASMTASA------PAIASPPPPKVGETYHPPTASGTRVPPVQQP-SHPNPYTPV 960 Query: 789 XPPXP 803 P P Sbjct: 961 APQSP 965 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,983,783 Number of Sequences: 5004 Number of extensions: 49016 Number of successful extensions: 1784 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 428468660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -