BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D23 (978 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0515 - 3864796-3865425 31 0.18 02_05_0750 - 31479876-31480985 33 0.35 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 33 0.46 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 33 0.46 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 33 0.46 04_04_1560 - 34432491-34432837,34433097-34433292 33 0.46 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 33 0.46 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 33 0.46 01_05_0490 + 22672241-22674679 28 0.46 07_03_0154 + 14509979-14512033 30 0.47 12_02_1174 - 26696869-26698191 32 0.80 06_01_0486 - 3455030-3455770 32 0.80 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 32 0.80 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 32 0.80 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 31 1.1 08_01_0059 - 394001-394708 31 1.1 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 31 1.1 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 31 1.1 04_04_0712 + 27476319-27476569,27477150-27477402,27477535-274779... 31 1.1 04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064,654... 31 1.1 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 31 1.1 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.1 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 31 1.4 05_01_0380 + 2978256-2979284 31 1.4 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 31 1.4 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 31 1.4 01_02_0031 + 10364487-10365407 31 1.4 01_01_0796 + 6190931-6192745 31 1.4 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 1.8 04_04_1676 - 35302498-35302836,35302911-35302997,35303063-353032... 31 1.8 04_04_0675 + 27183826-27184443 31 1.8 02_04_0021 + 18975992-18976408 31 1.8 11_06_0016 - 19284810-19284926,19285527-19286879 30 2.4 08_02_0602 + 19183549-19184919 30 2.4 03_05_0252 - 22403504-22404676 30 2.4 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 30 3.2 10_08_1008 - 22222051-22222377,22222479-22222640,22223179-222233... 30 3.2 09_02_0327 - 7284829-7284889,7284946-7286126 30 3.2 08_02_1256 + 25645085-25645396 30 3.2 07_01_0080 + 587674-588510 30 3.2 06_03_0696 + 23617687-23617851,23618838-23619536 30 3.2 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 30 3.2 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 30 3.2 04_04_1687 - 35365766-35366356,35367137-35368135 30 3.2 04_04_0236 + 23825368-23825763,23826229-23828667 30 3.2 04_03_1022 - 21778315-21779007 30 3.2 04_03_0925 - 20856628-20856690,20856786-20856845,20856924-208570... 30 3.2 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 30 3.2 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 30 3.2 01_01_0046 - 331758-332627 30 3.2 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 24 4.0 07_01_0516 - 3850252-3852870 29 4.3 05_05_0135 - 22626163-22626198,22626391-22626441,22626516-226266... 29 4.3 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 29 4.3 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 29 4.3 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 29 5.6 09_02_0543 + 10427321-10428315,10428440-10429154 29 5.6 08_02_1084 - 24232968-24234779 29 5.6 07_03_1130 - 24187316-24187402,24188365-24188436,24188714-24189379 29 5.6 06_03_0219 - 18227559-18227858,18227864-18228340 29 5.6 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 29 5.6 01_06_1330 - 36361275-36361448,36361778-36361973,36362248-363623... 29 5.6 08_02_0796 - 21300251-21300373,21300846-21301721 25 6.7 12_02_0299 - 17051570-17052474,17053542-17053755 29 7.5 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 29 7.5 11_06_0610 - 25449085-25453284 29 7.5 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 29 7.5 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 29 7.5 09_06_0125 - 21011757-21012428 29 7.5 09_04_0506 - 18188785-18190599 29 7.5 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 29 7.5 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 7.5 05_01_0110 - 741968-742279 29 7.5 03_06_0599 + 34984869-34985319,34986581-34987563 29 7.5 02_03_0388 + 18429538-18430598,18430971-18431081,18431165-184312... 29 7.5 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 29 7.5 01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536,787... 29 7.5 01_01_0715 - 5542648-5543219,5543352-5543544 29 7.5 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 25 8.0 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 24 8.0 12_01_0292 + 2193309-2193338,2193565-2193640,2193744-2195203,219... 28 9.8 11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 28 9.8 11_01_0066 - 536281-537196,537397-537452 28 9.8 08_02_1615 + 28257275-28258428,28258523-28259144 28 9.8 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 28 9.8 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 28 9.8 06_03_0447 + 20878444-20878821 28 9.8 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 28 9.8 04_04_1413 - 33386049-33386339 28 9.8 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 28 9.8 01_06_0146 + 26969011-26969995,26970878-26970930 28 9.8 >03_01_0515 - 3864796-3865425 Length = 209 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 519 PPPXAPAPPPXXA-PXSPPPS 578 PPP P PPP A P PPPS Sbjct: 85 PPPLPPPPPPPAASPPPPPPS 105 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP A PPP Sbjct: 84 PPPPLPPPPPPPAASPPPP 102 Score = 29.9 bits (64), Expect(2) = 0.18 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPPPS 578 L PPP A PP P PPPS Sbjct: 88 LPPPPPPPAASPPPPPPSPPPPS 110 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P + PP P Sbjct: 84 PPPPLPPPPPPPAASPPPPPPSP 106 Score = 23.0 bits (47), Expect(2) = 0.18 Identities = 12/42 (28%), Positives = 12/42 (28%) Frame = +3 Query: 264 PXAXKXGPXPXPXXPPXAXXXXXXXXXXXXPPXRGXPXPPPP 389 P A P P P PP G PPPP Sbjct: 33 PEAEASPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPP 74 >02_05_0750 - 31479876-31480985 Length = 369 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP +P+PPP P PPP Sbjct: 193 PPPPSPSPPPEPEPQLPPP 211 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPPP 575 L PPP P PPP P PPP Sbjct: 430 LPPPPPPPPPPPPPLPPNMPPP 451 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP P PPP P PPP Sbjct: 425 PPPPPLPPPPPPPPPPPP 442 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP P PPP P PP Sbjct: 426 PPPPLPPPPPPPPPPPPP 443 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPPP 575 L PPP P PPP P P P Sbjct: 424 LPPPPPLPPPPPPPPPPPPPLP 445 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 431 PPPPPPPPPPPPPLPPNMPPPLP 453 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PP P PPP Sbjct: 438 PPPPPPLPPNMPPPLPPPP 456 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P+PPP P PPP Sbjct: 109 PPPPPPSPPPSAPPPPPPP 127 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P A PP P Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPP 128 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP AP PPP P PPP Sbjct: 116 PPPSAP-PPPPPPPTQPPP 133 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP P PPP P +PPP Sbjct: 106 PPPPPPPPPSPPPSAPPP 123 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP APPP AP PPP Sbjct: 42 PPPQGAPPPFLAPPPPPP 59 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +3 Query: 519 PPPXAPAP-PPXXAPXSPPP 575 PPP P P PP AP PPP Sbjct: 107 PPPPPPPPSPPPSAPPPPPP 126 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPP P R PP P Sbjct: 121 PPPPPPPPTQPPPREAQLAPPPP 143 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP PPP A +PPP Sbjct: 124 PPPPPTQPPPREAQLAPPP 142 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP +P PPP Sbjct: 1164 PPPATPPPPPPLSPSLPPP 1182 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P + PP P Sbjct: 1164 PPPATPPPPPPLSPSLPPPPPPP 1186 Score = 25.8 bits (54), Expect(2) = 1.6 Identities = 13/38 (34%), Positives = 13/38 (34%), Gaps = 1/38 (2%) Frame = +3 Query: 285 PXPXPXXPPXAXXXXXXXXXXXXP-PXRGXPXPPPPFS 395 P P P PP P P P PPPP S Sbjct: 1139 PPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLS 1176 Score = 23.4 bits (48), Expect(2) = 1.6 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPPP 575 L PPP P P +PPP Sbjct: 1179 LPPPPPPPPLPSGPPPQPAPPP 1200 >04_04_1560 - 34432491-34432837,34433097-34433292 Length = 180 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP +P PPP AP +PP Sbjct: 135 PPPASPPPPPSNAPPTPP 152 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP AP PPP AP PP Sbjct: 275 PPPQAPPPPPPNAPMGMPP 293 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP AP PPP+ Sbjct: 268 PPPQVPPPPPQ-APPPPPPN 286 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 2/25 (8%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXL--RXPPXP 505 PPP PPPP P + R PP P Sbjct: 275 PPPQAPPPPPPNAPMGMPPRIPPPP 299 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P+ + PP P Sbjct: 355 PPPPPPPPPPPKLNTAPKPPPPP 377 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P + PP P Sbjct: 49 PPPSPPPPPAPDFTSDPSTPPAP 71 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P L P P Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKP 373 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 354 PPPPPPPPPPPPKLNTAPKPPPP 376 >01_05_0490 + 22672241-22674679 Length = 812 Score = 28.3 bits (60), Expect(2) = 0.46 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 440 PPXXPPPPXPRXRAXLRXPPXP 505 PP PPPP P R R PP P Sbjct: 638 PPQPPPPPPPTTRRS-RKPPQP 658 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP PAPPP P PP Sbjct: 658 PPSRPAPPPPPPPQQQPP 675 Score = 23.0 bits (47), Expect(2) = 0.46 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 437 PPPXXPPPP 463 PPP PPPP Sbjct: 607 PPPPPPPPP 615 >07_03_0154 + 14509979-14512033 Length = 684 Score = 29.9 bits (64), Expect(2) = 0.47 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P+ +A P P Sbjct: 56 PPPPPPPPPPPQVQAATVATPVP 78 Score = 21.4 bits (43), Expect(2) = 0.47 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 Query: 263 PXGPKXGXXPXPXXXPGGXPP 325 P P+ G P P P PP Sbjct: 38 PASPERGPLPLPAAAPPPPPP 58 >12_02_1174 - 26696869-26698191 Length = 440 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P PPP Sbjct: 141 PPPVKPQPPPSLPPPPPPP 159 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP P PPP P PP Sbjct: 148 PPPSLPPPPPPPPPPPPP 165 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPPP 575 L PPP P PPP P PP Sbjct: 152 LPPPPPPPPPPPPPRPPSVKPP 173 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPP 499 PPP PPPP P R PP Sbjct: 153 PPPPPPPPPPPPPRPPSVKPP 173 >06_01_0486 - 3455030-3455770 Length = 246 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP P+PPP P SPP Sbjct: 137 PPPTPPSPPPYVPPPSPP 154 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP P+PPP P +PP Sbjct: 125 PPPTPPSPPPYVPPPTPP 142 Score = 30.3 bits (65), Expect = 2.4 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPPS 578 PP P+PPP P PPP+ Sbjct: 90 PPYVPSPPPYVPPYIPPPT 108 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 519 PPPXAPAP-PPXXAPXSPPPS 578 PPP P P PP P PPPS Sbjct: 132 PPPYVPPPTPPSPPPYVPPPS 152 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P PPP Sbjct: 38 PPPPPPPPPPPPPPPPPPP 56 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPP 572 L PPP P PPP P PP Sbjct: 36 LCPPPPPPPPPPPPPPPPPPP 56 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P PPP Sbjct: 353 PPPPPPPPPPPPPPPPPPP 371 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P PPP Sbjct: 357 PPPPPPPPPPPPPPPRPPP 375 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P PPP Sbjct: 358 PPPPPPPPPPPPPPRPPPP 376 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P PPP Sbjct: 360 PPPPPPPPPPPPRPPPPPP 378 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P PPP Sbjct: 361 PPPPPPPPPPPRPPPPPPP 379 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P R PP P Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPP 377 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPP 572 L PPP P PPP P PP Sbjct: 351 LMPPPPPPPPPPPPPPPPPPP 371 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP +PPP+ Sbjct: 369 PPPRPPPPPPPIKKGAPPPA 388 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPP 378 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPP 499 PPP PPPP P R PP Sbjct: 359 PPPPPPPPPPPPPRPPPPPPP 379 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPP 376 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P P P Sbjct: 355 PPPPPPPPPPPPPPPPPRP 373 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP P PP Sbjct: 356 PPPPPPPPPPPPPPPPRPP 374 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 357 PPPPPPPPPPPPPPPRPPPPPPP 379 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP PPP Sbjct: 359 PPPPPPPPPPPPPRPPPPP 377 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 220 PPPPPPPPPSPHRHPAAHPPPPP 242 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP AP PPP+ Sbjct: 150 PPP--PPPPPPHAPPGPPPT 167 >08_01_0059 - 394001-394708 Length = 235 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP AP PPPS Sbjct: 12 PPPATPPPPPRRAP--PPPS 29 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP APPP P PPP Sbjct: 18 PPPPRRAPPPPSPPIRPPP 36 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP P PPP P +PPP Sbjct: 30 PPIRPPPPPTPRPYAPPP 47 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +3 Query: 519 PPPXAP---APPPXXAPXSPPP 575 PPP P APPP P +PPP Sbjct: 35 PPPPTPRPYAPPPPSHPLAPPP 56 Score = 28.3 bits (60), Expect(2) = 1.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPPP 575 L PPP P P P SPPP Sbjct: 52 LAPPPPHISPPAPVPPPPSPPP 73 Score = 21.8 bits (44), Expect(2) = 1.1 Identities = 10/35 (28%), Positives = 10/35 (28%) Frame = +3 Query: 285 PXPXPXXPPXAXXXXXXXXXXXXPPXRGXPXPPPP 389 P P PP PP P PPP Sbjct: 13 PPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPP 47 >06_03_0310 - 19453047-19453160,19453240-19453338,19453441-19453513, 19453598-19453708,19453795-19453956,19454064-19454340, 19454542-19455160,19455256-19455471 Length = 556 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP APAP P AP PP Sbjct: 174 PPPQAPAPTPPQAPAPTPP 192 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 525 PXAPAPPPXXAPXSPPP 575 P APAPPP AP PP Sbjct: 168 PHAPAPPPPQAPAPTPP 184 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP APAP P AP PP Sbjct: 183 PPQAPAPTPPRAPTPTPP 200 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PP AP PPP P PPP+ Sbjct: 19 PPAPAPVPPPPPPPPPPPPA 38 >04_04_0712 + 27476319-27476569,27477150-27477402,27477535-27477914, 27479738-27479864,27479945-27480110,27480221-27480359, 27481854-27481987,27482087-27482229,27482367-27482565, 27482688-27483010 Length = 704 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -1 Query: 498 GGXRRXARXRGXGGGGXXGGG 436 GG RR + RG GGGG GGG Sbjct: 6 GGVRRRSGRRGAGGGGAGGGG 26 >04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064, 6542113-6542322,6542507-6542765,6544022-6544215 Length = 511 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P R PP P Sbjct: 32 PPPLPPPPPGPLQRRSSLPPPPP 54 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP +P PPP +P PPS Sbjct: 90 PPPPSPPPPPPSSPPPVPPS 109 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PP AP PPP P PPP+ Sbjct: 331 PPKAAPPPPPPKGPPPPPPA 350 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 291 PXPXXPPXAXXXXXXXXXXXXPPXRGXPXPPPP 389 P P P A PP +G P PPPP Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PP P PPP P PPP Sbjct: 340 PPKGPPPPPPAKGPPPPPP 358 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP PPP Sbjct: 339 PPPKGPPPPPPAKGPPPPP 357 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 3/22 (13%) Frame = +3 Query: 519 PPPXA---PAPPPXXAPXSPPP 575 PPP A P PPP P PPP Sbjct: 346 PPPPAKGPPPPPPPKGPSPPPP 367 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP P SP P+ Sbjct: 82 PPPPPPPPPPPPPPLSPTPT 101 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PP P+PPP P PPP Sbjct: 75 PPQTPPSPPPPPPPPPPPP 93 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PP P PPP Sbjct: 74 PPPQTPPSPPPPPPPPPPP 92 >05_01_0380 + 2978256-2979284 Length = 342 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P R R P P Sbjct: 29 PPPPPPPPPPPPPRPFSRKPSEP 51 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP P S PS Sbjct: 30 PPPPPPPPPPPPRPFSRKPS 49 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP APAPPP P P S Sbjct: 115 PPPPAPAPPPTPTPKFPSSS 134 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP A SP P+ Sbjct: 92 PPPLLPTPPPPPASISPTPA 111 >03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021, 5103670-5104577 Length = 538 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP AP PPP P PP Sbjct: 202 PPPQAPLPPPAPVPAPAPP 220 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPP 572 P APAPPP AP PP Sbjct: 248 PAPAPAPPPVTAPPPPP 264 >01_02_0031 + 10364487-10365407 Length = 306 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = +3 Query: 519 PPPXAPAPPPXXA---PXSPPPS 578 PPP PAPPP A P +PPP+ Sbjct: 174 PPPALPAPPPPPAPMLPLAPPPT 196 >01_01_0796 + 6190931-6192745 Length = 604 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P+ L+ P P Sbjct: 193 PPPPPPPPPPPQPEQQLQLPQWP 215 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P+ PP P Sbjct: 566 PPPPPPPPPLPQSNYASSQPPPP 588 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPP 566 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPP 607 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P PP P Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPPP 640 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP + PP P Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPP 567 >04_04_1676 - 35302498-35302836,35302911-35302997,35303063-35303286, 35303375-35303675,35303762-35303860,35304895-35305032, 35305108-35305326 Length = 468 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PP APAP P AP SPP Sbjct: 381 PPAAAPAPAPEMAPSSPP 398 >04_04_0675 + 27183826-27184443 Length = 205 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP A PP AP SPPP Sbjct: 109 PPPPASPPPLPPAPSSPPP 127 >02_04_0021 + 18975992-18976408 Length = 138 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 519 PPPXAPAP-PPXXAPXSPPP 575 PPP AP P PP +P PPP Sbjct: 106 PPPPAPTPKPPAPSPSPPPP 125 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP P P PS Sbjct: 83 PPPSPPPPPPPPPPPRPAPS 102 >08_02_0602 + 19183549-19184919 Length = 456 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 504 GXGGXRRXARXRGXGGGGXXGGG 436 G GG R A G GGGG GGG Sbjct: 54 GSGGSHRGASGGGSGGGGGGGGG 76 >03_05_0252 - 22403504-22404676 Length = 390 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 504 GXGGXRRXARXRGXGGGGXXGGG 436 G GG R R G GGGG GGG Sbjct: 5 GGGGGGRAGRVGGGGGGGAGGGG 27 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP R A ++ P P Sbjct: 74 PPPSQPPPPFARPAAPVQQQPPP 96 >10_08_1008 - 22222051-22222377,22222479-22222640,22223179-22223310, 22224556-22224608,22224713-22225256 Length = 405 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 P P A APPP AP +PPPS Sbjct: 14 PAPAAAAPPPAAAP-APPPS 32 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PP APAPPP P P P Sbjct: 22 PPAAAPAPPPSQPPPPPLP 40 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLR 490 PPP PPPP PR R R Sbjct: 57 PPPPPPPPPPPRGRRYYR 74 >08_02_1256 + 25645085-25645396 Length = 103 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP P PPP +P PPP Sbjct: 61 PPPPPPPPPLPSPPPPPP 78 >07_01_0080 + 587674-588510 Length = 278 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP + +PPP P PPP Sbjct: 97 PPPSSGSPPPPPPPPPPPP 115 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PP +P PPP Sbjct: 91 PPPPPPPPPSSGSPPPPPP 109 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP P PPP P PP Sbjct: 104 PPPPPPPPPPPPPPPPPP 121 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP P PPP P PPP Sbjct: 104 PPPPPPPPPPPPPPPPPP 121 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P + PP P Sbjct: 79 PPPPPPPPPSPPATHDVGQPPPP 101 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXP 496 PPP PPPP PR R+ P Sbjct: 310 PPPPPPPPPMPRSRSASPSP 329 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSP-PPS 578 PPP P PPP +P P PPS Sbjct: 77 PPPPPPPPPPRNSPSPPKPPS 97 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP A APPP P PPP Sbjct: 4 PPAATAPPPPPPPPPPPP 21 >04_04_0236 + 23825368-23825763,23826229-23828667 Length = 944 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPPS 578 PP PA PP AP PPP+ Sbjct: 903 PPFTPAVPPVVAPAVPPPA 921 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPPPS 578 L PPP P PPP P PPS Sbjct: 34 LLPPPPPPPPPPPYVPPHLLPPS 56 >04_03_0925 - 20856628-20856690,20856786-20856845,20856924-20857001, 20857127-20857192,20857542-20858675,20858991-20860283 Length = 897 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PP P P P AP SPPP Sbjct: 9 PPEHPPTPAPAPAPASPPP 27 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP P PPP P +PP Sbjct: 37 PPPPPPPPPPPSQPSAPP 54 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 525 PXAPAPPPXXAPXSPPP 575 P AP PPP AP PPP Sbjct: 354 PPAPPPPPPFAPTLPPP 370 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP AP PP P PPS Sbjct: 360 PPPFAPTLPPPPPPRRKPPS 379 >01_01_0046 - 331758-332627 Length = 289 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P + R P P Sbjct: 21 PPPPPPPPPPPPSSSRYRPPSPP 43 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 24.2 bits (50), Expect(2) = 4.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSP 569 L PP AP P P AP P Sbjct: 147 LVPPPAPAPRPAPAPAPRVP 166 Score = 23.8 bits (49), Expect(2) = 4.0 Identities = 11/36 (30%), Positives = 11/36 (30%) Frame = +3 Query: 282 GPXPXPXXPPXAXXXXXXXXXXXXPPXRGXPXPPPP 389 G P PP PP P PPPP Sbjct: 103 GRTAKPYRPPPPPRKKPQFQPPPQPPRAWDPSPPPP 138 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP P PPP P PPP Sbjct: 27 PPPPPPPPPAHGPSPPPP 44 >05_05_0135 - 22626163-22626198,22626391-22626441,22626516-22626608, 22627249-22627254,22628051-22628180,22628333-22628583 Length = 188 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 504 GXGGXRRXARXRGXGGGGXXGGG 436 G GG RG GGGG GGG Sbjct: 10 GGGGSHESGSPRGGGGGGGGGGG 32 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +3 Query: 522 PPXAPAPP-PXXAPXSPPP 575 PP APAPP P P PPP Sbjct: 1201 PPGAPAPPMPPGVPGGPPP 1219 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP P PPP P PPP Sbjct: 116 PPRPPPPPPPHPPEDPPP 133 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP + PPP P PPP Sbjct: 257 PPPQSVRPPPPPPPPPPPP 275 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = +3 Query: 519 PPPXAP--APPPXXAPXSPPP 575 PPP P PPP AP PPP Sbjct: 26 PPPAIPESGPPPPPAPDMPPP 46 >08_02_1084 - 24232968-24234779 Length = 603 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP PPP P +PPP Sbjct: 87 PPPQHSLPPPPPLPQAPPP 105 >07_03_1130 - 24187316-24187402,24188365-24188436,24188714-24189379 Length = 274 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSP 569 PPP AP PP AP SP Sbjct: 9 PPPSAPQSPPFSAPASP 25 >06_03_0219 - 18227559-18227858,18227864-18228340 Length = 258 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P R LR P P Sbjct: 94 PPPASPPPPPP--RLALRFPRRP 114 >04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 Length = 268 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PP P PPP Sbjct: 140 PPPCKPEEPPKPPPEKPPP 158 >01_06_1330 - 36361275-36361448,36361778-36361973,36362248-36362325, 36362685-36362807,36363206-36363463,36363914-36364073, 36364702-36364812,36365159-36365429,36365514-36365663, 36366383-36367090 Length = 742 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP P LR PP P Sbjct: 99 PPPSLPPPPPP-----LRPPPPP 116 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP P PPP P PP Sbjct: 99 PPPSLPPPPPPLRPPPPP 116 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 25.4 bits (53), Expect(2) = 6.7 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 510 LXXPPPXAPAPPPXXAPXSPPP 575 L PPP P PPP P P Sbjct: 102 LPPPPPPPPPPPPPPQPQQHLP 123 Score = 21.8 bits (44), Expect(2) = 6.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 354 PPXRGXPXPPPP 389 PP P PPPP Sbjct: 97 PPLLALPPPPPP 108 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = +3 Query: 519 PPPXAPAP--PPXXAPXSPPP 575 PPP P P PP +P SPPP Sbjct: 271 PPPAFPFPHLPPIFSPPSPPP 291 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PP P PPP P PPP Sbjct: 620 PPGAPPPPPPPGKPGGPPP 638 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 28.7 bits (61), Expect = 7.5 Identities = 23/105 (21%), Positives = 25/105 (23%), Gaps = 1/105 (0%) Frame = +3 Query: 264 PXAXKXGPXPXPXXPPXAXXXXXXXXXXXXPPXRGXPXPPPPF-SXXXXXXXXXXXXXXX 440 P P P PP A PP PPPP S Sbjct: 1139 PVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVK 1198 Query: 441 XXXXXXXXXXXXXXXXXXXXXXXLXXPPPXAPAPPPXXAPXSPPP 575 + PPP +PPP SPPP Sbjct: 1199 SPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPP 1243 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +3 Query: 519 PPPXAP--APPPXXAPXSPPPS 578 PPP +P +PP P SPPPS Sbjct: 781 PPPHSPEKSPPSEAHPTSPPPS 802 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PP P PPP P PPP Sbjct: 925 PPGAPPPPPPPGKPGGPPP 943 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP AP P P +PPP+ Sbjct: 54 PPPAVVAPSPPLPPLTPPPA 73 >09_06_0125 - 21011757-21012428 Length = 223 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 440 PPXXPPPPXPRXRAXLRXPPXP 505 PP PPPP PR PP P Sbjct: 167 PPPSPPPPPPRAPFLAPPPPPP 188 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP P PPP +PPP Sbjct: 167 PPPSPPPPPPRAPFLAPPP 185 >09_04_0506 - 18188785-18190599 Length = 604 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP + PPP AP PP Sbjct: 64 PPPISQQPPPLQAPPPPP 81 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P PPP SP PS Sbjct: 19 PPPPPPPPPPLPPRGSPAPS 38 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 P P P PPP P PPP Sbjct: 50 PQPTLPPPPPRTLPPPPPP 68 >05_01_0110 - 741968-742279 Length = 103 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSP 569 PPP AP PPP P P Sbjct: 84 PPPGAPTPPPIGPPHRP 100 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 437 PPPXXPPPPXPRXRAXLRXPPXP 505 PPP PPPP R PP P Sbjct: 404 PPPPPPPPPHQRETPSPSPPPQP 426 >02_03_0388 + 18429538-18430598,18430971-18431081,18431165-18431237, 18431513-18431695 Length = 475 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPP 575 PP APAP P AP PP Sbjct: 91 PPHAPAPSPPQAPAMTPP 108 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPPS 578 PP P PPP +PPPS Sbjct: 82 PPPPPPPPPTNGTLTPPPS 100 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP P+PPP P PPP+ Sbjct: 75 PPPTPPSPPP---PPPPPPT 91 >01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536, 7878507-7878761 Length = 223 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 504 GXGGXRRXARXRGXGGGGXXGGG 436 G G R A+ G GGGG GGG Sbjct: 4 GGGDEREKAKGGGGGGGGGGGGG 26 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 504 GXGGXRRXARXRGXGGGGXXGGG 436 G GG + +G GGGG GGG Sbjct: 2 GGGGGDEREKAKGGGGGGGGGGG 24 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 Query: 504 GXGGXRRXARXRGXGGGGXXGGG 436 G GG R G GGGG GGG Sbjct: 3 GGGGDEREKAKGGGGGGGGGGGG 25 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 P P PAP P +P PPP Sbjct: 175 PSPPVPAPAPAGSPPPPPP 193 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 25.4 bits (53), Expect(2) = 8.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 437 PPPXXPPPPXP 469 PPP PPPP P Sbjct: 277 PPPAGPPPPAP 287 Score = 21.4 bits (43), Expect(2) = 8.0 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 452 PPPPXPRXRAXLRXPPXP 505 PPPP A PP P Sbjct: 321 PPPPPAHPAAPAPPPPAP 338 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 24.2 bits (50), Expect(2) = 8.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAP 560 PPP P PPP P Sbjct: 365 PPPPPPPPPPPPPP 378 Score = 22.6 bits (46), Expect(2) = 8.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 534 PAPPPXXAPXSPPP 575 PA PP P PPP Sbjct: 392 PAVPPPPPPTPPPP 405 >12_01_0292 + 2193309-2193338,2193565-2193640,2193744-2195203, 2195479-2195505,2195794-2196024,2196523-2196692, 2197278-2197421,2198036-2198083,2198503-2198566 Length = 749 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 388 GGGGXGXPRXGGXXXXXXXXXXXGAXGGXXGXGXG 284 GGGG G P+ GG G GG G G G Sbjct: 95 GGGGKGQPKDGGGKGHPKDAGGKGQKGGGGGGGNG 129 >11_01_0288 + 2151552-2151581,2151818-2151893,2152019-2153460 Length = 515 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 388 GGGGXGXPRXGGXXXXXXXXXXXGAXGGXXGXGXG 284 GGGG G P+ GG G GG G G G Sbjct: 94 GGGGKGQPKDGGGKGQPKDAGGKGQKGGGGGGGGG 128 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPPS 578 PPP +PPP PPPS Sbjct: 223 PPPSPASPPPPSTATPPPPS 242 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PPP AP PP P SPPP Sbjct: 59 PPPPAPLTPP--PPKSPPP 75 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PP +P P P AP PPP Sbjct: 586 PPEPSPPPAPKAAPPPPPP 604 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 495 GXRRXARXRGXGGGGXXGGG 436 G R R RG GGGG GGG Sbjct: 747 GGRDFRRDRGSGGGGYGGGG 766 >06_03_0447 + 20878444-20878821 Length = 125 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 437 PPPXXPPPPXPRXRA 481 PPP PPPP PR A Sbjct: 6 PPPSPPPPPLPREAA 20 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPP 572 PPP P+P P AP PP Sbjct: 38 PPPPPPSPVPSPAPPPPP 55 >04_04_1413 - 33386049-33386339 Length = 96 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 504 GXGGXRRXARXRGXGGGGXXGGG 436 G GG RR R G GGGG GGG Sbjct: 53 GSGGRRR--RTGGGGGGGGGGGG 73 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 519 PPPXAPAPPPXXAPXSPPP 575 PP P PPP P PPP Sbjct: 49 PPRPPPPPPPPTQPAPPPP 67 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPPS 578 PP P PP AP PPP+ Sbjct: 52 PPPPPPPPTQPAPPPPPPA 70 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 522 PPXAPAPPPXXAPXSPPPS 578 PP APA P AP SPPPS Sbjct: 103 PPPAPA-PDQPAPPSPPPS 120 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,134,827 Number of Sequences: 37544 Number of extensions: 211737 Number of successful extensions: 8701 Number of sequences better than 10.0: 91 Number of HSP's better than 10.0 without gapping: 2227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7229 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2846681820 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -