BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D22 (810 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 61 4e-08 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 57 5e-07 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 57 5e-07 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 56 1e-06 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 55 2e-06 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 55 2e-06 UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n... 53 7e-06 UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 ... 53 7e-06 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 53 7e-06 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 52 1e-05 UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabido... 52 1e-05 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 52 1e-05 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 52 2e-05 UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms... 52 2e-05 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 52 2e-05 UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; ... 52 2e-05 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 52 2e-05 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 52 2e-05 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 52 2e-05 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 51 3e-05 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 51 3e-05 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 51 4e-05 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 50 5e-05 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 50 5e-05 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 50 5e-05 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 50 5e-05 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 50 7e-05 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 50 7e-05 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 50 9e-05 UniRef50_Q5AAF4 Cluster: Putative uncharacterized protein BNI1; ... 50 9e-05 UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Eut... 50 9e-05 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 49 1e-04 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 49 1e-04 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 49 2e-04 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 49 2e-04 UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, in... 48 2e-04 UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyosteli... 48 2e-04 UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Dia... 48 2e-04 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 48 2e-04 UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleos... 48 3e-04 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 48 3e-04 UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; ... 48 3e-04 UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Ad... 48 3e-04 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 47 5e-04 UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Pr... 47 5e-04 UniRef50_UPI00006A1088 Cluster: WAS/WASL interacting protein fam... 47 6e-04 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 47 6e-04 UniRef50_O23691 Cluster: Putative uncharacterized protein T19D16... 47 6e-04 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 47 6e-04 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 46 9e-04 UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|R... 46 9e-04 UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|R... 46 9e-04 UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; ... 46 9e-04 UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyosteli... 46 9e-04 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 46 9e-04 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 46 9e-04 UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; ... 46 0.001 UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n... 46 0.001 UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whol... 46 0.001 UniRef50_A4TTL3 Cluster: Putative uncharacterized protein; n=2; ... 46 0.001 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 46 0.001 UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella ve... 46 0.001 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 46 0.001 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 46 0.001 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 46 0.001 UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pomb... 46 0.001 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 46 0.001 UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleos... 46 0.001 UniRef50_UPI00015B5CAE Cluster: PREDICTED: similar to conserved ... 46 0.001 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 46 0.001 UniRef50_Q9VC23 Cluster: CG7016-PA; n=2; Sophophora|Rep: CG7016-... 46 0.001 UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella ve... 46 0.001 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 46 0.001 UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces cap... 46 0.001 UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sa... 45 0.002 UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-... 45 0.002 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 45 0.003 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 45 0.003 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 45 0.003 UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa... 45 0.003 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 45 0.003 UniRef50_Q5BXW2 Cluster: SJCHGC01957 protein; n=3; Eukaryota|Rep... 45 0.003 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 45 0.003 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 45 0.003 UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; ... 45 0.003 UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda... 45 0.003 UniRef50_UPI0000E46C2C Cluster: PREDICTED: similar to transcript... 44 0.003 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 44 0.003 UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein... 44 0.003 UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whol... 44 0.003 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 44 0.003 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 44 0.003 UniRef50_A5C4F9 Cluster: Putative uncharacterized protein; n=1; ... 44 0.003 UniRef50_A5BPY4 Cluster: Putative uncharacterized protein; n=1; ... 44 0.003 UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|... 44 0.003 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 44 0.003 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 44 0.003 UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2... 44 0.003 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 44 0.005 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 44 0.005 UniRef50_A6G120 Cluster: Putative periplasmic protein TonB; n=1;... 44 0.005 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 44 0.005 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 44 0.005 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 44 0.005 UniRef50_P41484 Cluster: Proline-rich antigen; n=21; Mycobacteri... 44 0.005 UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 44 0.005 UniRef50_P22357 Cluster: Anther-specific protein SF18 precursor;... 44 0.005 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 44 0.006 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 44 0.006 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 44 0.006 UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; ... 44 0.006 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 44 0.006 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 44 0.006 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 44 0.006 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 44 0.006 UniRef50_Q2R360 Cluster: C2 domain containing protein, expressed... 44 0.006 UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; ... 44 0.006 UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; ... 44 0.006 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 44 0.006 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 44 0.006 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 44 0.006 UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n... 43 0.008 UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thali... 43 0.008 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 43 0.008 UniRef50_A2EVR8 Cluster: Putative uncharacterized protein; n=1; ... 43 0.008 UniRef50_Q6CEK4 Cluster: Similar to tr|O42854 Schizosaccharomyce... 43 0.008 UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe gri... 43 0.008 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 43 0.008 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 43 0.008 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 43 0.008 UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Enta... 43 0.011 UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein... 43 0.011 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 43 0.011 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 43 0.011 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 43 0.011 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 43 0.011 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 43 0.011 UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein;... 43 0.011 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 43 0.011 UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; ... 43 0.011 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 43 0.011 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 43 0.011 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 43 0.011 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 43 0.011 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 43 0.011 UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - ... 43 0.011 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 43 0.011 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 43 0.011 UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.... 37 0.012 UniRef50_UPI00015B55AC Cluster: PREDICTED: similar to GA10757-PA... 42 0.014 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 42 0.014 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 42 0.014 UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12;... 42 0.014 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 42 0.014 UniRef50_Q7S8Q9 Cluster: Predicted protein; n=1; Neurospora cras... 42 0.014 UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cere... 42 0.014 UniRef50_A4RD40 Cluster: Putative uncharacterized protein; n=2; ... 42 0.014 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 42 0.018 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 42 0.018 UniRef50_Q6ML35 Cluster: Putative uncharacterized protein; n=1; ... 42 0.018 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 42 0.018 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 42 0.018 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 42 0.018 UniRef50_Q6XJQ7 Cluster: FCA protein; n=86; BEP clade|Rep: FCA p... 42 0.018 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 42 0.018 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 42 0.018 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 42 0.018 UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliop... 42 0.018 UniRef50_Q8MQE6 Cluster: Wasp (Actin cytoskeleton modulator) hom... 42 0.018 UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; ... 42 0.018 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 42 0.018 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 42 0.018 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 42 0.018 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 42 0.018 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 42 0.018 UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; ... 42 0.018 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 42 0.018 UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morp... 42 0.018 UniRef50_Q7Z5R6 Cluster: Amyloid beta A4 precursor protein-bindi... 42 0.018 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 42 0.024 UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH30... 42 0.024 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 42 0.024 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 42 0.024 UniRef50_Q54BJ4 Cluster: Putative uncharacterized protein; n=1; ... 42 0.024 UniRef50_O01864 Cluster: Putative uncharacterized protein; n=2; ... 42 0.024 UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, wh... 42 0.024 UniRef50_A0CFX0 Cluster: Chromosome undetermined scaffold_177, w... 42 0.024 UniRef50_Q7SFQ1 Cluster: Predicted protein; n=1; Neurospora cras... 42 0.024 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 42 0.024 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 42 0.024 UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family... 42 0.024 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 42 0.024 UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin ... 42 0.024 UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L spl... 41 0.032 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 41 0.032 UniRef50_UPI0000D9F058 Cluster: PREDICTED: hypothetical protein;... 41 0.032 UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; ... 41 0.032 UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Ara... 41 0.032 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 41 0.032 UniRef50_Q7F0U2 Cluster: OJ1116_C07.3 protein; n=4; Oryza sativa... 41 0.032 UniRef50_Q585V1 Cluster: Putative uncharacterized protein; n=1; ... 41 0.032 UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; ... 41 0.032 UniRef50_Q23G58 Cluster: Putative uncharacterized protein; n=1; ... 41 0.032 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 41 0.032 UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; ... 41 0.032 UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, wh... 41 0.032 UniRef50_Q4WNW8 Cluster: KH domain protein; n=13; Pezizomycotina... 41 0.032 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 41 0.032 UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous... 41 0.042 UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009;... 41 0.042 UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; ... 41 0.042 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 41 0.042 UniRef50_Q9S858 Cluster: HRGP=HYDROXYPROLINE-rich glycoprotein; ... 41 0.042 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 41 0.042 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 41 0.042 UniRef50_O48682 Cluster: F3I6.8 protein; n=2; Arabidopsis thalia... 41 0.042 UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole gen... 41 0.042 UniRef50_A2Q4Q2 Cluster: Phosphoinositide-binding clathrin adapt... 41 0.042 UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella ve... 41 0.042 UniRef50_Q6CAY8 Cluster: Similarity; n=2; Fungi/Metazoa group|Re... 41 0.042 UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=... 41 0.042 UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein P... 41 0.042 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 41 0.042 UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; ... 41 0.042 UniRef50_Q99954 Cluster: Submaxillary gland androgen-regulated p... 41 0.042 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 41 0.042 UniRef50_Q9SXE7 Cluster: T3P18.6; n=2; core eudicotyledons|Rep: ... 40 0.056 UniRef50_Q9LQZ8 Cluster: F10A5.23; n=1; Arabidopsis thaliana|Rep... 40 0.056 UniRef50_Q2RAC3 Cluster: Harpin-induced protein 1 containing pro... 40 0.056 UniRef50_Q8IRB3 Cluster: CG32241-PA; n=1; Drosophila melanogaste... 40 0.056 UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; D... 40 0.056 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 40 0.056 UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; ... 40 0.056 UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma j... 40 0.056 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 40 0.056 UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21... 40 0.056 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 40 0.056 UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; ... 40 0.056 UniRef50_Q96U76 Cluster: Putative uncharacterized protein B18D24... 40 0.056 UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; ... 40 0.056 UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; ... 40 0.056 UniRef50_Q0UAV3 Cluster: Putative uncharacterized protein; n=1; ... 40 0.056 UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis... 40 0.056 UniRef50_Q15942 Cluster: Zyxin; n=27; Theria|Rep: Zyxin - Homo s... 40 0.056 UniRef50_O10270 Cluster: 61 kDa protein homolog; n=1; Orgyia pse... 40 0.056 UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [C... 40 0.056 UniRef50_Q96EP5 Cluster: DAZ-associated protein 1; n=39; Euteleo... 40 0.056 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 40 0.074 UniRef50_UPI0000E4A721 Cluster: PREDICTED: similar to LOC397922 ... 40 0.074 UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropica... 40 0.074 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 40 0.074 UniRef50_Q9MA04 Cluster: F20B17.16; n=5; core eudicotyledons|Rep... 40 0.074 UniRef50_Q9W3G1 Cluster: CG10555-PA; n=2; Drosophila melanogaste... 40 0.074 UniRef50_Q8IT88 Cluster: UNC-34; n=4; Caenorhabditis|Rep: UNC-34... 40 0.074 UniRef50_Q0IEF4 Cluster: Vasodilator-stimulated phosphoprotein; ... 40 0.074 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 40 0.074 UniRef50_A0EAP8 Cluster: Chromosome undetermined scaffold_86, wh... 40 0.074 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 40 0.074 UniRef50_Q5BEN1 Cluster: Adenylyl cyclase-associated protein; n=... 40 0.074 UniRef50_Q2H3D5 Cluster: Putative uncharacterized protein; n=3; ... 40 0.074 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 40 0.074 UniRef50_Q8TF74 Cluster: WAS/WASL-interacting protein family mem... 40 0.074 UniRef50_UPI00015B42DB Cluster: PREDICTED: hypothetical protein;... 40 0.098 UniRef50_UPI0000E4922C Cluster: PREDICTED: similar to Enabled ho... 40 0.098 UniRef50_UPI0000583EC6 Cluster: PREDICTED: similar to ENSANGP000... 40 0.098 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 40 0.098 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 40 0.098 UniRef50_Q2RXX9 Cluster: Putative uncharacterized protein; n=1; ... 40 0.098 UniRef50_A1UKQ7 Cluster: Putative uncharacterized protein; n=3; ... 40 0.098 UniRef50_Q948Y6 Cluster: VMP4 protein; n=1; Volvox carteri f. na... 40 0.098 UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis ... 40 0.098 UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza s... 40 0.098 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 40 0.098 UniRef50_A7PAA7 Cluster: Chromosome chr14 scaffold_9, whole geno... 40 0.098 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 40 0.098 UniRef50_Q8IMM6 Cluster: CG5514-PB, isoform B; n=3; Drosophila m... 40 0.098 UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057... 40 0.098 UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; ... 40 0.098 UniRef50_Q19479 Cluster: Putative uncharacterized protein inft-2... 40 0.098 UniRef50_O17265 Cluster: Putative uncharacterized protein; n=3; ... 40 0.098 UniRef50_Q2H239 Cluster: Putative uncharacterized protein; n=1; ... 40 0.098 UniRef50_Q0TWV8 Cluster: Predicted protein; n=1; Phaeosphaeria n... 40 0.098 UniRef50_A7TP17 Cluster: Putative uncharacterized protein; n=1; ... 40 0.098 UniRef50_A4R3R8 Cluster: Predicted protein; n=1; Magnaporthe gri... 40 0.098 UniRef50_A2QQW4 Cluster: Contig An08c0110, complete genome; n=2;... 40 0.098 UniRef50_Q9LKA5 Cluster: Uncharacterized mitochondrial protein A... 40 0.098 UniRef50_Q4UMI6 Cluster: Arp2/3 complex-activating protein rickA... 40 0.098 UniRef50_Q27294 Cluster: RNA-binding protein cabeza; n=5; Endopt... 40 0.098 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 39 0.13 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 39 0.13 UniRef50_UPI00004992B2 Cluster: hypothetical protein 53.t00004; ... 39 0.13 UniRef50_UPI000069EE4E Cluster: WAS/WASL interacting protein fam... 39 0.13 UniRef50_UPI0000F30AB8 Cluster: UPI0000F30AB8 related cluster; n... 39 0.13 UniRef50_UPI0000F30461 Cluster: Formin-2.; n=2; Bos taurus|Rep: ... 39 0.13 UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus... 39 0.13 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 39 0.13 UniRef50_Q0S917 Cluster: Possible proline rich protein; n=1; Rho... 39 0.13 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 39 0.13 UniRef50_Q9FF15 Cluster: Arabidopsis thaliana genomic DNA, chrom... 39 0.13 UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=... 39 0.13 UniRef50_A7R244 Cluster: Chromosome undetermined scaffold_398, w... 39 0.13 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 39 0.13 UniRef50_A5BAX2 Cluster: Putative uncharacterized protein; n=1; ... 39 0.13 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 39 0.13 UniRef50_Q55FT9 Cluster: Component of SCAR regulatory complex; n... 39 0.13 UniRef50_Q4QAM2 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 39 0.13 UniRef50_A7RMK5 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.13 UniRef50_A2ELJ5 Cluster: Putative uncharacterized protein; n=1; ... 39 0.13 UniRef50_A2ECL1 Cluster: Putative uncharacterized protein; n=1; ... 39 0.13 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 39 0.13 UniRef50_A0DM29 Cluster: Chromosome undetermined scaffold_56, wh... 39 0.13 UniRef50_A0CJV0 Cluster: Chromosome undetermined scaffold_2, who... 39 0.13 UniRef50_Q8WZK9 Cluster: Putative uncharacterized protein B14D6.... 39 0.13 UniRef50_Q7S9H3 Cluster: Predicted protein; n=1; Neurospora cras... 39 0.13 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 39 0.13 UniRef50_A6QTR5 Cluster: Adenylyl cyclase-associated protein; n=... 39 0.13 UniRef50_A5E6V9 Cluster: Putative uncharacterized protein; n=1; ... 39 0.13 UniRef50_Q15637 Cluster: Splicing factor 1; n=57; Euteleostomi|R... 39 0.13 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 39 0.17 UniRef50_UPI0000F2E28C Cluster: PREDICTED: similar to high-mobil... 39 0.17 UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain... 39 0.17 UniRef50_UPI0000E49E39 Cluster: PREDICTED: similar to Wiskott-Al... 39 0.17 UniRef50_UPI0000E4931A Cluster: PREDICTED: hypothetical protein;... 39 0.17 UniRef50_UPI0000DB6BDB Cluster: PREDICTED: similar to prickle CG... 39 0.17 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 39 0.17 UniRef50_Q4RQM1 Cluster: Chromosome 2 SCAF15004, whole genome sh... 39 0.17 UniRef50_Q4RHV8 Cluster: Chromosome 8 SCAF15044, whole genome sh... 39 0.17 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 39 0.17 UniRef50_Q828N1 Cluster: Putative secreted protein; n=5; Strepto... 39 0.17 UniRef50_A3TRM3 Cluster: Putative uncharacterized protein; n=1; ... 39 0.17 UniRef50_Q9LVN1 Cluster: Gb|AAD23008.1; n=2; Arabidopsis thalian... 39 0.17 UniRef50_Q08194 Cluster: Cysteine-rich extensin-like protein-1; ... 39 0.17 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 39 0.17 UniRef50_A5AVJ0 Cluster: Putative uncharacterized protein; n=1; ... 39 0.17 UniRef50_A3BQ84 Cluster: Putative uncharacterized protein; n=1; ... 39 0.17 UniRef50_A2X6I7 Cluster: Putative uncharacterized protein; n=2; ... 39 0.17 UniRef50_Q9VEJ1 Cluster: CG5836-PA; n=10; Eumetazoa|Rep: CG5836-... 39 0.17 UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1; Acant... 39 0.17 UniRef50_Q61QV1 Cluster: Putative uncharacterized protein CBG068... 39 0.17 UniRef50_Q5DGR5 Cluster: SJCHGC08168 protein; n=1; Schistosoma j... 39 0.17 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.17 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.17 UniRef50_A2DXB4 Cluster: Formin Homology 2 Domain containing pro... 39 0.17 UniRef50_A0DMD8 Cluster: Chromosome undetermined scaffold_56, wh... 39 0.17 UniRef50_Q4P173 Cluster: Putative uncharacterized protein; n=1; ... 39 0.17 UniRef50_Q0UMH1 Cluster: Putative uncharacterized protein; n=1; ... 39 0.17 UniRef50_A7LNW5 Cluster: Hydrophobin; n=1; Trichoderma atrovirid... 39 0.17 UniRef50_A3GHT1 Cluster: Predicted protein; n=3; Saccharomycetac... 39 0.17 UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomyc... 39 0.17 UniRef50_Q9NSV4 Cluster: Protein diaphanous homolog 3; n=66; Deu... 39 0.17 UniRef50_Q6IR48 Cluster: Zgc:63914; n=9; Euteleostomi|Rep: Zgc:6... 38 0.23 UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome... 38 0.23 UniRef50_Q4KT78 Cluster: ORF1629; n=2; Nucleopolyhedrovirus|Rep:... 38 0.23 UniRef50_Q89X06 Cluster: Blr0521 protein; n=7; Bradyrhizobiaceae... 38 0.23 UniRef50_Q2INY4 Cluster: Putative uncharacterized protein precur... 38 0.23 UniRef50_Q20IN6 Cluster: HrpW; n=1; Pseudomonas cichorii|Rep: Hr... 38 0.23 UniRef50_A4M4S8 Cluster: Putative uncharacterized protein precur... 38 0.23 UniRef50_A3IWX1 Cluster: FHA domain containing protein; n=2; Chr... 38 0.23 UniRef50_Q9SN46 Cluster: Extensin-like protein; n=4; Magnoliophy... 38 0.23 UniRef50_Q9FW12 Cluster: Putative proteophosphoglycan; n=1; Oryz... 38 0.23 UniRef50_Q9FLQ6 Cluster: Similarity to unknown protein; n=2; Ara... 38 0.23 UniRef50_Q7XCX5 Cluster: Plus-3 domain containing protein, expre... 38 0.23 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 38 0.23 UniRef50_Q3E7G7 Cluster: Uncharacterized protein At5g19090.2; n=... 38 0.23 UniRef50_Q0D806 Cluster: Os07g0192900 protein; n=5; Magnoliophyt... 38 0.23 UniRef50_O48809 Cluster: T3P18.1; n=9; Eukaryota|Rep: T3P18.1 - ... 38 0.23 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 38 0.23 UniRef50_A2YML9 Cluster: Putative uncharacterized protein; n=2; ... 38 0.23 UniRef50_Q9VZC2 Cluster: CG15021-PA; n=1; Drosophila melanogaste... 38 0.23 UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaste... 38 0.23 UniRef50_Q4X6Y4 Cluster: Putative uncharacterized protein; n=1; ... 38 0.23 UniRef50_Q09493 Cluster: Putative uncharacterized protein shn-1;... 38 0.23 UniRef50_A0DUX8 Cluster: Chromosome undetermined scaffold_65, wh... 38 0.23 UniRef50_Q0CLE5 Cluster: Predicted protein; n=1; Aspergillus ter... 38 0.23 UniRef50_Q8ZSX8 Cluster: Putative uncharacterized protein PAE353... 38 0.23 UniRef50_O36027 Cluster: Wiskott-Aldrich syndrome homolog protei... 38 0.23 UniRef50_O15047 Cluster: Histone-lysine N-methyltransferase, H3 ... 38 0.23 UniRef50_UPI00015B605E Cluster: PREDICTED: similar to vasodilato... 38 0.30 UniRef50_UPI00015B56FF Cluster: PREDICTED: similar to splicing f... 38 0.30 UniRef50_UPI0000DB6D2F Cluster: PREDICTED: hypothetical protein;... 38 0.30 UniRef50_UPI0000DA3CD5 Cluster: PREDICTED: hypothetical protein;... 38 0.30 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 38 0.30 UniRef50_Q1LVB7 Cluster: Novel protein; n=5; Danio rerio|Rep: No... 38 0.30 UniRef50_Q92NU7 Cluster: PUTATIVE GLYCINE-RICH PROTEIN; n=4; Sin... 38 0.30 UniRef50_A3Q026 Cluster: Putative uncharacterized protein precur... 38 0.30 UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Re... 38 0.30 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 38 0.30 UniRef50_O49946 Cluster: Extensin-like protein; n=5; Solanaceae|... 38 0.30 UniRef50_A2XET4 Cluster: Putative uncharacterized protein; n=2; ... 38 0.30 UniRef50_Q4R8N9 Cluster: Testis cDNA clone: QtsA-11950, similar ... 38 0.30 UniRef50_Q9VAT0 Cluster: CG1520-PA, isoform A; n=3; Sophophora|R... 38 0.30 UniRef50_Q93424 Cluster: Putative uncharacterized protein grl-23... 38 0.30 UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG214... 38 0.30 UniRef50_Q54XH4 Cluster: SAP DNA-binding domain-containing prote... 38 0.30 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 38 0.30 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 38 0.30 UniRef50_A2D8Z8 Cluster: Putative uncharacterized protein; n=1; ... 38 0.30 UniRef50_A0NCF4 Cluster: ENSANGP00000030385; n=2; Eukaryota|Rep:... 38 0.30 UniRef50_Q5ANI0 Cluster: Potential fungal zinc cluster transcrip... 38 0.30 UniRef50_Q0U760 Cluster: Putative uncharacterized protein; n=1; ... 38 0.30 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 38 0.30 UniRef50_Q8ZU13 Cluster: Putative uncharacterized protein PAE299... 38 0.30 UniRef50_P50552 Cluster: Vasodilator-stimulated phosphoprotein; ... 38 0.30 UniRef50_P42858 Cluster: Huntingtin; n=29; Eumetazoa|Rep: Huntin... 38 0.30 UniRef50_UPI00015056F9 Cluster: DNA binding / ligand-dependent n... 38 0.40 UniRef50_UPI00015A5049 Cluster: UPI00015A5049 related cluster; n... 38 0.40 UniRef50_Q2V2M9-2 Cluster: Isoform 2 of Q2V2M9 ; n=9; Amniota|Re... 38 0.40 UniRef50_Q4S708 Cluster: Chromosome 14 SCAF14723, whole genome s... 38 0.40 UniRef50_Q4RE14 Cluster: Chromosome undetermined SCAF15155, whol... 38 0.40 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 38 0.40 UniRef50_Q5YPL1 Cluster: Putative stress protein; n=1; Nocardia ... 38 0.40 UniRef50_O86637 Cluster: Putative uncharacterized protein SCO571... 38 0.40 UniRef50_Q1D1I3 Cluster: Response regulator/GGDEF domain protein... 38 0.40 UniRef50_Q1CY00 Cluster: DnaK family protein; n=2; Cystobacterin... 38 0.40 UniRef50_Q0C0P5 Cluster: OmpA family protein; n=1; Hyphomonas ne... 38 0.40 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 38 0.40 UniRef50_A1UGS6 Cluster: Fibronectin-attachment family protein p... 38 0.40 UniRef50_A0QQN9 Cluster: Putative uncharacterized protein; n=1; ... 38 0.40 UniRef50_Q9LJ64 Cluster: Extensin protein-like; n=8; Eukaryota|R... 38 0.40 UniRef50_Q6PSU8 Cluster: Formin homology 2 domain-containing pro... 38 0.40 UniRef50_Q6H899 Cluster: Nuclear protein ZAP-like; n=6; Magnolio... 38 0.40 UniRef50_Q0JQG3 Cluster: Os01g0164400 protein; n=3; Oryza sativa... 38 0.40 UniRef50_Q09084 Cluster: Extensin (Class II) precursor; n=3; Sol... 38 0.40 UniRef50_Q01A81 Cluster: Serine/threonine specific protein phosp... 38 0.40 UniRef50_Q00X46 Cluster: Chromosome 13 contig 1, DNA sequence; n... 38 0.40 UniRef50_A2XRM2 Cluster: Putative uncharacterized protein; n=1; ... 38 0.40 UniRef50_Q7YYP6 Cluster: Hydroxyproline-rich glycoprotein dz-hrg... 38 0.40 UniRef50_Q5C113 Cluster: SJCHGC03128 protein; n=4; Eukaryota|Rep... 38 0.40 UniRef50_O97344 Cluster: Intermediate filament protein IF1; n=2;... 38 0.40 UniRef50_A2FA50 Cluster: Proline-rich protein MP-2-related prote... 38 0.40 UniRef50_Q5KN38 Cluster: Putative uncharacterized protein; n=1; ... 38 0.40 UniRef50_Q2GNY9 Cluster: Putative uncharacterized protein; n=2; ... 38 0.40 UniRef50_Q1EA57 Cluster: Predicted protein; n=12; Pezizomycotina... 38 0.40 UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe gri... 38 0.40 UniRef50_A3LZQ9 Cluster: Predicted protein; n=1; Pichia stipitis... 38 0.40 UniRef50_A2QAJ3 Cluster: Similarity to hypothetical protein YPL2... 38 0.40 UniRef50_A2Q9T1 Cluster: Contig An01c0300, complete genome; n=6;... 38 0.40 UniRef50_Q61900 Cluster: Submaxillary gland androgen-regulated p... 38 0.40 UniRef50_Q2V2M9 Cluster: FH1/FH2 domain-containing protein 3; n=... 38 0.40 UniRef50_P13983 Cluster: Extensin precursor; n=1; Nicotiana taba... 38 0.40 UniRef50_Q86T65 Cluster: Disheveled-associated activator of morp... 38 0.40 UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Sacc... 38 0.40 UniRef50_P19544 Cluster: Wilms tumor protein; n=35; Euteleostomi... 33 0.51 UniRef50_UPI0000E81871 Cluster: PREDICTED: similar to functional... 37 0.52 UniRef50_UPI0000DB6FB3 Cluster: PREDICTED: similar to plexus CG4... 37 0.52 UniRef50_UPI0000D57439 Cluster: PREDICTED: similar to protein ki... 37 0.52 UniRef50_UPI000065D9FC Cluster: Ras-associated and pleckstrin ho... 37 0.52 UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to... 37 0.52 UniRef50_P42859-2 Cluster: Isoform Short of P42859 ; n=7; Deuter... 37 0.52 UniRef50_Q4SS96 Cluster: Chromosome 11 SCAF14479, whole genome s... 37 0.52 UniRef50_Q4RLP1 Cluster: Chromosome 10 SCAF15019, whole genome s... 37 0.52 UniRef50_Q06KR7 Cluster: Viral capsid associated protein; n=3; N... 37 0.52 UniRef50_A6G312 Cluster: Serine/threonine protein kinase; n=1; P... 37 0.52 UniRef50_A5NR52 Cluster: Putative uncharacterized protein; n=1; ... 37 0.52 UniRef50_A3Q1Z8 Cluster: Molecular chaperone-like; n=4; Mycobact... 37 0.52 UniRef50_Q7XUV2 Cluster: OSJNBa0072F16.14 protein; n=3; Oryza sa... 37 0.52 UniRef50_Q69XV3 Cluster: Putative glycine-rich cell wall structu... 37 0.52 UniRef50_A5B8N9 Cluster: Putative uncharacterized protein; n=1; ... 37 0.52 UniRef50_A4S1Y9 Cluster: Predicted protein; n=1; Ostreococcus lu... 37 0.52 UniRef50_Q9UA70 Cluster: Unconventional myosin heavy chain MyoK;... 37 0.52 UniRef50_Q5C200 Cluster: SJCHGC08716 protein; n=1; Schistosoma j... 37 0.52 UniRef50_A2G6R9 Cluster: Putative uncharacterized protein; n=1; ... 37 0.52 UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginali... 37 0.52 UniRef50_A1Z6X9 Cluster: CG11112-PB, isoform B; n=2; Drosophila ... 37 0.52 UniRef50_Q96WL0 Cluster: TPR-containing protein Mql1; n=4; Dikar... 37 0.52 UniRef50_Q6C7Q8 Cluster: Similar to tr|Q95JC9 Sus scrofa Basic p... 37 0.52 UniRef50_Q0U8T6 Cluster: Predicted protein; n=1; Phaeosphaeria n... 37 0.52 UniRef50_A7F7G2 Cluster: Putative uncharacterized protein; n=2; ... 37 0.52 UniRef50_P55114 Cluster: Zinc metalloproteinase nas-33 precursor... 37 0.52 UniRef50_P41832 Cluster: Protein BNI1; n=2; Saccharomyces cerevi... 37 0.52 UniRef50_UPI0001554718 Cluster: PREDICTED: similar to NHS-like 1... 37 0.69 UniRef50_UPI0000D56E18 Cluster: PREDICTED: hypothetical protein;... 37 0.69 UniRef50_UPI0000F30E84 Cluster: UPI0000F30E84 related cluster; n... 37 0.69 UniRef50_Q6NWB3 Cluster: Splicing factor 3b, subunit 4; n=16; Eu... 37 0.69 UniRef50_Q4SIS2 Cluster: Chromosome 21 SCAF14577, whole genome s... 37 0.69 UniRef50_Q4A2S6 Cluster: Putative membrane protein precursor; n=... 37 0.69 UniRef50_Q6M9P0 Cluster: Putative uncharacterized protein; n=1; ... 37 0.69 UniRef50_A4LPA5 Cluster: Intracellular motility protein A; n=6; ... 37 0.69 UniRef50_A1UNN0 Cluster: Putative uncharacterized protein precur... 37 0.69 UniRef50_A0TH68 Cluster: Rhs element Vgr protein; n=16; Burkhold... 37 0.69 UniRef50_A0R4D4 Cluster: Putative uncharacterized protein; n=1; ... 37 0.69 UniRef50_A0J0A0 Cluster: Putative lipoprotein precursor; n=2; Al... 37 0.69 UniRef50_Q6Z4S7 Cluster: Putative uncharacterized protein OSJNBa... 37 0.69 UniRef50_Q6YYS1 Cluster: Putative uncharacterized protein B1047A... 37 0.69 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 37 0.69 UniRef50_Q4PSF3 Cluster: Proline-rich extensin-like family prote... 37 0.69 UniRef50_Q00TR5 Cluster: Homology to unknown gene; n=3; Ostreoco... 37 0.69 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 37 0.69 UniRef50_A7PS25 Cluster: Chromosome chr14 scaffold_27, whole gen... 37 0.69 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 37 0.69 UniRef50_A2YC93 Cluster: Putative uncharacterized protein; n=3; ... 37 0.69 UniRef50_A2X6K1 Cluster: Putative uncharacterized protein; n=3; ... 37 0.69 UniRef50_Q9GP35 Cluster: Spliceosome-associated-protein 114; n=2... 37 0.69 UniRef50_Q61XH9 Cluster: Putative uncharacterized protein CBG039... 37 0.69 UniRef50_Q61UQ5 Cluster: Putative uncharacterized protein CBG051... 37 0.69 UniRef50_Q54PI9 Cluster: Formin homology domain-containing prote... 37 0.69 UniRef50_A7RW05 Cluster: Predicted protein; n=1; Nematostella ve... 37 0.69 UniRef50_A2FFZ7 Cluster: Putative uncharacterized protein; n=1; ... 37 0.69 UniRef50_Q5T8W7 Cluster: Espin; n=51; Euteleostomi|Rep: Espin - ... 37 0.69 UniRef50_Q7S7S6 Cluster: Putative uncharacterized protein NCU042... 37 0.69 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 60.9 bits (141), Expect = 4e-08 Identities = 30/74 (40%), Positives = 31/74 (41%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P +G PP G PPPF PPPPP PPPPP Sbjct: 972 PPPPPPGYGSPPPPPPPPPSYGSPPP--PPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPP 1029 Query: 377 XXXGGGXXPPPPPP 418 GG PPPPPP Sbjct: 1030 PMHGGAPPPPPPPP 1043 Score = 56.8 bits (131), Expect = 6e-07 Identities = 47/174 (27%), Positives = 50/174 (28%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP G PPP G PPPPP PPP Sbjct: 1012 PPPPPPMHGGAPPPPPPPPMHGG-----APPPPPPPPMHGGAPPPPPPPPMHGGAPPPPP 1066 Query: 377 XXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPLXXXKKXXXGVGXXXXXFFFFXXLGGGG 556 GG PPPPPP P G P G + GG Sbjct: 1067 PPMFGGAQPPPPPPMRGGAPPPPPPPMRGGAPPPPPPPMRGGAPPPPP-----PPMHGGA 1121 Query: 557 XKXXXXFXKKKXXXRAPPPPPXXXXKKKXXPXPXXXPXXKXXTXXPXGGPPXXG 718 APPPPP + P P P + P GP G Sbjct: 1122 PPP----PPPPMRGGAPPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPPGPRPPG 1171 Score = 56.4 bits (130), Expect = 8e-07 Identities = 31/77 (40%), Positives = 32/77 (41%), Gaps = 3/77 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX---PPPP 367 PPP P +G PP F PPP GG PPPPP PPPP Sbjct: 985 PPPPPPSYGSPPPPPPPP-----FSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPP 1039 Query: 368 PXXXXXGGGXXPPPPPP 418 P GG PPPPPP Sbjct: 1040 PPPPMHGGAPPPPPPPP 1056 Score = 54.8 bits (126), Expect = 2e-06 Identities = 28/76 (36%), Positives = 32/76 (42%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 ++PPP P +G PP G PPP + PPPPP PPPPP Sbjct: 933 LSPPP--PSYGSPPPPPPPPPSYGS----PPPPPPPPPSYGSPPPPPPPPPGYGSPPPPP 986 Query: 371 XXXXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 987 PPPPSYGSPPPPPPPP 1002 Score = 54.4 bits (125), Expect = 3e-06 Identities = 28/81 (34%), Positives = 30/81 (37%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP PF P G PPP + PPPPP PPPPP Sbjct: 920 PPPPPPFSNAHSVLSPPPPSYGS----PPPPPPPPPSYGSPPPPPPPPPSYGSPPPPPPP 975 Query: 377 XXXGGGXXPPPPPPXXFFFXP 439 G PPPPPP + P Sbjct: 976 PPGYGSPPPPPPPPPSYGSPP 996 Score = 53.2 bits (122), Expect = 7e-06 Identities = 28/77 (36%), Positives = 29/77 (37%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P + PP PPP PPPPP PPPPP Sbjct: 996 PPPPPPPFSHVSSIPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPPPMHGGAPPPPPPP 1055 Query: 377 XXXGGGXXPPPPPPXXF 427 GG PPPPPP F Sbjct: 1056 PMHGGA--PPPPPPPMF 1070 Score = 50.0 bits (114), Expect = 7e-05 Identities = 30/75 (40%), Positives = 30/75 (40%), Gaps = 2/75 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP--XXXXXPPPPP 370 PPP P G PP G PPP G PPPPP PPPPP Sbjct: 1111 PPPPPPMHGGAPPPPPPPMRGGA-----PPPPPPPGGRGPGAPPPPPPPGGRAPGPPPPP 1165 Query: 371 XXXXXGGGXXPPPPP 415 GGG PPPPP Sbjct: 1166 GPRPPGGG--PPPPP 1178 Score = 37.9 bits (84), Expect = 0.30 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 4/51 (7%) Frame = +2 Query: 287 PPPFXXXFXKGGX--PPPPPXXXXXPPPPPXXXXXGGGXX--PPPPPPXXF 427 PPPF G PPPPP PPPP G PPPPPP F Sbjct: 674 PPPFSSERPNSGTVLPPPPP-----PPPPFSSERPNSGTVLPPPPPPPLPF 719 Score = 35.1 bits (77), Expect = 2.1 Identities = 26/80 (32%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +2 Query: 194 TPPPQIP-FWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGX--PPPPPXXXXXPPP 364 TPPP P ++ +K PPPF PPPPP PPP Sbjct: 763 TPPPPPPAYYSVGQKSSDLQTSQLPSPPPPPPPPPFASVRRNSETLLPPPPP-----PPP 817 Query: 365 PPXXXXXGGG--XXPPPPPP 418 PP PPPPPP Sbjct: 818 PPFASVRRNSETLLPPPPPP 837 Score = 34.7 bits (76), Expect = 2.8 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXX--PPPPPPXXF 427 P P + PPPPP PPPP G PPPPPP F Sbjct: 655 PLPTYSHYQTSQLPPPPP-----PPPPFSSERPNSGTVLPPPPPPPPPF 698 Score = 34.3 bits (75), Expect = 3.7 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 1/70 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX-PPPPPX 373 PPP P G PP G PPP G PPP P PPPPP Sbjct: 1123 PPPPPPMRGGAPPPPPPPGGRGPGAP---PPPPPPGGRAPGPPPPPGPRPPGGGPPPPPM 1179 Query: 374 XXXXGGGXXP 403 G P Sbjct: 1180 LGARGAAVDP 1189 Score = 33.1 bits (72), Expect = 8.5 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP + P P P PPGGGPP Sbjct: 1145 PGAPPPPPPPGGR------APGPP--PPPGPRPPGGGPP 1175 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 57.2 bits (132), Expect = 5e-07 Identities = 29/74 (39%), Positives = 30/74 (40%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP + G PP G PPP GG PPPPP PPPPP Sbjct: 668 PPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTG----GGPPPPPPPPGGGPPPPPPP 723 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 724 PGAKAGGPPPPPPP 737 Score = 52.0 bits (119), Expect = 2e-05 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPP PPPPP PPPPP GG PPPPPP Sbjct: 653 PPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPP 712 Score = 51.2 bits (117), Expect = 3e-05 Identities = 31/78 (39%), Positives = 32/78 (41%), Gaps = 4/78 (5%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----PPP 364 PPP + G PP G PPP GG PPPPP PPP Sbjct: 653 PPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPP---PMTGGGPPPPPPPPPMTGGGPPPP 709 Query: 365 PPXXXXXGGGXXPPPPPP 418 PP GGG PPPPPP Sbjct: 710 PP---PPGGGPPPPPPPP 724 Score = 50.0 bits (114), Expect = 7e-05 Identities = 27/69 (39%), Positives = 27/69 (39%), Gaps = 7/69 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-------PPPPPXXXXXGGGXXPPPPPPXXFFFXPXX 445 PPP GG PPPPP PPPPP GG PPPPPP P Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPP 709 Query: 446 XXXGGGXXP 472 GG P Sbjct: 710 PPPPGGGPP 718 Score = 44.8 bits (101), Expect = 0.003 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP G PPP GG PPPPP PPPPP Sbjct: 695 PPPPPPMTGGGPPPPPPPPGGGP------PPPPPPPGAKAGGPPPPPPPFGKGPPPPPGG 748 Query: 377 XXXGGGXXPP 406 PP Sbjct: 749 FGMKKAAAPP 758 Score = 37.5 bits (83), Expect = 0.40 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGG 701 P G PPPPP K P P K P PPGG Sbjct: 713 PGGGPPPPPPPPGAKAGGPPPPPPPFGKGPPPPPGG 748 Score = 34.3 bits (75), Expect = 3.7 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = -1 Query: 555 PPPPKXXKKKKXXXXXPTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXX 376 PPPP P P PPP G GG PPP Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPPPPPPPMTG---------GGPPPPPPPPP 700 Query: 375 XXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGG GGG PP K GG Sbjct: 701 MTGGGPPPPPPPPGGGPPPPPPPPGAKAGG 730 Score = 33.9 bits (74), Expect = 4.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 600 GPPPPPPXXXKKKKXXXXPXXP-----XXXKXXPXPPGGGPP 710 GPPPPPP P P P PPGGGPP Sbjct: 677 GPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPP 718 Score = 33.1 bits (72), Expect = 8.5 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = -1 Query: 555 PPPPKXXKKKKXXXXXPTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXX 376 PPPP P P PPP G GGG PPP Sbjct: 665 PPPPPPPMTGGGGPPPPPPPPPMTGGGPPPPPPPPPMTGGGPPPPPPPPGGGPPPPPPPP 724 Query: 375 XXGGGGGXXFXXGGGGGXPP 316 GG G G PP Sbjct: 725 GAKAGGPPPPPPPFGKGPPP 744 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 57.2 bits (132), Expect = 5e-07 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = +2 Query: 197 PPPQIP-FWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 PPP +P G PP PPP GG PPPPP PPPPP Sbjct: 715 PPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPP 774 Query: 374 XXXXGGGXXPPPPPPXXFF 430 G PPPPPP F Sbjct: 775 PPPGGFKGGPPPPPPPGMF 793 Score = 48.8 bits (111), Expect = 2e-04 Identities = 26/67 (38%), Positives = 27/67 (40%), Gaps = 4/67 (5%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP----PPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXX 454 PPP GG PPPPP P PPPP G PPPPPP F P Sbjct: 730 PPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGGPPPPPP 789 Query: 455 GGGXXPL 475 G P+ Sbjct: 790 PGMFAPM 796 Score = 43.6 bits (98), Expect = 0.006 Identities = 25/66 (37%), Positives = 25/66 (37%), Gaps = 8/66 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP--------PPPPXXXXXGGGXXPPPPPPXXFFFXPX 442 PPP GG PPPPP P PPP GG PPPPPP P Sbjct: 714 PPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGGCPPPPP 773 Query: 443 XXXXGG 460 GG Sbjct: 774 PPPPGG 779 Score = 39.5 bits (88), Expect = 0.098 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = +2 Query: 317 GGXPPP---PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 GG PPP PP PPPPP PPPPPP Sbjct: 711 GGPPPPPGLPPITGGPPPPPPPGGLPPITGGPPPPPP 747 Score = 35.5 bits (78), Expect = 1.6 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 GG PP PPPPP GG PPPPP Sbjct: 701 GGSSALPPITGG-PPPPPGLPPITGGPPPPPPP 732 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 55.6 bits (128), Expect = 1e-06 Identities = 32/81 (39%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX---- 355 K+ PPP P G K PP GK P G PPPPP Sbjct: 486 KLPPPPPPP--GGKLPPPPPPPPGGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPP 543 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPPP GGG PPPPPP Sbjct: 544 PPPPPGKLGPGGGPPPPPPPP 564 Score = 46.0 bits (104), Expect = 0.001 Identities = 24/62 (38%), Positives = 25/62 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP + PPPPP PPPPP GG PPPPPP P G Sbjct: 467 PPPPPPAAERLPAPPPPPVKLPPPPPPP-----GGKLPPPPPPPPGGKLPPPPPPPGKAP 521 Query: 467 XP 472 P Sbjct: 522 PP 523 Score = 35.5 bits (78), Expect = 1.6 Identities = 29/78 (37%), Positives = 30/78 (38%), Gaps = 9/78 (11%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*----KXXPPPFXXXFXKGGXPPPPPXXXXX 355 K+ PPP P G K PP GK K PPP KG PPPPP Sbjct: 497 KLPPPPPPPPGG---KLPPPPPPPGKAPPPPPGGKLPPPP--PPGGKGAPPPPPPPPGKL 551 Query: 356 -----PPPPPXXXXXGGG 394 PPPPP G G Sbjct: 552 GPGGGPPPPPPPPPRGLG 569 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 54.8 bits (126), Expect = 2e-06 Identities = 30/73 (41%), Positives = 30/73 (41%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP PPPF GG PPPPP PPPPP Sbjct: 441 PPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFP-----GGVPPPPPLPGGAPPPPPPP 495 Query: 377 XXXGGGXXPPPPP 415 GGG PPP P Sbjct: 496 PFPGGGVPPPPFP 508 Score = 53.6 bits (123), Expect = 6e-06 Identities = 34/94 (36%), Positives = 35/94 (37%), Gaps = 2/94 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPP--PPXXXXXPPPPP 370 PPP +P G PP PPP G PPP PP PPPPP Sbjct: 425 PPPPLPP-GVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPP 483 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 GG PPPPPP P GGG P Sbjct: 484 ---LPGGAPPPPPPPPFPGGGVPPPPFPGGGPPP 514 Score = 45.2 bits (102), Expect = 0.002 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 8/70 (11%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP--------PPPPXXXXXGGGXXPPPPPPXXFFFXPX 442 PPP G PPPP P PPPP GG PPPPPP P Sbjct: 422 PPPPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPP 481 Query: 443 XXXXGGGXXP 472 GG P Sbjct: 482 PPLPGGAPPP 491 Score = 43.2 bits (97), Expect = 0.008 Identities = 28/72 (38%), Positives = 28/72 (38%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP PF G PP G PPPF GG PPPP PPPPP Sbjct: 468 PPPPPPFPGG---VPPPPPLPGGAPP-PPPPPPFP-----GGGVPPPPFPGGGPPPPPPI 518 Query: 377 XXXGGGXXPPPP 412 G P PP Sbjct: 519 GGMGVPRLPGPP 530 Score = 37.5 bits (83), Expect = 0.40 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP G PPPPPP Sbjct: 420 PPPP-----PPPPPLPPGVGAPPPPPPPPP 444 Score = 36.7 bits (81), Expect = 0.69 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 338 PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPPPP G G PPPPPP Sbjct: 416 PAAAPPPPPPPPPLPPGVGAPPPPPPP 442 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P G PPPPP P P P PGGGPP Sbjct: 475 PGGVPPPPPLPGGAPPPPPPPPFPGGGVPPPPFPGGGPP 513 Score = 33.5 bits (73), Expect = 6.4 Identities = 24/74 (32%), Positives = 26/74 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP +P PP G PPPF GG PPPPP P P Sbjct: 478 VPPPPPLPGGAPPPPPPPPFPGGG------VPPPPFPG----GGPPPPPPIGGMGVPRLP 527 Query: 371 XXXXXGGGXXPPPP 412 G PP P Sbjct: 528 GPPVASG---PPKP 538 Score = 33.1 bits (72), Expect = 8.5 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = -1 Query: 555 PPPPKXXKKKKXXXXXPTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXX 376 PPPP P P PPP G GG PPP Sbjct: 438 PPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPPPPPPPPF 497 Query: 375 XXGGGGGXXFXXGGGGGXPP 316 GG F GG PP Sbjct: 498 PGGGVPPPPFPGGGPPPPPP 517 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 PPPPPP P P P PGG PP Sbjct: 455 PPPPPPGMGGAPPPPPPPPFPGGVPPPPPLPGGAPP 490 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 54.8 bits (126), Expect = 2e-06 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP GGG PPPPPP Sbjct: 511 PPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 554 Score = 46.0 bits (104), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP G G PPPPPP Sbjct: 509 PPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP F PPPPP PPPPP G PPPPPP Sbjct: 490 PPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPP 528 Score = 36.3 bits (80), Expect = 0.91 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 7/38 (18%) Frame = +2 Query: 326 PPPPPX-------XXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 489 PPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPP 526 Score = 34.3 bits (75), Expect = 3.7 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP PPPPPP Sbjct: 485 PPPP-----PPPPPLHAFVAPPPPPPPPPP 509 >UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 9.t00033 - Entamoeba histolytica HM-1:IMSS Length = 540 Score = 53.2 bits (122), Expect = 7e-06 Identities = 28/73 (38%), Positives = 28/73 (38%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP PPP G PPPPP PPPPP Sbjct: 384 PPPPPPARGTGCGAPPPPPPPAFDTGCGIPPPPPPARGTGCGAPPPPPPLNAPPPPPPPA 443 Query: 377 XXXGGGXXPPPPP 415 G G PPPPP Sbjct: 444 HGTGCGVPPPPPP 456 Score = 39.9 bits (89), Expect = 0.074 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 6/50 (12%) Frame = +2 Query: 287 PPPFXXXFXKG-GXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 PPP F G G PPPPP PPPPP G G PPPPP Sbjct: 370 PPPPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPPAFDTGCGI--PPPPP 417 Score = 38.7 bits (86), Expect = 0.17 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPP PPPP PPP G G PPPPP F Sbjct: 359 PPPSYGGHHNVPPPPPPAFDTGCGVPPPPPPARGTGCGAPPPPPPPAF 406 Score = 34.3 bits (75), Expect = 3.7 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G G PPPPP Sbjct: 357 PPPPPSYGGHHNVPPPPPPAFDTGCGV--PPPPP 388 >UniRef50_Q640S7 Cluster: Fmnl1 protein; n=3; Xenopus|Rep: Fmnl1 protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 1167 Score = 53.2 bits (122), Expect = 7e-06 Identities = 28/78 (35%), Positives = 32/78 (41%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP 361 + +I PPP +P PP E G PPP +G PPPP P Sbjct: 613 IAEIPPPPPLPMSADVPPPPPLPELSG------IPPPPPLPMGEQGAPPPPPSMGAPGVP 666 Query: 362 PPPXXXXXGGGXXPPPPP 415 PPP G G PPPPP Sbjct: 667 PPPPPPPSGFGPAPPPPP 684 Score = 43.2 bits (97), Expect = 0.008 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPP G PPPPP PP G PPPPPP F P GG Sbjct: 631 PPPLPEL---SGIPPPPPLPMGEQGAPPPPPSMGAPGVPPPPPPPPSGFGPAPPPPPGG 686 Score = 40.7 bits (91), Expect = 0.042 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGG 460 PPP G PPPP PPP G PPPPPP F GG Sbjct: 629 PPPPPLPELSGIPPPPPLPMGEQGAPPPPPSMGAPGVPPPPPPPPSGFGPAPPPPPGG 686 Score = 36.7 bits (81), Expect = 0.69 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + PPP P PPPPP G PPPP P Sbjct: 606 PPPPLPSIAEIPPPPPLPMSADVPPPPPLPEL--SGIPPPPPLP 647 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 53.2 bits (122), Expect = 7e-06 Identities = 28/75 (37%), Positives = 28/75 (37%), Gaps = 1/75 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKG-GXPPPPPXXXXXPPPPPX 373 PPP G PP PPP G PPPPP PPPPP Sbjct: 598 PPPPPALGGVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPPPPPP 657 Query: 374 XXXXGGGXXPPPPPP 418 G G PPPPPP Sbjct: 658 PPLPGAGPPPPPPPP 672 Score = 49.6 bits (113), Expect = 9e-05 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP PPP PPPPP PPPPP Sbjct: 613 PPPPPPALGAMGAPPPPPPPPPSAAGLPPPPPPPLPGAGPP-PPPPPPLPGAGPPPPPPP 671 Query: 377 XXXGGGXXPPPPPP 418 G G PPPP P Sbjct: 672 PLSGAGPPPPPPMP 685 Score = 36.3 bits (80), Expect = 0.91 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG P P PP GG PPPPPP Sbjct: 572 PPPPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPP 615 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G P P PPP G PPPPPP Sbjct: 573 PPPPPPCIPGGNLSPAPASDVCDSAPPPPPALGGVPPPPPPPPP 616 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 52.4 bits (120), Expect = 1e-05 Identities = 27/76 (35%), Positives = 28/76 (36%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 +T PP P G PP G PPP PPPPP PPPP Sbjct: 306 MTAPPPPPPPGNMSVPPPPPPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPP 365 Query: 371 XXXXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 366 PPPPPGNMCIPPPPPP 381 Score = 48.8 bits (111), Expect = 2e-04 Identities = 27/79 (34%), Positives = 28/79 (35%), Gaps = 2/79 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPP--FXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP P PP G PPP + PPPP PPPPP Sbjct: 350 PPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPPPAPPPPQNASMAPPPPP 409 Query: 371 XXXXXGGGXXPPPPPPXXF 427 G PPPPPP F Sbjct: 410 PPPLGGKFLPPPPPPPPPF 428 Score = 48.4 bits (110), Expect = 2e-04 Identities = 29/88 (32%), Positives = 30/88 (34%), Gaps = 5/88 (5%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----- 355 + PPP P PP G PPP G PPPPP Sbjct: 293 VPPPPPPPGTNTTMTAPPPPPPPGNM---SVPPPPPPPPGNMGVLPPPPPPRPGNMGVPP 349 Query: 356 PPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP G PPPPPP P Sbjct: 350 PPPPPPPGNMGVPPPPPPPPPGNMCIPP 377 Score = 47.6 bits (108), Expect = 4e-04 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP P PPP GG PPPPPP Sbjct: 260 PPPLLPDDDMGDAPPPPPP----PSPPPPGSVYGGSLVPPPPPP 299 Score = 47.2 bits (107), Expect = 5e-04 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP-XXXXXPPPP 367 + PPP P PP G PPP PPPPP PPPP Sbjct: 320 VPPPPPPPPGNMGVLPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPP 379 Query: 368 PXXXXXGGGXXPPPPPP 418 P G PPP PP Sbjct: 380 PPPPGYTGSSLPPPAPP 396 Score = 46.4 bits (105), Expect = 9e-04 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP G PPP PPPPP PPPPP Sbjct: 273 PPPPPP-----PSPPPPGSVYGGSLVPPPPPPPGTNTTMTAPPPPPPPGNMSVPPPPPPP 327 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 328 PG-NMGVLPPPPPP 340 Score = 42.3 bits (95), Expect = 0.014 Identities = 28/87 (32%), Positives = 29/87 (33%), Gaps = 4/87 (4%) Frame = +2 Query: 191 ITPPPQIPFWGXKK-KCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX---P 358 + PPP P G PP G PPP PPPPP P Sbjct: 333 VLPPPPPPRPGNMGVPPPPPPPPPGNMGVPPPPPPPPPGNMCIPPPPPPPPGYTGSSLPP 392 Query: 359 PPPPXXXXXGGGXXPPPPPPXXFFFXP 439 P PP PPPPPP F P Sbjct: 393 PAPPPPQNASMAPPPPPPPPLGGKFLP 419 >UniRef50_Q9LI74 Cluster: Similarity to pherophorin; n=1; Arabidopsis thaliana|Rep: Similarity to pherophorin - Arabidopsis thaliana (Mouse-ear cress) Length = 1004 Score = 52.4 bits (120), Expect = 1e-05 Identities = 30/73 (41%), Positives = 33/73 (45%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP++P + PP GK PP GG PPPPP PPPPP Sbjct: 648 PPRVP------RPPPRSAGGGKSTNLPSARPPLPG----GGPPPPPPPPGGGPPPPP--- 694 Query: 380 XXGGGXXPPPPPP 418 GGG PPPPPP Sbjct: 695 --GGGPPPPPPPP 705 Score = 33.9 bits (74), Expect = 4.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGG 394 GG PPPP PPPPP G G Sbjct: 688 GGPPPPPGGGPPPPPPPPGALGRGAG 713 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 52.4 bits (120), Expect = 1e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPPPP PPPPP GGG PPPPPP P GG Sbjct: 584 PPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGG 629 Score = 50.0 bits (114), Expect = 7e-05 Identities = 28/62 (45%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP---XXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXG 457 PPP GG PPPPP PPPPP GGG PPPPPP P G Sbjct: 584 PPP--PPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGG--PPPPPPMGGKGGPPPPPGG 639 Query: 458 GG 463 GG Sbjct: 640 GG 641 Score = 50.0 bits (114), Expect = 7e-05 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPP PPPPP GGG PPPPPP P GG P Sbjct: 585 PPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMGGGPPPPPPMGGKGGP 633 Score = 38.7 bits (86), Expect = 0.17 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPPPP GGG PPPPPP Sbjct: 577 PPPAPPA---PPPPPMM---GGGPPPPPPPP 601 Score = 38.7 bits (86), Expect = 0.17 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP P G PP G PPP GG PPPPP PPPP Sbjct: 584 PPPPPMMGGGPPPPPPPPMMGGGGPPPPPPPPMMG----GGPPPPPPMGGKGGPPPPPGG 639 Query: 380 XXGGGXXPPPPP 415 G PP Sbjct: 640 GGFGLFNSNKPP 651 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -1 Query: 411 GGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPP 316 GGGG PPP GGG GG GG PP Sbjct: 604 GGGGPPPPPPPPMMGGGPPPPPPMGGKGGPPP 635 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 52.0 bits (119), Expect = 2e-05 Identities = 31/92 (33%), Positives = 32/92 (34%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G + PP G PPP PPPPP PPPP Sbjct: 192 PPPPPPPPGARPGPPPPPPPPGGRPSAPPLPPPGGRA--SAPPPPPPPSTRLGAPPPPPP 249 Query: 377 XXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 GG PPPP P P GG P Sbjct: 250 PGAGGRAPPPPPAPGGRLGGPPPPPPPGGRAP 281 Score = 51.6 bits (118), Expect = 2e-05 Identities = 26/73 (35%), Positives = 28/73 (38%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP F PPP + G PP PP PPPPP Sbjct: 130 PPPPLPAARFNAPPPPPPPPTTHF---NAPPPPPPPPITRSGAPPSPPPPPSPPPPPPPP 186 Query: 377 XXXGGGXXPPPPP 415 G PPPPP Sbjct: 187 GARPGPPPPPPPP 199 Score = 49.2 bits (112), Expect = 1e-04 Identities = 29/89 (32%), Positives = 32/89 (35%), Gaps = 10/89 (11%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-------- 337 L+ + PPP P PP +F PPP F PPPP Sbjct: 111 LRSVPPPPPPPPISHSNAPPPPPLPAARFNAPPPPPPPPTTHFNAPPPPPPPPITRSGAP 170 Query: 338 --PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPPPP G PPPPPP Sbjct: 171 PSPPPPPSPPPPPPPPGARPGPPPPPPPP 199 Score = 48.4 bits (110), Expect = 2e-04 Identities = 29/88 (32%), Positives = 30/88 (34%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP + PPP PPPPP PPPPP Sbjct: 144 PPPPPPTTHFNAPPPPPPPPITRSGAPPSPPPP-----PSPPPPPPPPGARPGPPPPPPP 198 Query: 377 XXXGGGXXPPPPPPXXFFFXPXXXXXGG 460 G PPPPPP P GG Sbjct: 199 PGARPGPPPPPPPPGGRPSAPPLPPPGG 226 Score = 44.8 bits (101), Expect = 0.003 Identities = 25/76 (32%), Positives = 26/76 (34%), Gaps = 2/76 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFX-KGGXP-PPPPXXXXXPPPPP 370 PPP+ G PP PPP G P PPPP PPPP Sbjct: 32 PPPRSGVGGNTPPAPPPPPLRSTVPAISPPPPPPPPPLKPSSGAPCPPPPPPPPPPPPPS 91 Query: 371 XXXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 92 APSSRAFSSAPPPPPP 107 Score = 44.4 bits (100), Expect = 0.003 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 1/82 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX-PPPPPX 373 PPP P PP F PPP PPPPP PPPPP Sbjct: 78 PPPPPP---PPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPPPPPISHSNAPPPPPL 134 Query: 374 XXXXGGGXXPPPPPPXXFFFXP 439 PPPPPP F P Sbjct: 135 PAARFNAPPPPPPPPTTHFNAP 156 Score = 41.1 bits (92), Expect = 0.032 Identities = 26/71 (36%), Positives = 27/71 (38%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP G + PPP GG PPPPP PPPP Sbjct: 232 PPPPPPSTRLGAPPPPPPPGAGG----RAPPPPPAPGGRLGGPPPPPPPGGRAPPPP--- 284 Query: 377 XXXGGGXXPPP 409 G G PPP Sbjct: 285 --RGPGAPPPP 293 Score = 37.5 bits (83), Expect = 0.40 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP GG P PPPP Sbjct: 25 PPPP-----PPPPPPRSGVGGNTPPAPPPP 49 Score = 37.1 bits (82), Expect = 0.52 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPP Sbjct: 25 PPPPP-----PPPPPRSGVGGNTPPAPPPPP 50 Score = 33.5 bits (73), Expect = 6.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGG--GPP 710 PPPPPP + P P P PPG GPP Sbjct: 156 PPPPPPPPITRSGAPPSPPPPPSPPPPPPPPGARPGPP 193 Score = 33.1 bits (72), Expect = 8.5 Identities = 23/80 (28%), Positives = 24/80 (30%) Frame = -1 Query: 555 PPPPKXXKKKKXXXXXPTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXX 376 PPPP + P P PPP G G GG PPP Sbjct: 206 PPPPPPPGGRPSAPPLPPPGGR---ASAPPPPPPPSTRLGAPPPPPPPGAGGRAPPPPPA 262 Query: 375 XXGGGGGXXFXXGGGGGXPP 316 G GG GG PP Sbjct: 263 PGGRLGGPPPPPPPGGRAPP 282 >UniRef50_Q86C16 Cluster: Ah1644 protein; n=7; cellular organisms|Rep: Ah1644 protein - Drosophila melanogaster (Fruit fly) Length = 1644 Score = 52.0 bits (119), Expect = 2e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP GG PPPPPP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 51.6 bits (118), Expect = 2e-05 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 K PPP PPPPP PPPP GG PPPPPP Sbjct: 268 KTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 52.0 bits (119), Expect = 2e-05 Identities = 32/95 (33%), Positives = 33/95 (34%), Gaps = 1/95 (1%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P G PP G PPP PPPPP PPPPP Sbjct: 546 LVPPPPPPPPGASLVPPPPPPPPGAPGL-VPSPPPGAAGLVPPPPPPPPPGASLVPPPPP 604 Query: 371 XXXXXGG-GXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPPP P G G P Sbjct: 605 PPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPP 639 Score = 44.4 bits (100), Expect = 0.003 Identities = 28/79 (35%), Positives = 29/79 (36%), Gaps = 4/79 (5%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P G PP G PPP G PPPPP PPPPP Sbjct: 585 VPPPPPPPPPGASLVPPPPPPPPGAAGLVPPPPPP--PPGAGGIPPPPPPPGAGIPPPPP 642 Query: 371 ----XXXXXGGGXXPPPPP 415 G PPPPP Sbjct: 643 GVPGIPPPPGAPGLPPPPP 661 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPPP PPPPP PPPPPP P G P Sbjct: 538 PPPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVP 586 Score = 40.7 bits (91), Expect = 0.042 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPP PPPPPP Sbjct: 529 PPP-----PSGTAPPPPPPPPGLVPPPPPPPPGASLVPPPPPPP 567 Score = 37.5 bits (83), Expect = 0.40 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 9/53 (16%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG---------GGXXPPPPPP 418 PPP PPPP PPPPP G G PPPPPP Sbjct: 539 PPPPPPGLVPPPPPPPPGASLVPPPPPPPPGAPGLVPSPPPGAAGLVPPPPPP 591 Score = 37.1 bits (82), Expect = 0.52 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P G PP P G PPPPP PPPP Sbjct: 612 LVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAPGLPPPPPGVPGIPPPP- 670 Query: 371 XXXXXGGGXXPPPPP 415 G PPPPP Sbjct: 671 -----GAPGLPPPPP 680 Score = 36.7 bits (81), Expect = 0.69 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPPP G PPPPPP P Sbjct: 529 PPPPSGTAPPPPPPPP---GLVPPPPPPPPGASLVPP 562 Score = 35.9 bits (79), Expect = 1.2 Identities = 26/82 (31%), Positives = 27/82 (32%), Gaps = 6/82 (7%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKG----GXPPPPPXXXXXP 358 + PPP P PP G PPP G PPPP P Sbjct: 599 VPPPPPPPPGAAGLVPPPPPPPPGAGGIPPPPPPPGAGIPPPPPGVPGIPPPPGAPGLPP 658 Query: 359 PPP--PXXXXXGGGXXPPPPPP 418 PPP P G PPPPP Sbjct: 659 PPPGVPGIPPPPGAPGLPPPPP 680 >UniRef50_A2F3Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 634 Score = 52.0 bits (119), Expect = 2e-05 Identities = 25/62 (40%), Positives = 25/62 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP G PPPPP PPPPP G PPPPPP P GG Sbjct: 538 PPPSAPG---AGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPGLAPPPPKAGGSS 594 Query: 467 XP 472 P Sbjct: 595 SP 596 Score = 39.5 bits (88), Expect = 0.098 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPP PPPP PPPPPP P G G P Sbjct: 534 GEAPPPPSAPGAGIPPPPPVPGNAPPPPPPPPPPPGAGAPPPPPPPGPGLAP 585 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 51.6 bits (118), Expect = 2e-05 Identities = 24/49 (48%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPPP PPPPP GGG PPPPPP Sbjct: 428 PPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPP 476 Score = 51.2 bits (117), Expect = 3e-05 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 + G PPPPP PPPPP GG PPPPPP Sbjct: 412 YFSGPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPP 448 Score = 51.2 bits (117), Expect = 3e-05 Identities = 30/76 (39%), Positives = 30/76 (39%), Gaps = 2/76 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP--PPP 370 PPP P G PP G PPP GG PPPPP P PPP Sbjct: 417 PPPPPPPGGVPPPPPPPPPGMGGAPPPPPPPPP-----GMGGGPPPPPPPPPGPGGGPPP 471 Query: 371 XXXXXGGGXXPPPPPP 418 GGG PPPPP Sbjct: 472 PPPPPGGGPPGPPPPP 487 Score = 50.8 bits (116), Expect = 4e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 F G PPPPP PPPPP GG PPPPPP Sbjct: 411 FYFSGPPPPPPPPGGVPPPPPPPPPGMGGAPPPPPPP 447 Score = 35.9 bits (79), Expect = 1.2 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P G PP PPP G PPPPP P PPP Sbjct: 426 VPPPPPPPPPGMGGAPPPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPPGPPP 485 Query: 371 XXXXXGGGXXP 403 G P Sbjct: 486 PPAQLPPGFAP 496 Score = 33.1 bits (72), Expect = 8.5 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXP-XXXKXXPXPPGGGPP 710 P PPPPP P P P PPGGGPP Sbjct: 442 PPPPPPPPGMGGGPPPPPPPPPGPGGGPPPPPPPPGGGPP 481 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 51.6 bits (118), Expect = 2e-05 Identities = 30/76 (39%), Positives = 31/76 (40%), Gaps = 2/76 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX--PPPPP 370 PPP P G K+ PP PPP K G PPPPP PPPPP Sbjct: 547 PPPPPPLPGQHKQTPPPPPPP---------PPPPPLPGQKTGPPPPPPLPGQKAGPPPPP 597 Query: 371 XXXXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 598 PLPGQKTGPPPPPPPP 613 Score = 47.6 bits (108), Expect = 4e-04 Identities = 31/88 (35%), Positives = 33/88 (37%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G K PP G+ K PPP + PPPPP PPP P Sbjct: 567 PPPPPPLPGQKTGPPPPPPLPGQ----KAGPPPPPPLPGQKTGPPPPP-----PPPLPGQ 617 Query: 377 XXXGGGXXPPPPPPXXFFFXPXXXXXGG 460 PPPPPP P GG Sbjct: 618 KAGAPPPPPPPPPPGQKGIPPPPPTFGG 645 Score = 47.6 bits (108), Expect = 4e-04 Identities = 31/78 (39%), Positives = 33/78 (42%) Frame = +2 Query: 185 KKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP 364 +K PPP P G K PP G+ PPP K G PPPPP PPP Sbjct: 576 QKTGPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPPPP-PLPGQKAGAPPPPP-----PPP 629 Query: 365 PPXXXXXGGGXXPPPPPP 418 PP G PPPPP Sbjct: 630 PP------GQKGIPPPPP 641 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 K PPPPP PPPPP PPPPPP Sbjct: 538 KSHPPPPPPP----PPPPPLPGQHKQTPPPPPPPP 568 Score = 35.1 bits (77), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPP P PPPPPP Sbjct: 541 PPPPPPPPPPPPLPGQHKQTPPPPPPPPPP 570 Score = 33.5 bits (73), Expect = 6.4 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 600 GPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPPXXG 719 GPPPPPP +K P P P PP PP G Sbjct: 579 GPPPPPPLPGQKAGPPPPPPLPGQKTGPPPPP--PPPLPG 616 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 51.6 bits (118), Expect = 2e-05 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP PP G PPP F PPPPP PPPPP Sbjct: 1043 PPPGAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPP 1102 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 1103 PPGGAFGVPPPPPP 1116 Score = 50.4 bits (115), Expect = 5e-05 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP GG PPPPP PPPPP GG PPPPPP F P Sbjct: 1056 PPPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGGFGGPPPPPPPPPGGAFGVP 1111 Score = 48.8 bits (111), Expect = 2e-04 Identities = 25/59 (42%), Positives = 25/59 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPP G PPPPP PPPPP G PPPPPP F P GG Sbjct: 1038 PPPPPPPPGAGAAPPPPPP----PPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPPPGG 1092 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPPP G G PPPPPP Sbjct: 1021 PPPPAHPGLSGAAPPPPPP---PPPPPP-----GAGAAPPPPPP 1056 Score = 38.7 bits (86), Expect = 0.17 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 K PPPP PPPPP G PPPPPP Sbjct: 1011 KATAAPPPP-----PPPPPAHPGLSGAAPPPPPPP 1040 Score = 35.9 bits (79), Expect = 1.2 Identities = 26/70 (37%), Positives = 26/70 (37%), Gaps = 4/70 (5%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----PPP 364 PPP P PP G F PPP F GG PPPPP PPP Sbjct: 1057 PPPPPPGGLGGPPPPPPPPPPGGFGGPPPPPPP-PGGF--GGPPPPPPPPPGGAFGVPPP 1113 Query: 365 PPXXXXXGGG 394 PP GG Sbjct: 1114 PPPPGTVIGG 1123 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 51.2 bits (117), Expect = 3e-05 Identities = 35/104 (33%), Positives = 36/104 (34%), Gaps = 2/104 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G K PP PPP PPPPP PPPPP Sbjct: 827 PPPPPPPPGGKSAPPPPPPP----------PPPGGKGAPPPPPPPPPPGSKTGPPPPPPP 876 Query: 377 XXXGG--GXXPPPPPPXXFFFXPXXXXXGGGXXPLXXXKKXXXG 502 G G PPPPPP P GG PL + G Sbjct: 877 PPPGAKTGSAPPPPPPPGGPRPPGPPPPPGGAPPLPPGPRPPGG 920 Score = 44.0 bits (99), Expect = 0.005 Identities = 34/99 (34%), Positives = 34/99 (34%), Gaps = 7/99 (7%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX------P 358 PPP P G PP PPP K G PPPPP P Sbjct: 828 PPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAP 887 Query: 359 PPPPXXXXXGGGXXP-PPPPPXXFFFXPXXXXXGGGXXP 472 PPPP GG P PPPPP P GG P Sbjct: 888 PPPPPP---GGPRPPGPPPPPGGAPPLPPGPRPPGGPDP 923 Score = 40.3 bits (90), Expect = 0.056 Identities = 24/60 (40%), Positives = 24/60 (40%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPP GG PPP PPPPP G G PPPPPP Sbjct: 809 PPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPP---PPPPP----GGKGAPPPPPPP 861 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 585 KXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 K P PPPPPP K P P K P PP PP Sbjct: 837 KSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPPPPPPP 878 Score = 37.1 bits (82), Expect = 0.52 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP K P P K P PP PP Sbjct: 825 PPPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPPPPPPP 863 Score = 35.5 bits (78), Expect = 1.6 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 600 GPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPPXXG 719 GPPPPPP K P P P PPG PP G Sbjct: 869 GPPPPPPPPPPGAKTGSAPPPPPPP-GGPRPPGPPPPPGG 907 Score = 35.1 bits (77), Expect = 2.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +3 Query: 585 KXXPXGPPPPPPXXXKKKKXXXXPXXPXXXK----XXPXPPGGGPPXXG 719 K P PPPPPP K P P K P PP GGP G Sbjct: 852 KGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPG 900 Score = 34.3 bits (75), Expect = 3.7 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKKKXXXXPXXPXXXK--XXPXPPGGGPP 710 K P PPPPPP K P P + P PPGG PP Sbjct: 867 KTGPPPPPPPPPP-GAKTGSAPPPPPPPGGPRPPGPPPPPGGAPP 910 Score = 33.5 bits (73), Expect = 6.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 594 PXGPPPPPPXXXK---KKKXXXXPXXPXXXKXXPXPPGGGPPXXG 719 P PPPPPP K + P P K P PP PP G Sbjct: 807 PPPPPPPPPGGSKTLPRPPPPPPPPPPPGGKSAPPPPPPPPPPGG 851 Score = 33.1 bits (72), Expect = 8.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 806 PPPPPP----PPPPGGSKTLPRPPPPPPPPP 832 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 51.2 bits (117), Expect = 3e-05 Identities = 29/74 (39%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXP-PPPPXXXXXPPPPPX 373 PPP P G PP G+ PPP GG P PPPP PPPPP Sbjct: 514 PPP--PPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPM 571 Query: 374 XXXXGGGXXPPPPP 415 G PPPPP Sbjct: 572 PGMMRPGGGPPPPP 585 Score = 46.4 bits (105), Expect = 9e-04 Identities = 19/33 (57%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXX--GGGXXPPPPPP 418 PPPPP PPPPP GGG PPPPPP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 7/41 (17%) Frame = +2 Query: 317 GGXPPPPPXXXXX-------PPPPPXXXXXGGGXXPPPPPP 418 GG PPPPP PPPPP GG PPPPPP Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 43.2 bits (97), Expect = 0.008 Identities = 27/66 (40%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP----PXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXX 454 PPP GG PPPP P PPPPP GG PPPPP P Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGG---PPPPP------MPGMMRP 577 Query: 455 GGGXXP 472 GGG P Sbjct: 578 GGGPPP 583 Score = 35.9 bits (79), Expect = 1.2 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +2 Query: 335 PPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 P PPPPP GGG PPPPPP P GGG P Sbjct: 507 PKVNIPMPPPPP-----GGGGAPPPPPP------PMPGRAGGGPPP 541 Score = 33.1 bits (72), Expect = 8.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +3 Query: 600 GPPPPPPXXXKKKKXXXXPXXPXXXKXXPXP--------PGGGPP 710 GPPPPPP + P P P P PGGGPP Sbjct: 538 GPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPP 582 >UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: Formin A - Trypanosoma cruzi strain CL Brener Length = 1178 Score = 50.8 bits (116), Expect = 4e-05 Identities = 30/77 (38%), Positives = 30/77 (38%), Gaps = 3/77 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXX---GKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 PPP P G K PP G PPP K G PPPP PPPP Sbjct: 620 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPPPP---PPPP 676 Query: 368 PXXXXXGGGXXPPPPPP 418 P G PPPPPP Sbjct: 677 PPGAGAKSGLPPPPPPP 693 Score = 49.2 bits (112), Expect = 1e-04 Identities = 51/187 (27%), Positives = 52/187 (27%), Gaps = 17/187 (9%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXX---GKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX---- 355 PPP P G K PP G PPP K G PPPPP Sbjct: 524 PPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKS 583 Query: 356 ----PPPPPXXXXXGGGXXPPPPPPXXFFF------XPXXXXXGGGXXPLXXXKKXXXGV 505 PPPPP G PPPPPP P G L G Sbjct: 584 GLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPPPPPPGA 643 Query: 506 GXXXXXFFFFXXLGGGGXKXXXXFXKKKXXXRAPPPPPXXXXKKKXXPXPXXXPXXKXXT 685 G G G K PPPPP K P P P K + Sbjct: 644 GAKSGLPPPPPPPPGAGAKSGL----SPPPPPPPPPPPPGAGAKSGLPPPPPPPPPKAKS 699 Query: 686 XXPXGGP 706 GP Sbjct: 700 RPAQTGP 706 Score = 44.8 bits (101), Expect = 0.003 Identities = 29/87 (33%), Positives = 31/87 (35%), Gaps = 11/87 (12%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXG---KFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX-- 355 +T PP +P G P G PPP K G PPPPP Sbjct: 490 LTMPPSLPTSGIDGIYPAAPSLRGIAASSGLPPPPPPPPPGAGAKSGLPPPPPPPPGAGA 549 Query: 356 ------PPPPPXXXXXGGGXXPPPPPP 418 PPPPP G PPPPPP Sbjct: 550 KSGLPPPPPPPPGAGAKSGLPPPPPPP 576 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 50.4 bits (115), Expect = 5e-05 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPP 418 PPP F PPPPP PPPPP GGG PPPPPP Sbjct: 364 PPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPP 410 Score = 46.4 bits (105), Expect = 9e-04 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 5/65 (7%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP-----XXXXXPPPPPXXXXXGGGXXP 403 PP G PPP PPPPP PPPPP G G P Sbjct: 363 PPPPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPP 422 Query: 404 PPPPP 418 PPPPP Sbjct: 423 PPPPP 427 Score = 45.6 bits (103), Expect = 0.001 Identities = 27/78 (34%), Positives = 27/78 (34%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP F G PP PPP PPPPP PPP Sbjct: 365 PPPPPGFLGPPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPP 424 Query: 377 XXXGGGXXPPPPPPXXFF 430 G G PPPPPP F Sbjct: 425 PPPGCG--PPPPPPMGSF 440 Score = 43.6 bits (98), Expect = 0.006 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP PPP G PPPPP PPPPP Sbjct: 378 PPPPLPGNTGAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPPM 437 Query: 377 XXXGGGXXPPPPPP 418 G PP P Sbjct: 438 GSFGQKPENPPRKP 451 Score = 41.5 bits (93), Expect = 0.024 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 4/57 (7%) Frame = +2 Query: 314 KGGXPPPPPXXXXXP----PPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 K G PPPPP P PPPP G PPPPP P GGG P Sbjct: 355 KAGAPPPPPPPPPPPGFLGPPPPPPPPLPGNTGAPPPPP------PPPPLPGGGPPP 405 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 50.4 bits (115), Expect = 5e-05 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 2/81 (2%) Frame = +2 Query: 182 LKKITPPPQIP--FWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX 355 LK PPP P F K PP PPP PPPPP Sbjct: 487 LKHFAPPPPTPPAFKPLKGSAPPPPP-----------PPPLPTTIAAPPPPPPPPRAAVA 535 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPPP Sbjct: 536 PPPPPPPPGTAAAPPPPPPPP 556 Score = 47.6 bits (108), Expect = 4e-04 Identities = 27/78 (34%), Positives = 29/78 (37%), Gaps = 4/78 (5%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----PPP 364 PPP P G + PP + P P G PPPPP PPP Sbjct: 549 PPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPP 608 Query: 365 PPXXXXXGGGXXPPPPPP 418 PP G PPPPPP Sbjct: 609 PPPMAMANGAAGPPPPPP 626 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP G PPP PPPPP P PPP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP-PGTQAAPPPPPPPPMQNRAPSPPPMP 581 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 582 MGNSGSGGPPPPPP 595 Score = 45.2 bits (102), Expect = 0.002 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP---PXXXX 352 LK PPP P PP F PP F PPPP P Sbjct: 469 LKHFAPPPPPPL-------PPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIA 521 Query: 353 XPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPPP Sbjct: 522 APPPPPPPPRAAVAPPPPPPPP 543 Score = 45.2 bits (102), Expect = 0.002 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 7/80 (8%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX------- 355 PPP P PP G PPP G PPPPP Sbjct: 564 PPPPPPMQNRAPSPPPMP--MGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGP 621 Query: 356 PPPPPXXXXXGGGXXPPPPP 415 PPPPP G PPPPP Sbjct: 622 PPPPPRMGMANGAAGPPPPP 641 Score = 38.3 bits (85), Expect = 0.23 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 3/79 (3%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX---PP 361 + PPP P G PP G PPP + PPP P PP Sbjct: 534 VAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP--PMQNRAPSPPPMPMGNSGSGGPP 591 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP Sbjct: 592 PPPPPMPLANGAT-PPPPP 609 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 9/53 (16%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP---------XXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PP PP G PPPPPP Sbjct: 462 PPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Score = 35.5 bits (78), Expect = 1.6 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 454 PPPPP-----PPPPPPAVMPLKHFAPPPPPP 479 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 50.4 bits (115), Expect = 5e-05 Identities = 28/62 (45%), Positives = 28/62 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP GG PPPPP PPPPP GGG PPPPPP P GG Sbjct: 549 PPPPPAPPVSGGGPPPPP-----PPPPPSS---GGGPPPPPPPPSSGGPPPPPPPPGGMK 600 Query: 467 XP 472 P Sbjct: 601 KP 602 Score = 41.5 bits (93), Expect = 0.024 Identities = 24/51 (47%), Positives = 24/51 (47%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP PPPP GGG PPPPPP P GGG P Sbjct: 543 GAPPPPP------PPPPAPPVSGGG--PPPPPP------PPPPSSGGGPPP 579 Score = 36.3 bits (80), Expect = 0.91 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = +2 Query: 203 PQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXX 382 P P G PP PPP GG PPPPP PPPP Sbjct: 537 PSSPSLGAPPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPPPPPPPSSGGPPPP-PPP 595 Query: 383 XGGGXXPPPP 412 GG P P Sbjct: 596 PGGMKKPGAP 605 >UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 50.4 bits (115), Expect = 5e-05 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP GG PPPPPP Sbjct: 278 GSAPPPPPSDGSLPPPPPPPPGAPGGGAPPPPPP 311 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPP PPPP G G PPPPPP Sbjct: 292 PPPPPPPGAPGGGAPPPP------PPPPPAAAGGAGVPPPPPPP 329 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPPP PPPP G PPPPPP Sbjct: 293 PPPPPPGAPGGGAPPPPP-----PPPPAAAGGAGVPPPPPPPPP 331 Score = 42.3 bits (95), Expect = 0.014 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP--PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP P PPPPP GG PPPPP Sbjct: 282 PPPPSDGSLPPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPPP 327 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 50.0 bits (114), Expect = 7e-05 Identities = 33/110 (30%), Positives = 35/110 (31%), Gaps = 4/110 (3%) Frame = +2 Query: 158 SPXFXXXXLKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP 337 SP L + PPP P + PP G PPP PPPP Sbjct: 544 SPPSRPEMLASLPPPPPPPPMPGIMQPPPPPPMPGMMSGPPPPPPPMPEMMSGPPPPPPP 603 Query: 338 P----XXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPL 475 P PPPPP G PPPPP P GG L Sbjct: 604 PMPGMMSGPPPPPPPIPGMMTGPPSPPPPPLVATVVGPPPPLPPGGPAAL 653 Score = 40.3 bits (90), Expect = 0.056 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP G PPP PPPPP PPP Sbjct: 586 PPPPMPEMMSGPPPPPPPPMPGMMSGPPPPPPPIPGMMTGPPSPPPPPLVATVVGPPPPL 645 Query: 377 XXXGGGXXPPPP 412 G P PP Sbjct: 646 PPGGPAALPLPP 657 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 50.0 bits (114), Expect = 7e-05 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G PPPPP PPPPP G G PPPPP Sbjct: 955 PPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPP 997 Score = 49.6 bits (113), Expect = 9e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPPP PPPP G PPPPPP Sbjct: 954 PPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAGPGGPPPPPP 997 Score = 36.7 bits (81), Expect = 0.69 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 335 PPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 P PPPPP GG PPPPPP P G G Sbjct: 946 PEQAPLFPPPPPPPPPGVGGPPPPPPPPGMGGPPPPPPPPGAG 988 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 49.6 bits (113), Expect = 9e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX--PPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP GGG PPPPPP Sbjct: 584 PPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPP 629 Score = 44.8 bits (101), Expect = 0.003 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP G PPPP PPPPP G PPPPPP P G G Sbjct: 579 PPPPPPPPLPGAEAPPPP-----PPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGP 633 Query: 467 XP 472 P Sbjct: 634 PP 635 Score = 41.9 bits (94), Expect = 0.018 Identities = 24/70 (34%), Positives = 25/70 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP G PPP GG PPPPP PPPPP Sbjct: 583 PPPPLPGAEAPPPPPPPPPPSGSGGAPPPPPPPPPPG---GGPPPPPPPPGSGPPPPPGA 639 Query: 377 XXXGGGXXPP 406 G P Sbjct: 640 PPAPGAETGP 649 Score = 40.7 bits (91), Expect = 0.042 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX---PPPPPXXXXXGGGXXPPPPP 415 PPP GG PPPPP PPPPP G PPPPP Sbjct: 596 PPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSG----PPPPP 637 Score = 37.5 bits (83), Expect = 0.40 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP P PPPPP PPPPPP Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPP 600 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP P PPPPP PPPPPP Sbjct: 571 PPSPAAAPPPPPPPPPLPGAEAPPPPPPPPP 601 Score = 34.3 bits (75), Expect = 3.7 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP PPPPPP Sbjct: 578 PPPP-----PPPPPLPGAEAPPPPPPPPPP 602 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 PPPPPP P P P PPGGGPP Sbjct: 594 PPPPPPPPPSGSGGAPPPPPP------PPPPGGGPP 623 Score = 33.1 bits (72), Expect = 8.5 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXP--XXXKXXPXPPGGGPP 710 P PPPPPP P P P PPG GPP Sbjct: 594 PPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPPPPPPGSGPP 634 >UniRef50_Q5AAF4 Cluster: Putative uncharacterized protein BNI1; n=1; Candida albicans|Rep: Putative uncharacterized protein BNI1 - Candida albicans (Yeast) Length = 1485 Score = 49.6 bits (113), Expect = 9e-05 Identities = 29/77 (37%), Positives = 31/77 (40%), Gaps = 3/77 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP---XXXXXPPPP 367 PPP +P + K PP G F PPP F K PPPPP PPPP Sbjct: 845 PPPPVPDF-IKSAAPPPPPLPG-FMNASAPPPPPVPEFIKSSAPPPPPLPGFITTTPPPP 902 Query: 368 PXXXXXGGGXXPPPPPP 418 P PPPP P Sbjct: 903 PPLPGFITTTPPPPPMP 919 Score = 39.5 bits (88), Expect = 0.098 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 4/82 (4%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----PPP 364 PPP+ K P F PPP F PPPPP PPP Sbjct: 834 PPPE-----SKDSVAPPPPPVPDFIKSAAPPPPPLPGFMNASAPPPPPVPEFIKSSAPPP 888 Query: 365 PPXXXXXGGGXXPPPPPPXXFF 430 PP PPPPPP F Sbjct: 889 PPLPGFI--TTTPPPPPPLPGF 908 Score = 36.7 bits (81), Expect = 0.69 Identities = 22/66 (33%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP---XXXX 352 +K PPP P G P +F PPP F PPPPP Sbjct: 853 IKSAAPPPP-PLPGFMNASAPPPPPVPEFIKSSAPPPPPLPGFITTTPPPPPPLPGFITT 911 Query: 353 XPPPPP 370 PPPPP Sbjct: 912 TPPPPP 917 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PP PPPP PPPP PPPPP F Sbjct: 821 PPLPESKDPVAQPPPPESKDSVAPPPPPVPDFIKSAAPPPPPLPGF 866 >UniRef50_O60610 Cluster: Protein diaphanous homolog 1; n=43; Euteleostomi|Rep: Protein diaphanous homolog 1 - Homo sapiens (Human) Length = 1248 Score = 49.6 bits (113), Expect = 9e-05 Identities = 28/75 (37%), Positives = 31/75 (41%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G + PP G PPP + G PPPPP P PP Sbjct: 654 IPPPPPLP--GSARIPPPPPPLPGS----AGIPPPPPPLPGEAGMPPPPPPLPGGPGIPP 707 Query: 371 XXXXXGGGXXPPPPP 415 GG PPPPP Sbjct: 708 PPPFPGGPGIPPPPP 722 Score = 43.2 bits (97), Expect = 0.008 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP PPP P PPPPP G PPPP P P GG Sbjct: 657 PPPLPGSARIPPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIPPPPPFPGGPG 716 Query: 467 XP 472 P Sbjct: 717 IP 718 Score = 41.9 bits (94), Expect = 0.018 Identities = 27/75 (36%), Positives = 28/75 (37%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 IT PP +P PP G PPP PPPPP PPPPP Sbjct: 561 ITVPPSVPSRAPVPPAPPLPGDSGTIIP----PPPAPGD---STTPPPPP-----PPPPP 608 Query: 371 XXXXXGGGXXPPPPP 415 GG PPPP Sbjct: 609 PPPLPGGTAISPPPP 623 Score = 39.9 bits (89), Expect = 0.074 Identities = 27/77 (35%), Positives = 29/77 (37%), Gaps = 1/77 (1%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-PXXXXXPPPP 367 I+PPP + PP E G P P PPPP P PPPP Sbjct: 618 ISPPPPLSGDATIPPPPPLPEGVG-------IPSPSSLPGGTAIPPPPPLPGSARIPPPP 670 Query: 368 PXXXXXGGGXXPPPPPP 418 P G PPPPPP Sbjct: 671 PPLP--GSAGIPPPPPP 685 Score = 37.5 bits (83), Expect = 0.40 Identities = 29/79 (36%), Positives = 30/79 (37%), Gaps = 2/79 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP--PPPP 370 PPP P G PP G+ PPP G PPPPP P PPPP Sbjct: 667 PPPPPPLPGSAGIPPPPPPLPGE----AGMPPPPPPLPGGPGIPPPPPF-PGGPGIPPPP 721 Query: 371 XXXXXGGGXXPPPPPPXXF 427 G PPPPP F Sbjct: 722 P------GMGMPPPPPFGF 734 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 49.2 bits (112), Expect = 1e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP GG PPPPPP Sbjct: 459 PPPPPPPPPPPPPPPTQSSAAGGGPPPPPPP 489 Score = 49.2 bits (112), Expect = 1e-04 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP GG PPPPP PPPPP G PPPPPP F Sbjct: 470 PPPPTQSSAAGGGPPPPP-----PPPPPPTPMIGVPPPPPPPPPSVF 511 Score = 48.4 bits (110), Expect = 2e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP GGG PPPPPP Sbjct: 460 PPPPPPPPPPPPPPTQSSAAGGGPPPPPPPP 490 Score = 46.8 bits (106), Expect = 6e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 458 PPPPPPPPPPPPPPPPTQSSAAGGGPPPPPP 488 Score = 45.2 bits (102), Expect = 0.002 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPP GG PPPPP PPPPP G PPPPPP F Sbjct: 471 PPPTQSSAAGGGPPPPPP-----PPPPPTPMI--GVPPPPPPPPPSVF 511 Score = 34.7 bits (76), Expect = 2.8 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP + PPPPP PPPPP G P P P Sbjct: 506 PPPSVFAGGQQQQPPPPPP----PPPPPGAASQGSSQGPSPLP 544 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 49.2 bits (112), Expect = 1e-04 Identities = 30/89 (33%), Positives = 33/89 (37%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G P + PP +GG PPPPP PPPP Sbjct: 28 PPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGYPPPPQGGFPPPPPGGYPPPPPPQ-- 85 Query: 377 XXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 GG PPPPPP + P G G Sbjct: 86 ----GGSYPPPPPPGAAGYPPPGYPGGPG 110 Score = 47.6 bits (108), Expect = 4e-04 Identities = 30/92 (32%), Positives = 32/92 (34%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP PPP +GG PPPPP PPP Sbjct: 18 PPPPPPDGGYPPPPPPDGGYPPAQPG-GFGPPP------QGGYPPPPPPGGYPPPPQGGF 70 Query: 377 XXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPPP + P G P Sbjct: 71 PPPPPGGYPPPPPPQGGSYPPPPPPGAAGYPP 102 Score = 40.3 bits (90), Expect = 0.056 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 11/48 (22%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPP-----XXXXXGG------GXXPPPPPPXXF 427 GG PPPPP PPPPP GG G PPPPPP + Sbjct: 15 GGYPPPPPPDGGYPPPPPPDGGYPPAQPGGFGPPPQGGYPPPPPPGGY 62 Score = 39.1 bits (87), Expect = 0.13 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPP PPPPP GG PPPPP + P G G P Sbjct: 7 GNNPPPPDGGYPPPPPP-----DGGYPPPPPPDGGY---PPAQPGGFGPPP 49 >UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like; n=3; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to dishevelled associated activator of morphogenesis 1 like - Strongylocentrotus purpuratus Length = 801 Score = 48.8 bits (111), Expect = 2e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 G PPPPP PPPP GG PPPPPP F Sbjct: 254 GAPPPPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMF 289 Score = 48.4 bits (110), Expect = 2e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 G PPPPP PPPPP GG PPPPP Sbjct: 254 GAPPPPPPMMGGAPPPPPPPPGPGGAPPPPPPP 286 Score = 48.0 bits (109), Expect = 3e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP--PP 418 PPP PPPPP PPPPP GGG PPPP PP Sbjct: 257 PPPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPPGAPP 302 Score = 35.1 bits (77), Expect = 2.1 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPP----GGGPP 710 P PPPPPP P P P PP GGGPP Sbjct: 253 PGAPPPPPPMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGPP 295 Score = 34.7 bits (76), Expect = 2.8 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX----PPPPPXXXXXGGGXXP 403 PPP GG PPPPP PPPPP GG P Sbjct: 267 PPPPPPPPGPGGAPPPPPPPGMFGGGGPPPPPGAPPFGGMSAP 309 Score = 34.3 bits (75), Expect = 3.7 Identities = 22/55 (40%), Positives = 22/55 (40%), Gaps = 2/55 (3%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXG--GGXXP 472 K G P P PPPPP GG PPPPPP P G GG P Sbjct: 246 KSGVPAAP----GAPPPPP--PMMGGAPPPPPPPPGPGGAPPPPPPPGMFGGGGP 294 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 48.8 bits (111), Expect = 2e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PP G PPPPP PPPPP GG PPPPP Sbjct: 522 PPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPKGGAPPPPPPP 563 Score = 46.8 bits (106), Expect = 6e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPPPP PPPPP GG PPPPPP Sbjct: 511 PPAPPLPGAGVPPPPPPPGAGAPPPPP--PPAGGAPPPPPPPP 551 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPP G PPPPPP Sbjct: 520 GVPPPPPPPGAGAPPPPPPPAGGAPPPPPPPPP 552 Score = 41.1 bits (92), Expect = 0.032 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPP PP PP G G PPPPPP P GG P Sbjct: 502 PPPPSAPGVPPAPPLP---GAGVPPPPPPPGAGAPPPPPPPAGGAPPP 546 Score = 40.3 bits (90), Expect = 0.056 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP--PPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PPPP GG PPPPPP Sbjct: 522 PPPPPPPGAGAPPPPPPPAGGAPPPPPPPPPK----GGAPPPPPPP 563 Score = 39.9 bits (89), Expect = 0.074 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PP PP PPPP G G PPPPPP Sbjct: 509 GVPPAPPLPGAGVPPPPPP--PGAGAPPPPPPP 539 Score = 39.1 bits (87), Expect = 0.13 Identities = 27/73 (36%), Positives = 28/73 (38%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P G PP G PPP KGG PPPPP PPPP Sbjct: 521 VPPPPPPPGAGAP---PPPPPPAGGAPPPPPPPPP------KGGAPPPPPPPARAPPPP- 570 Query: 371 XXXXXGGGXXPPP 409 G PPP Sbjct: 571 ------AGTPPPP 577 Score = 36.7 bits (81), Expect = 0.69 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPP--PPPP 418 PPPPP PPPPP PP PPPP Sbjct: 98 PPPPPPKSDAPPPPPARPPPPPPTAPPATPPPP 130 Score = 35.1 bits (77), Expect = 2.1 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP K PPPPP PPPPP PPPPPP Sbjct: 100 PPP-----PKSDAPPPPPA--RPPPPPPTAPP----ATPPPPPP 132 Score = 34.3 bits (75), Expect = 3.7 Identities = 23/73 (31%), Positives = 24/73 (32%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PP P + PP PPP PPPPP PPPPP Sbjct: 85 PPAPAPAAPPPARPPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPPP---NHPPPPPPK 141 Query: 377 XXXGGGXXPPPPP 415 PPPPP Sbjct: 142 ----SNDIPPPPP 150 Score = 33.9 bits (74), Expect = 4.9 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPP PP Sbjct: 136 PPPPPKSNDIPPPPP-------AAIPPPAPP 159 >UniRef50_UPI0000E80701 Cluster: PREDICTED: similar to formin, inverted; n=1; Gallus gallus|Rep: PREDICTED: similar to formin, inverted - Gallus gallus Length = 1208 Score = 48.4 bits (110), Expect = 2e-04 Identities = 32/92 (34%), Positives = 32/92 (34%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP G PPP GG PPPPP PPP Sbjct: 368 PPPPPPLPGMAV-IPPPPPLPGM----AVIPPPPPPLPGMGGIPPPPPLPGMGGIPPPPP 422 Query: 377 XXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 GG PPPP P P G G P Sbjct: 423 LPGLGGIPPPPPLPGLAGIPPPPPLPGMGGIP 454 Score = 47.2 bits (107), Expect = 5e-04 Identities = 31/94 (32%), Positives = 32/94 (34%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P PP G PPP GG PPPPP PPP Sbjct: 380 IPPPPPLPGMAVIPPPPPPLPGMGGIPP----PPPLPGM---GGIPPPPPLPGLGGIPPP 432 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPP P P G G P Sbjct: 433 PPLPGLAGIPPPPPLPGMGGIPPPPPLSGMGGIP 466 Score = 45.6 bits (103), Expect = 0.001 Identities = 28/76 (36%), Positives = 29/76 (38%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPP PPPP Sbjct: 405 IPPPPPLPGMGGIPPPPPLPGLGG-------IPPPPPLPGLAGIPPPPPLPGMGGIPPPP 457 Query: 371 XXXXXGGGXXPPPPPP 418 GG PPPP P Sbjct: 458 PLSGMGGIPPPPPPLP 473 Score = 36.7 bits (81), Expect = 0.69 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 2/69 (2%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP--XXXXXPPP 364 I PPP +P G PP G PPP GG PPPPP PPP Sbjct: 417 IPPPPPLPGLGGIPPPPPLPGLAGI-----PPPPPLPGM---GGIPPPPPLSGMGGIPPP 468 Query: 365 PPXXXXXGG 391 PP G Sbjct: 469 PPPLPGMAG 477 >UniRef50_Q55DK4 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1561 Score = 48.4 bits (110), Expect = 2e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP GG PPPPPP Sbjct: 1037 PPPPPISGAPPPPPPPPPPMKGGAGPPPPPP 1067 Score = 45.2 bits (102), Expect = 0.002 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP GG PPPPPP Sbjct: 1038 PPPPISGAPPPPPPPPPPMKGGAGPPPPPPP 1068 Score = 33.9 bits (74), Expect = 4.9 Identities = 25/84 (29%), Positives = 28/84 (33%), Gaps = 5/84 (5%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP 361 +K++ PPP P K P PPP PPPP PP Sbjct: 1006 IKQMEPPP--PPISVKSPDDPNNAAPIVVAPIPPPPPPISGAPPPPPPPPPPMKGGAGPP 1063 Query: 362 PPPXXXXXGGGXXPPP-----PPP 418 PPP G PP PPP Sbjct: 1064 PPPPPPGKLGAKKPPAGVQCRPPP 1087 >UniRef50_Q16F81 Cluster: Diaphanous; n=3; Endopterygota|Rep: Diaphanous - Aedes aegypti (Yellowfever mosquito) Length = 1014 Score = 48.4 bits (110), Expect = 2e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP GGG PPPPPP Sbjct: 432 PPPPQMPGMGPPPPPPPPGSGGGMPPPPPPP 462 Score = 41.5 bits (93), Expect = 0.024 Identities = 29/82 (35%), Positives = 30/82 (36%), Gaps = 7/82 (8%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXK-------GGXPPPPPXXX 349 I PPPQ+P G PP G PPP GG P PPP Sbjct: 431 IPPPPQMPGMGPPPPPPPPGSGGGMPPP---PPPPMMPGVPMPPPMPGMGGAPRPPPMPG 487 Query: 350 XXPPPPPXXXXXGGGXXPPPPP 415 PPPPP G PP PP Sbjct: 488 MGPPPPPMP-----GMGPPRPP 504 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 48.4 bits (110), Expect = 2e-04 Identities = 25/74 (33%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP PPP + PPPPP PPPP Sbjct: 316 PPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPPPPPP 375 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 376 PPFGNAPPPPPPPP 389 Score = 47.6 bits (108), Expect = 4e-04 Identities = 28/74 (37%), Positives = 29/74 (39%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G + PP G PPP F PPPPP P PPP Sbjct: 346 PPPPPPLPGQQAPPPPPPLPGGA-----RPPPPPPPPFGNAPPPPPPPPGSKIPGPPPPP 400 Query: 377 XXXGGGXXPPPPPP 418 GG PP PPP Sbjct: 401 ----GGPRPPGPPP 410 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP PPPP PPPPP GG PPPPPP F Sbjct: 335 PPPIPGQQNPPPPPPPPLPGQQAPPPPPPLP---GGARPPPPPPPPF 378 Score = 43.2 bits (97), Expect = 0.008 Identities = 26/74 (35%), Positives = 28/74 (37%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G + PP PPP + PPPPP PPPPP Sbjct: 332 PPPPPPIPGQQNPPPPPPPPLPGQQA--PPPPPPLPGGARPPPPPPPPFGNAPPPPPPPP 389 Query: 377 XXXGGGXXPPPPPP 418 G P PPPP Sbjct: 390 ----GSKIPGPPPP 399 Score = 39.1 bits (87), Expect = 0.13 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G + PP G PPP K PPPPP P PPP Sbjct: 358 PPPPPPLPGGARPPPPPPPPFGN-----APPPPPPPPGSKIPGPPPPPGGPRPPGPPPPP 412 Query: 377 XXXGG 391 GG Sbjct: 413 GQAGG 417 Score = 37.9 bits (84), Expect = 0.30 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 288 PPPPPP----PPPPPLPNSTSNVTAPPPPPP 314 Score = 37.5 bits (83), Expect = 0.40 Identities = 28/93 (30%), Positives = 29/93 (31%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP PPPPP PPPPP Sbjct: 287 SPPPPPP-----PPPPPLPNSTSNVTAPPPPPPPPPPPLPNSQAPPPPPP---PPPPPPI 338 Query: 374 XXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPP P P GG P Sbjct: 339 PGQQNPPPPPPPPLPGQQAPPPPPPLPGGARPP 371 >UniRef50_Q7T318 Cluster: Wiskott-Aldrich syndrome; n=7; Euteleostomi|Rep: Wiskott-Aldrich syndrome - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 479 Score = 48.0 bits (109), Expect = 3e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPPP PPPPPP Sbjct: 336 PPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPPP 379 Score = 46.8 bits (106), Expect = 6e-04 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + G PPPPP PPPP PPPPPP Sbjct: 335 PPPPAPHCNRSGPPPPPPPSQSHKPPPPPMGACAPPPPPPPPPP 378 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +2 Query: 320 GXPPPPPXXXXXP---PPPPXXXXXGGGXXPPPPP 415 G PPPP P PPPP G PPPPP Sbjct: 319 GRPPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPP 353 Score = 33.5 bits (73), Expect = 6.4 Identities = 26/84 (30%), Positives = 28/84 (33%), Gaps = 10/84 (11%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX- 373 PPP G + PP PPP + PPPPP PPPPP Sbjct: 321 PPPPSRSPGPPHRGPPPPAPHCNRSGPPPPPPP-----SQSHKPPPPPMGACAPPPPPPP 375 Query: 374 --XXXXGG-------GXXPPPPPP 418 G PPPPPP Sbjct: 376 PPPPSSSGNFSSSPVSSAPPPPPP 399 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 48.0 bits (109), Expect = 3e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPF PPPPP PPPPP PPPPPP Sbjct: 212 PPPFRDRPVASPSPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 255 Score = 39.1 bits (87), Expect = 0.13 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP PPPPP PPPPP PPPP Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPP 272 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP P PPPPPP Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PP PP PPPPPP Sbjct: 230 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPP PP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PP PPP Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP P PPPP Sbjct: 235 PPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPP P Sbjct: 237 PPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 Score = 37.9 bits (84), Expect = 0.30 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPP P Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPPPPKGP 275 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSPNPP 270 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 >UniRef50_Q5KG31 Cluster: Putative uncharacterized protein; n=3; Basidiomycota|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 464 Score = 48.0 bits (109), Expect = 3e-04 Identities = 30/95 (31%), Positives = 32/95 (33%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P + PP PPP G PPPP PPPP Sbjct: 277 VPPPPPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPP------PPPP 330 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPL 475 GG PPPPPP P GG L Sbjct: 331 PARPPGGAPPPPPPPPTSAPSAPPLPTASGGRSAL 365 Score = 33.1 bits (72), Expect = 8.5 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXP-XPPGGGPP 710 P PPPPPP + P P PPGG PP Sbjct: 301 PSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPP 340 >UniRef50_A2QUG1 Cluster: Similarity to the N. crassa protein. Additionally; n=5; Trichocomaceae|Rep: Similarity to the N. crassa protein. Additionally - Aspergillus niger Length = 578 Score = 48.0 bits (109), Expect = 3e-04 Identities = 29/78 (37%), Positives = 31/78 (39%), Gaps = 4/78 (5%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----PPP 364 PPP P G PP + + PP F F GG PPPP PPP Sbjct: 452 PPPPPPPVGYHAPPPPPPQMG--YPSAAGVPPHFA--FPPGGPAPPPPPPPNYQGTWPPP 507 Query: 365 PPXXXXXGGGXXPPPPPP 418 PP G PPPPPP Sbjct: 508 PPPAMNLGAAHPPPPPPP 525 Score = 39.1 bits (87), Expect = 0.13 Identities = 26/84 (30%), Positives = 33/84 (39%), Gaps = 3/84 (3%) Frame = +2 Query: 185 KKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP 364 + I PPP+ + + + PP G PPP + PPPPP P Sbjct: 426 RSIPPPPE---YHHQPQYPPPHNAYGNTAP---PPPPPPVGYHA---PPPPPPQMGYPSA 476 Query: 365 ---PPXXXXXGGGXXPPPPPPXXF 427 PP GG PPPPPP + Sbjct: 477 AGVPPHFAFPPGGPAPPPPPPPNY 500 Score = 37.5 bits (83), Expect = 0.40 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP P PP G PPPPPP + P Sbjct: 429 PPPPEYHHQPQYPPPHNAYGNTAPPPPPPPVGYHAPP 465 Score = 35.5 bits (78), Expect = 1.6 Identities = 24/72 (33%), Positives = 26/72 (36%), Gaps = 14/72 (19%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX----PPPPPXXXXXGGGXXPPPP----------PPXX 424 PPP +G PPPPP PPPPP G PPP PP Sbjct: 492 PPPPPPPNYQGTWPPPPPPAMNLGAAHPPPPPPPHAAHQGSHFPPPYGQGQYVQQMPPGS 551 Query: 425 FFFXPXXXXXGG 460 + F P GG Sbjct: 552 YHFPPPHPGRGG 563 >UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 664 Score = 47.2 bits (107), Expect = 5e-04 Identities = 31/91 (34%), Positives = 31/91 (34%), Gaps = 9/91 (9%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX------ 355 TPPP P P G PPP GG PPPPP Sbjct: 483 TPPPPPP---PPASSRPVPGVPGGVPPPPPPPPPGPGPAAAGGPPPPPPPPPGAAPSFGS 539 Query: 356 ---PPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP GG PPPPPP F P Sbjct: 540 AAPPPPPGPPPAMSGGPPPPPPPPGDFGVTP 570 Score = 39.1 bits (87), Expect = 0.13 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP---PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP F PPPP P PPPPP G PPPPP Sbjct: 530 PPGAAPSFGSAAPPPPPGPPPAMSGGPPPPPPPPGDFGVTPGPPPPP 576 Score = 37.5 bits (83), Expect = 0.40 Identities = 29/100 (29%), Positives = 32/100 (32%), Gaps = 8/100 (8%) Frame = +2 Query: 197 PPPQIPFWGXKKKC----PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX-PP 361 PPP +P G PP G + PPP + PPP PP Sbjct: 413 PPPSLPARGGTPAAGGPPPPPPPRDGATPLSRPPPPP-----SRSAIPPPAAAPTAYTPP 467 Query: 362 PPPXXXXXGGGXX---PPPPPPXXFFFXPXXXXXGGGXXP 472 PPP PPPPPP P GG P Sbjct: 468 PPPAAASPAAAQSSYTPPPPPPPPASSRPVPGVPGGVPPP 507 Score = 34.3 bits (75), Expect = 3.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGG----GXXPPPPPP 418 PPP P PPP GG G PPPPPP Sbjct: 401 PPPELPGRAVPAPPPSLPARGGTPAAGGPPPPPPP 435 >UniRef50_Q8T4F7 Cluster: Protein enabled; n=7; Eumetazoa|Rep: Protein enabled - Drosophila melanogaster (Fruit fly) Length = 829 Score = 47.2 bits (107), Expect = 5e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 GG P P P PPPPP GG PPP PP F P GGG P Sbjct: 547 GGPPAPAP-----PPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPP 593 Score = 44.8 bits (101), Expect = 0.003 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPP-PPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPP GG PPP PP PPPP GGG P PP P P G G Sbjct: 557 PPPSFGGAAGGGPPPPAPPQMFNGAPPPP---AMGGGPPPAPPAPPAMGGGPPPAPGGPG 613 Query: 464 XXP 472 P Sbjct: 614 APP 616 Score = 41.5 bits (93), Expect = 0.024 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP F G PP F PPP PP PP PPP P Sbjct: 555 PPPPPSFGGAAGGGPPPPAPPQMF---NGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGG 611 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 612 P---GAPPPPPPPP 622 Score = 35.1 bits (77), Expect = 2.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 GG PPP P PPPPP GG P Sbjct: 602 GGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 633 >UniRef50_UPI00006A1088 Cluster: WAS/WASL interacting protein family member 2 (WIP-related protein) (WASP-interacting protein-related protein) (WIP- and CR16-homologous protein).; n=10; Tetrapoda|Rep: WAS/WASL interacting protein family member 2 (WIP-related protein) (WASP-interacting protein-related protein) (WIP- and CR16-homologous protein). - Xenopus tropicalis Length = 373 Score = 46.8 bits (106), Expect = 6e-04 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPP PPPPP GG PPPPPP Sbjct: 287 PPPQSANLSPGGNRPPPPARDPPGRGAAPPPPPPIVRNGGRDAPPPPPP 335 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 46.8 bits (106), Expect = 6e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP--PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPPP P PPPPP GGG P PPPP Sbjct: 169 PPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPPPSGGGAPPAPPPP 214 Score = 37.9 bits (84), Expect = 0.30 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +2 Query: 314 KGGXPP-----PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 + PP PPP PPPPP G PPPPPP Sbjct: 162 RASAPPPPPSAPPPAPASGPPPPPGPPPAPGPPPPPPPPP 201 Score = 37.1 bits (82), Expect = 0.52 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPP PPPPP P PPP PPPPPP P GG Sbjct: 168 PPPSAPPPAPASGPPPPPGPPPAPGPPPP---------PPPPPPSGGGAPPAPPPPSGG 217 Score = 34.7 bits (76), Expect = 2.8 Identities = 26/77 (33%), Positives = 26/77 (33%) Frame = -1 Query: 555 PPPPKXXKKKKXXXXXPTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXX 376 PPPP P P G PPP GGG PPP Sbjct: 167 PPPPSAPPPAPASGPPPPPGPP---PAPGPPPPPPPPPPS------GGGAPPAPPPPSGG 217 Query: 375 XXGGGGGXXFXXGGGGG 325 GGGGG GGGGG Sbjct: 218 GGGGGGG-----GGGGG 229 Score = 34.7 bits (76), Expect = 2.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -1 Query: 462 PPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 PPP GGG PP GGGGG GG GG Sbjct: 187 PPPAPGPPPPPPPPPPSGGGAPPAPPPPSGGGGGGGGGGGGGGDGG 232 >UniRef50_O23691 Cluster: Putative uncharacterized protein T19D16.24; n=2; Arabidopsis thaliana|Rep: Putative uncharacterized protein T19D16.24 - Arabidopsis thaliana (Mouse-ear cress) Length = 554 Score = 46.8 bits (106), Expect = 6e-04 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKG-GXPP-PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP KG PP PPP PPPPP G G PPPPP Sbjct: 235 PPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPP 280 Score = 35.1 bits (77), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP G PP PP Sbjct: 224 PPPPGRAALPPPPPLPMAVRKGVAAPPLPP 253 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 46.8 bits (106), Expect = 6e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPPP G PP PPP Sbjct: 127 PPPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPP 170 Score = 46.8 bits (106), Expect = 6e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPPP G P PPPP Sbjct: 128 PPPVLPGPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPP 171 Score = 40.7 bits (91), Expect = 0.042 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPP PPPP G PPP PP Sbjct: 150 PPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGPPVPPPHPP 193 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPP P Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHP 173 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPP PP Sbjct: 144 PPPPPPPPPPPPPPPMAGPPPPPGPPPPHPP 174 Score = 37.9 bits (84), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP G PP PPP Sbjct: 145 PPPPPPPPPPPPPPMAGPPPPPGPPPPHPPP 175 Score = 37.5 bits (83), Expect = 0.40 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPPXXG 719 P PPPPPP P P P PP G PP G Sbjct: 143 PPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAG 184 Score = 34.7 bits (76), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP G P PPPP Sbjct: 146 PPPPPPPPPPPPPMAGPPPPPGPPPPHPPPP 176 Score = 33.9 bits (74), Expect = 4.9 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPP---PPP 418 PPP G P PPP P PP G PPP PPP Sbjct: 173 PPPPAGPPPVAGPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPP 219 Score = 33.5 bits (73), Expect = 6.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P GPPPPPP P P P PPG PP Sbjct: 136 PVGPPPPPP---PPPPPPPPPPPPPPMAGPPPPPGPPPP 171 Score = 33.5 bits (73), Expect = 6.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPP--PP 418 PPPPP P PPP PPPP PP Sbjct: 199 PPPPPAPQGPPAPPPVEGPPPPKGPPPPPHSPP 231 Score = 33.5 bits (73), Expect = 6.4 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPP P PPP PPP PP Sbjct: 211 PPPVEGPPPPKGPPPPP---HSPPGPPPAEGPPPPAKVPPPAPP 251 Score = 33.1 bits (72), Expect = 8.5 Identities = 25/78 (32%), Positives = 26/78 (33%), Gaps = 5/78 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPP--PPXXXXXP---P 361 PPP +P G PP PPP G PPP PP P P Sbjct: 128 PPPVLP--GPPVGPPPPPPPPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPPVAGP 185 Query: 362 PPPXXXXXGGGXXPPPPP 415 P P PPPPP Sbjct: 186 PVPPPHPPPAEPAPPPPP 203 >UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG01070.1 - Gibberella zeae PH-1 Length = 217 Score = 46.4 bits (105), Expect = 9e-04 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + PPPPP PPPPP PPPPPP Sbjct: 40 PPPPPPVIYRPPLPPPPPPQFYPPPPPPPVIEVPCSPPPPPPPP 83 Score = 35.9 bits (79), Expect = 1.2 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPP PPPPP PPPPPP + Sbjct: 32 PPPPREPSPPPPPPVIYRP---PLPPPPPPQFY 61 >UniRef50_Q9DEH3 Cluster: Diaphanous homologue; n=13; Eumetazoa|Rep: Diaphanous homologue - Gallus gallus (Chicken) Length = 1253 Score = 46.4 bits (105), Expect = 9e-04 Identities = 29/78 (37%), Positives = 30/78 (38%), Gaps = 2/78 (2%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P PP G PPP G PPPPP PPPP Sbjct: 687 IPPPPLLP---GGTVIPPPPPLPGGAAAVLPPPPPLPG----GTIPPPPPLFGGAVPPPP 739 Query: 371 XXXXXGGGXXPPPP--PP 418 G G PPPP PP Sbjct: 740 PLPGGGAGPPPPPPGGPP 757 Score = 44.4 bits (100), Expect = 0.003 Identities = 36/100 (36%), Positives = 37/100 (37%), Gaps = 6/100 (6%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGX--PPPPPXXXXX--- 355 I PPP +P G PP G PPP GG PPPPP Sbjct: 661 IPPPPPLP--GGAAVIPPPPPLPGGAAV---IPPP---PLLPGGTVIPPPPPLPGGAAAV 712 Query: 356 -PPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPPP GG PPPPP P GGG P Sbjct: 713 LPPPPPLP----GGTIPPPPPLFGGAVPPPPPLPGGGAGP 748 Score = 38.7 bits (86), Expect = 0.17 Identities = 27/76 (35%), Positives = 27/76 (35%), Gaps = 3/76 (3%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX---PPPPP 370 PP P G PP G PPP PPPPP PPPPP Sbjct: 610 PPAPPLPGGAAVIPPPPPLPGGAAV---IPPPPPLPGGAAVIPPPPPLPGGAAVIPPPPP 666 Query: 371 XXXXXGGGXXPPPPPP 418 GG PPPPP Sbjct: 667 L---PGGAAVIPPPPP 679 Score = 37.9 bits (84), Expect = 0.30 Identities = 30/92 (32%), Positives = 31/92 (33%), Gaps = 2/92 (2%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP PPP P PPPP Sbjct: 622 IPPPPPLP--GGAAVIPPPPPLPGGAAV-IPPPPPLPGGAAVIPPPPPLPGGAAVIPPPP 678 Query: 371 XXXXXGGGXXPPPPP--PXXFFFXPXXXXXGG 460 GG PPPP P P GG Sbjct: 679 --PLPGGAAVIPPPPLLPGGTVIPPPPPLPGG 708 Score = 35.9 bits (79), Expect = 1.2 Identities = 27/87 (31%), Positives = 29/87 (33%) Frame = +2 Query: 158 SPXFXXXXLKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP 337 SP + + PPP P G PP G PP PP P Sbjct: 560 SPPALSSGVVPLPPPPPPPLPGGAA-IPPAPPLPGGAAI--PPAPPLPGGTVVPPAPPLP 616 Query: 338 PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP GG PPPPP Sbjct: 617 GGAAVIPPPPPL---PGGAAVIPPPPP 640 Score = 34.7 bits (76), Expect = 2.8 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +2 Query: 317 GGXPPPPPXXXXX----PPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PP PP PPPPP G P PP P P GG P Sbjct: 555 GTVPPSPPALSSGVVPLPPPPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVP 610 Score = 33.9 bits (74), Expect = 4.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP-PXXFFFXPXXXXXGG 460 PPPPP PP GG PP PP P P GG Sbjct: 573 PPPPPPLPGGAAIPPAPPLPGGAAIPPAPPLPGGTVVPPAPPLPGG 618 >UniRef50_Q6MWG9 Cluster: B1160F02.7 protein; n=3; Oryza sativa|Rep: B1160F02.7 protein - Oryza sativa subsp. japonica (Rice) Length = 906 Score = 46.4 bits (105), Expect = 9e-04 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 2/64 (3%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP--PXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGG 460 PP G PPPP P PPP P G G PPPPPP P G Sbjct: 309 PPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGP 368 Query: 461 GXXP 472 G P Sbjct: 369 GPPP 372 Score = 37.9 bits (84), Expect = 0.30 Identities = 27/86 (31%), Positives = 28/86 (32%), Gaps = 3/86 (3%) Frame = -1 Query: 555 PPPPKXXKKKKXXXXXPTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXX 376 PPPP P+P G PPP G G G PPP Sbjct: 322 PPPPAHPAAPAPPPPAPSPSAA----GAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAA 377 Query: 375 XXGGGGGXXFXXGGG---GGXPPXKK 307 GGGG GG G PP KK Sbjct: 378 GRGGGGPPPPALPGGPRARGPPPFKK 403 Score = 37.9 bits (84), Expect = 0.30 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PP PPPPP GGG PPP P Sbjct: 361 PRPPGPGPGPPPPPGAAGRGGGGPPPPALP 390 >UniRef50_Q22715 Cluster: Putative uncharacterized protein; n=3; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 866 Score = 46.4 bits (105), Expect = 9e-04 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPPP PPPPP G PPPPPP Sbjct: 84 PPP--PPMFAGGIPPPPPMMGGIPPPPPMF-----GAPPPPPPP 120 Score = 40.7 bits (91), Expect = 0.042 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPPP PPPPP G G P PP P Sbjct: 97 PPPMM-----GGIPPPPPMFGAPPPPPP---PSGLGVAPQPPRP 132 Score = 39.5 bits (88), Expect = 0.098 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +2 Query: 287 PPPFXXXFXK-----GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP F GG PPPPP PPPP GG PPPP Sbjct: 66 PPPVPNGFIPPPPGPGGIPPPPPMFAGGIPPPPPMM---GGIPPPPP 109 >UniRef50_Q1ZXK2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1074 Score = 46.4 bits (105), Expect = 9e-04 Identities = 24/44 (54%), Positives = 24/44 (54%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPPP PPPPP GGG PPPPPP Sbjct: 576 PPPISG----GGAPPPPPP----PPPPPS----GGGAPPPPPPP 607 Score = 42.7 bits (96), Expect = 0.011 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P GG PPPP PPPPP G PPPPPP Sbjct: 571 PSPSPPPPISGGGAPPPP-----PPPPPPPSGGGAPPPPPPPPP 609 Score = 37.9 bits (84), Expect = 0.30 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 GG PPP P PPPP GG PPPPPP P GGG P Sbjct: 566 GGAPPPSPS-----PPPPI----SGGGAPPPPPP------PPPPPSGGGAPP 602 Score = 35.9 bits (79), Expect = 1.2 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPP PPPPP G PP P Sbjct: 587 PPPPPPPPPSGGGAPPPP-----PPPPPSGGKKAGAPGAPPTGP 625 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 46.4 bits (105), Expect = 9e-04 Identities = 31/95 (32%), Positives = 32/95 (33%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 +I PPP P PP G PPP PPPPP PPP Sbjct: 545 QIAPPPPPP--------PPPPPPGGLLTAPPPPPPP---------PPPPPPGGSLTAPPP 587 Query: 368 PXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 P GG PPPPPP P G P Sbjct: 588 PPPPPPPGGRLPPPPPPPPGGMPPPPPMPGRAPPP 622 Score = 40.7 bits (91), Expect = 0.042 Identities = 25/73 (34%), Positives = 25/73 (34%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP PPP GG PPPPP PPPPP Sbjct: 572 PPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPPP-----PPGGMPPPPPMPGRAPPPPPGA 626 Query: 377 XXXGGGXXPPPPP 415 G P P Sbjct: 627 AKPGKQKCNPTKP 639 Score = 37.9 bits (84), Expect = 0.30 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PP PPPPP GG PPPPP Sbjct: 541 PNPPQIAPPPPPPPPPPPPGGLLTAPPPPP 570 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 46.4 bits (105), Expect = 9e-04 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP G PPPPPP Sbjct: 606 PPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPP 649 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPX--XXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP GG PPPPPP Sbjct: 620 PPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPP 665 Score = 46.0 bits (104), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 PPP K G PPPPP PPPPP G PPPPPP Sbjct: 630 PPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPPPPP 678 Score = 45.2 bits (102), Expect = 0.002 Identities = 28/79 (35%), Positives = 29/79 (36%), Gaps = 5/79 (6%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----- 355 + PPP P PP G PPP GG PPPPP Sbjct: 618 LPPPPPPPKIAAPPPPPPPPMKAGP----PPPPPPPGVPRPPGGPPPPPPPPGSKAGGPP 673 Query: 356 PPPPPXXXXXGGGXXPPPP 412 PPPPP GG PPPP Sbjct: 674 PPPPPGAPQPPGGSAPPPP 692 Score = 39.9 bits (89), Expect = 0.074 Identities = 28/78 (35%), Positives = 28/78 (35%), Gaps = 5/78 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCP-PXXEXXGKFXX*KXXPPPFXXXFXKGGXPPP----PPXXXXXPP 361 PPP P K P P K PPP PPP PP PP Sbjct: 603 PPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPPMKAGPPPPPPPPGVPRPPGGPPPPP 662 Query: 362 PPPXXXXXGGGXXPPPPP 415 PPP GG PPPPP Sbjct: 663 PPP--GSKAGGPPPPPPP 678 Score = 37.1 bits (82), Expect = 0.52 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PP PPPPP PPPP PPPPP Sbjct: 596 PPNAPSLPPPPPPPPPPVKSAPLPPPPPPPKIAAPPPPPPPP 637 Score = 36.3 bits (80), Expect = 0.91 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P GPPPPPP K P P P PPGG P Sbjct: 655 PGGPPPPPPPPGSKAGGPPPPPPP----GAPQPPGGSAP 689 Score = 34.3 bits (75), Expect = 3.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP PPPPPP Sbjct: 596 PPNAPSLPPPPPPPPPPVKSAPLPPPPPP 624 Score = 33.9 bits (74), Expect = 4.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP PPPPPP Sbjct: 596 PPNAPSLPPPPPPPPPPVKSAPLPPPPPPP 625 Score = 33.5 bits (73), Expect = 6.4 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 PPPPPP K P P P PPGG PP Sbjct: 630 PPPPPPPPMK-----AGPPPPPPPPGVPRPPGGPPP 660 >UniRef50_UPI0000F1E7FE Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1331 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPP G G PPPPPP Sbjct: 823 PPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLP-GMGVPPPPPPP 865 Score = 44.8 bits (101), Expect = 0.003 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP PPP PPPP PPPPP Sbjct: 813 PPPPLPCLSVPPPPPPLPGMGAP-------PPPPPLPGLSAPPPPPPLPGMGVPPPPPPP 865 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 866 LTHTGPAPPPPPPP 879 Score = 39.9 bits (89), Expect = 0.074 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPPP PPPP G PPPP P P G G P Sbjct: 812 PPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPP 860 Score = 37.9 bits (84), Expect = 0.30 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP G PPP PPP P PPPPP Sbjct: 752 PPPPPPLPGVCAP-PPPPPLPGVCVP---TPPPLPGVCPPP-PPPPLPGVCAIPPPPPLP 806 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 807 ----GASLPPPPPP 816 >UniRef50_UPI00015A5D5E Cluster: UPI00015A5D5E related cluster; n=2; Danio rerio|Rep: UPI00015A5D5E UniRef100 entry - Danio rerio Length = 1093 Score = 46.0 bits (104), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPP G G PPPPPP Sbjct: 896 PPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLP-GMGVPPPPPPP 938 Score = 44.8 bits (101), Expect = 0.003 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP PPP PPPP PPPPP Sbjct: 886 PPPPLPCLSVPPPPPPLPGMGAP-------PPPPPLPGLSAPPPPPPLPGMGVPPPPPPP 938 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 939 LTHTGPAPPPPPPP 952 Score = 39.9 bits (89), Expect = 0.074 Identities = 19/49 (38%), Positives = 19/49 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPPP PPPP G PPPP P P G G P Sbjct: 885 PPPPPLPCLSVPPPPPPLPGMGAPPPPPPLPGLSAPPPPPPLPGMGVPP 933 Score = 37.9 bits (84), Expect = 0.30 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP G PPP PPP P PPPPP Sbjct: 825 PPPPPPLPGVCAP-PPPPPLPGVCVP---TPPPLPGVCPPP-PPPPLPGVCAIPPPPPLP 879 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 880 ----GASLPPPPPP 889 >UniRef50_Q4SE62 Cluster: Chromosome undetermined SCAF14625, whole genome shotgun sequence; n=7; Euteleostomi|Rep: Chromosome undetermined SCAF14625, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 496 Score = 46.0 bits (104), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 277 PPPPPGRGGAPPPPPPPPARGSRGAPPPPPP 307 Score = 44.4 bits (100), Expect = 0.003 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP-XXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP +G PPPPP PPPP G PPPPPP Sbjct: 290 PPPPPARGSRGAPPPPPPSRAPASAPPPPPPTRPGSLGAPPPPPP 334 Score = 37.9 bits (84), Expect = 0.30 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 PPP +GG PPPPP PPPPP PPPPPP Sbjct: 279 PPP-----GRGGAPPPPPPPPARGSRGAPPPPPPSRAPASA--PPPPPP 320 >UniRef50_A4TTL3 Cluster: Putative uncharacterized protein; n=2; cellular organisms|Rep: Putative uncharacterized protein - Magnetospirillum gryphiswaldense Length = 374 Score = 46.0 bits (104), Expect = 0.001 Identities = 46/133 (34%), Positives = 47/133 (35%), Gaps = 14/133 (10%) Frame = -1 Query: 642 FFFFXXXXGGGGGA------RXXXFFFXKXXXFFXPPPPKXXKK-----KKXXXXXPTPX 496 FFF GGGGA R FFF FF PPPP+ KK P P Sbjct: 32 FFFLGGGREGGGGAPPPPPARRQKFFFFPH--FFFPPPPRRGGGGVFFYKKKRGGPPPPP 89 Query: 495 XXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXX---GGGGGXXFXXGGGGG 325 PPP G GGGGG PP GG F GG G Sbjct: 90 TTQKKKNFFFSPPPPPSFWGX---FFGGGGGFVXXPPRGGAPPPPGGAPPPLFFWGGKRG 146 Query: 324 XPPXKKXXKKGGG 286 KKGGG Sbjct: 147 KKTPPPTHKKGGG 159 Score = 37.5 bits (83), Expect = 0.40 Identities = 32/104 (30%), Positives = 33/104 (31%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPLXXXKKXXXGVGXXXXXFFFF 535 PPPPP G P FFF GGG P + F Sbjct: 8 PPPPPKKKKKKKGRGGGGAHPHLFFFFLGGGREGGGGAPPPPPARRQKFFFFPHFFFPPP 67 Query: 536 XXLGGGGXKXXXXFXKKKXXXRAPPPPPXXXXKKKXXPXPXXXP 667 GGGG F KKK PPPPP KK P P Sbjct: 68 PRRGGGG----VFFYKKKRG--GPPPPPTTQKKKNFFFSPPPPP 105 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 46.0 bits (104), Expect = 0.001 Identities = 25/74 (33%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP PPP PPPPP PPPPP Sbjct: 216 PPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 276 PPPPPPPPPPPPPP 289 Score = 46.0 bits (104), Expect = 0.001 Identities = 25/74 (33%), Positives = 25/74 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPPPP PPPPP Sbjct: 217 PPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 277 PPPPPPPPPPPPPP 290 Score = 45.6 bits (103), Expect = 0.001 Identities = 25/75 (33%), Positives = 27/75 (36%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP +P PP PPP PPPPP PPPPP Sbjct: 235 SPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Query: 374 XXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 295 PPPPPPPPPPPPPPP 309 Score = 44.4 bits (100), Expect = 0.003 Identities = 25/75 (33%), Positives = 26/75 (34%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP PPPPP PPPPP Sbjct: 223 SPPPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Query: 374 XXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 283 PPPPPPPPPPPPPPP 297 Score = 44.0 bits (99), Expect = 0.005 Identities = 25/75 (33%), Positives = 26/75 (34%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP PPPPP PPPPP Sbjct: 228 SPPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Query: 374 XXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 288 PPPPPPPPPPPPPPP 302 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPP 686 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 644 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPP 687 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 645 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 43.6 bits (98), Expect = 0.006 Identities = 25/74 (33%), Positives = 25/74 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPPPP PPPPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 291 PPPPPPPPPPPPPP 304 Score = 43.6 bits (98), Expect = 0.006 Identities = 25/76 (32%), Positives = 26/76 (34%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P PP PPP PPPPP PPPPP Sbjct: 240 LPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Query: 371 XXXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 300 PPPPPPPPPPPPPPPP 315 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 646 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPP 689 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 647 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPP 690 Score = 42.3 bits (95), Expect = 0.014 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PP PPP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPPP 711 Score = 39.9 bits (89), Expect = 0.074 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PP PP PPPPPP Sbjct: 653 PPPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 39.9 bits (89), Expect = 0.074 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PPP PPPPPP Sbjct: 654 PPPPPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 36.7 bits (81), Expect = 0.69 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPP--PPXXXXXGGGXXPPPPPP 418 PPPPP PPP PP PPPPPP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPP 246 Score = 33.9 bits (74), Expect = 4.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPP PP PP PP PPP Sbjct: 206 GYNPPPPSPPPPPPLPPSPPPPSPPPPPPSPPP 238 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 211 PPSPPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPPPPPP 249 >UniRef50_A7SHT8 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1505 Score = 46.0 bits (104), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 GG PPPPP PPPPP G P PPPP Sbjct: 951 GGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 984 Score = 39.5 bits (88), Expect = 0.098 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP P PPPPP GGG PPPPPP Sbjct: 945 PPNPFFGGIPPPPP-----GGGMFPPPPPP 969 Score = 38.3 bits (85), Expect = 0.23 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 F G PPPP PPPPP GG PP PPP Sbjct: 949 FFGGIPPPPPGGGMFPPPPPP--PPGGGVPGPPKPPP 983 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 46.0 bits (104), Expect = 0.001 Identities = 27/77 (35%), Positives = 28/77 (36%), Gaps = 3/77 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP---PPP 367 PPP +P PP PPP G PPPPP PPP Sbjct: 646 PPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPPPSKTGAPPP 705 Query: 368 PXXXXXGGGXXPPPPPP 418 P GG PPPPPP Sbjct: 706 PPPPRIGGA--PPPPPP 720 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP G PPPPPP Sbjct: 643 PPPPPPPLPNTQVPPPPPP----PPPPPPPSKNGAPPPPPPPPP 682 Score = 34.7 bits (76), Expect = 2.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP K P P P PP PP Sbjct: 658 PPPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPPPPPPPP 696 >UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding; n=1; Yarrowia lipolytica|Rep: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding - Yarrowia lipolytica (Candida lipolytica) Length = 1851 Score = 46.0 bits (104), Expect = 0.001 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 5/57 (8%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPP-----PXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 GG PPPPP PPPP P GG PPPPPP F P GG P Sbjct: 1041 GGPPPPPPP----PPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPP 1093 Score = 38.3 bits (85), Expect = 0.23 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = +2 Query: 287 PPPFXXXFXKGGXPP------PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPP F G PP PPP PPPPP G PPPP F Sbjct: 1071 PPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPPPLPPGFTGGPPPPAPAF 1124 Score = 37.1 bits (82), Expect = 0.52 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP GG PP PPPPP GG PPP F P GG Sbjct: 1047 PPPPPPPMFTGGPPPMFTGGPPPPPPPPPPGFTGG------PPPPGFTGGPPPPGFTGGP 1100 Query: 467 XP 472 P Sbjct: 1101 PP 1102 Score = 35.9 bits (79), Expect = 1.2 Identities = 22/59 (37%), Positives = 22/59 (37%), Gaps = 8/59 (13%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP------PXXXXXGGGXXPPPP--PPXXFFFXP 439 PPP PPPPP PPPP P GG PPPP P F P Sbjct: 1059 PPPMFTGGPPPPPPPPPPGFTGGPPPPGFTGGPPPPGFTGGPPPPPPPPPLPPGFTGGP 1117 Score = 34.3 bits (75), Expect = 3.7 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 5/79 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP-----P 361 PPP P G PP G PPP GG PPPPP P P Sbjct: 1069 PPPPPPPPGFTGGPPPPGFTGGP-------PPPGFT----GGPPPPPPPPPLPPGFTGGP 1117 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP G P P P Sbjct: 1118 PPPAPAFVAGATPSPSPSP 1136 >UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 1705 Score = 46.0 bits (104), Expect = 0.001 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX--PPPPPXXXXXG--GGXXPPPPPP 418 PPP F PPPPP PPPPP G GG PPPPPP Sbjct: 984 PPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPP 1031 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +2 Query: 320 GXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPPXXFF 430 G PPPPP PPPPP GG PPPPPP F Sbjct: 979 GPPPPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGF 1020 Score = 40.3 bits (90), Expect = 0.056 Identities = 21/58 (36%), Positives = 23/58 (39%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP +P + PP G PPP F G PPPPP P PPP Sbjct: 984 PPPPLPGFSGPPP-PPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPPP 1040 Score = 39.9 bits (89), Expect = 0.074 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP P G PP F PPP GG PPPPP P PP Sbjct: 982 PPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPP 1039 Score = 38.7 bits (86), Expect = 0.17 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 3/63 (4%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX---PPPPPXXXXXGGGXXPPP 409 PP F PPP F G PPPPP PPPP G PPP Sbjct: 982 PPPPPPLPGFSGPPPPPPPPLPGFSGGPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPPPP 1041 Query: 410 PPP 418 P Sbjct: 1042 GAP 1044 Score = 33.1 bits (72), Expect = 8.5 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 600 GPPPPPPXXXKKKKXXXXPXXPXXXKXXP-XPPGGGPPXXG 719 GPPPPPP P P P PP G PP G Sbjct: 1008 GPPPPPPPPLPGFSGGAPPPPPPPMPGAPIPPPPGAPPLPG 1048 >UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pombe|Rep: Formin-3 - Schizosaccharomyces pombe (Fission yeast) Length = 1461 Score = 46.0 bits (104), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPPPP G G PPPPPP Sbjct: 752 PPPAPIMGGPPPPPPPPGVAGAGPPPPPPPP 782 Score = 34.3 bits (75), Expect = 3.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +2 Query: 314 KGGXPPPP----PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 K PPPP P P P P GG PPPPPP Sbjct: 730 KSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPP 768 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 46.0 bits (104), Expect = 0.001 Identities = 26/74 (35%), Positives = 29/74 (39%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P ++ PP PPP G PPPPP PPPPP Sbjct: 544 PPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPL--PGDLPPPPPP----PPPPPGT 597 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 598 DGPVPPPPPPPPPP 611 Score = 33.9 bits (74), Expect = 4.9 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPQ P + PP G PPP G PPPPP PPPPP Sbjct: 562 PPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPP--PPGTDGPVPPPPPP----PPPPP 612 >UniRef50_Q03173 Cluster: Protein enabled homolog; n=18; Euteleostomi|Rep: Protein enabled homolog - Mus musculus (Mouse) Length = 802 Score = 46.0 bits (104), Expect = 0.001 Identities = 27/75 (36%), Positives = 28/75 (37%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +P PQ G PP G PPP G PPPPP PPPPP Sbjct: 532 SPTPQGLVLGPPAPPPPPPLPSGPAYASALPPPP--------GPPPPPPLPSTGPPPPPP 583 Query: 374 XXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 584 PPPPLPNQAPPPPPP 598 >UniRef50_UPI00015B5CAE Cluster: PREDICTED: similar to conserved hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to conserved hypothetical protein - Nasonia vitripennis Length = 1774 Score = 45.6 bits (103), Expect = 0.001 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 G PPPPP PPPPP G PPPPPP F P Sbjct: 276 GPVPPPPPPALILPPPPPPPLLISG---PPPPPPNAFMDPP 313 Score = 37.9 bits (84), Expect = 0.30 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPP-PPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPP PP P P PP Sbjct: 289 PPPPPPPLLISGPPPPPPNAFMDPPPLPPPLQAPIAARVPTPEPP 333 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 45.6 bits (103), Expect = 0.001 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 284 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 230 PPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 245 PPPSPPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 288 Score = 43.6 bits (98), Expect = 0.006 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP PPPPP PPPPP PPPPPP + Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVY 304 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 228 PPPPPSPPPSPPPPPPPPPPSPPPSPPPPPP 258 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPP P PPPPPP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 36.7 bits (81), Expect = 0.69 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP P PPPPP PPPPPP Sbjct: 218 PPSPLPPSPPPPPPPSPPPSPPPPPPPPPP 247 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 223 PPSPPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPPPPP 261 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 >UniRef50_Q9VC23 Cluster: CG7016-PA; n=2; Sophophora|Rep: CG7016-PA - Drosophila melanogaster (Fruit fly) Length = 362 Score = 45.6 bits (103), Expect = 0.001 Identities = 21/44 (47%), Positives = 22/44 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + GG PPP P PPPP GGG PPPP P Sbjct: 176 PPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGG--PPPPRP 217 Score = 44.8 bits (101), Expect = 0.003 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP F GG PPP P PPPP GGG PPPP P Sbjct: 165 PPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGG--PPPPRP 205 Score = 38.3 bits (85), Expect = 0.23 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = -1 Query: 474 RGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKK 295 RG P P G G GGG PPP GGG G GG PP + Sbjct: 163 RGPPPRPGFNGGGPPPPRPGWNGGG--PPPPMPGWNGGGPPPPRPGWNGGGPPPPRPGWN 220 Query: 294 GG 289 GG Sbjct: 221 GG 222 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPP P PPPP GGG PPPP P Sbjct: 162 GRGPPPRPGFNGGGPPPPRPGWNGGG--PPPPMP 193 Score = 35.9 bits (79), Expect = 1.2 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -1 Query: 411 GGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGG 289 GGGG PPP GGG GGG PP GG Sbjct: 159 GGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGG 199 Score = 35.1 bits (77), Expect = 2.1 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGG 391 PPP + GG PPP P PPPP GG Sbjct: 188 PPPPMPGWNGGGPPPPRPGWNGGGPPPPRPGWNGG 222 Score = 33.9 bits (74), Expect = 4.9 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G GGG PP GGG G GG PP GGG Sbjct: 156 GWNGGGGRGPPPRPGFNGGGPPPPRPGWNGGGPPPPMPGWNGGG 199 Score = 33.9 bits (74), Expect = 4.9 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G GGG PPP GGG G GG PP + GGG Sbjct: 170 GFNGGG--PPPPRPGWNGGGPPPPMPGWNGGGPPPPRPGWNGGG 211 >UniRef50_A7S5P1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1254 Score = 45.6 bits (103), Expect = 0.001 Identities = 25/76 (32%), Positives = 28/76 (36%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I P PQ F ++ PP + PP PPPPP PPPPP Sbjct: 473 IDPAPQSIFAVSRQSAPPPKPVA------RASAPPAPPLPGGSAPPPPPPPGGSVPPPPP 526 Query: 371 XXXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 527 LPGGTCSSGPPPPPPP 542 Score = 36.3 bits (80), Expect = 0.91 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGG 460 PPP P PP P GG PPPPPP P GG Sbjct: 489 PPPKPVARASAPPAPPLP---GGSAPPPPPPPGGSVPPPPPLPGG 530 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 45.6 bits (103), Expect = 0.001 Identities = 24/62 (38%), Positives = 25/62 (40%), Gaps = 2/62 (3%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPX--XXXXPPPPPXXXXXGGGXXPPPP 412 PP K + PP KGG PPPPP PPPPP PPPP Sbjct: 254 PPPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPPPPPPPPPPPPPKGVPPPPRGPPPP 313 Query: 413 PP 418 PP Sbjct: 314 PP 315 Score = 37.5 bits (83), Expect = 0.40 Identities = 25/74 (33%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP ++ PP K PPP PPPPP PPPPP Sbjct: 257 PPPPSKQQQQQQVVPPPPAPSAKGGAPPPPPPP----------PPPPPP----PPPPPKG 302 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 303 VPPPPRGPPPPPPP 316 >UniRef50_A6RGJ8 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 757 Score = 45.6 bits (103), Expect = 0.001 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGGG PP GGGGG GGGGG PP GGG Sbjct: 386 GGGGGGGGPP-----GGGGGGGGGPPGGGGGGPPGSGGGGGGGG 424 Score = 44.8 bits (101), Expect = 0.003 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 6/84 (7%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPP------PXXXXXGGGGGXXFXXGGGGGXPPXK 310 G PP G GGGGGG PP GGGGG GGGGG PP Sbjct: 338 GRVPPASGGGGGGPPGRGGGGGGGGGPPEGGGGSDGAPGRGGGGGGPPGGGGGGGGPPG- 396 Query: 309 KXXKKGGGXXF*XXNFPKXSXXGG 238 GGG P S GG Sbjct: 397 GGGGGGGGPPGGGGGGPPGSGGGG 420 Score = 41.9 bits (94), Expect = 0.018 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 6/68 (8%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXP------PPXXXXXGGGGGXXFXXGGGGGXPPXK 310 G PP G GGGGGG P PP GGGGG GGG P + Sbjct: 380 GGGGPPGGGGGGGGPPGGGGGGGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGR 439 Query: 309 KXXKKGGG 286 GGG Sbjct: 440 GGGGGGGG 447 Score = 41.1 bits (92), Expect = 0.032 Identities = 24/60 (40%), Positives = 24/60 (40%), Gaps = 8/60 (13%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPP--------PXXXXXGGGGGXXFXXGGGGGXPP 316 G PP G GGGGGG P P GGGGG GGGGG PP Sbjct: 401 GGGGPPGGGGGGPPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGGGGPPGGGGGGGGPP 460 Score = 37.9 bits (84), Expect = 0.30 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXP 319 G PP GGGGGG PP GGGGG GGGG P Sbjct: 423 GGGPPEGGGGSDGAPGRGGGGGGGGGPP------GGGGGGGGPPGGGGDPP 467 Score = 37.1 bits (82), Expect = 0.52 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKG 292 G PP G GGGGG PP GGGGG GG G P G Sbjct: 390 GGGGPPGGGGGGGGGPPGGGGGG---PPGSGGGGGGGGGPPEGGGGSDGAPGRGGGGGGG 446 Query: 291 GG 286 GG Sbjct: 447 GG 448 Score = 34.3 bits (75), Expect = 3.7 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = -1 Query: 456 PXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 P G GGGGGG PP GG G GGGGG GGG Sbjct: 405 PPGGGGGGPPGSGGGGGGGGGPPEGG---GGSDGAPGRGGGGGGGGGPPGGGGGGGG 458 >UniRef50_Q7XMC9 Cluster: OSJNBb0018A10.6 protein; n=11; Oryza sativa|Rep: OSJNBb0018A10.6 protein - Oryza sativa (Rice) Length = 909 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP P PPP PPPPPP Sbjct: 456 PPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPPP 499 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PP PP PPPPPP Sbjct: 455 PPPPPPVPSPSGPPPPPPPPAPSPPAPPPPPPAPSPPAPPPPPP 498 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP PPPP G PPPPPP Sbjct: 444 PPSPPAPSPPAPPPPPPVPSPSGPPPPPPPP 474 >UniRef50_Q9VY31 Cluster: CG9411-PA; n=2; Sophophora|Rep: CG9411-PA - Drosophila melanogaster (Fruit fly) Length = 993 Score = 45.2 bits (102), Expect = 0.002 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP PPPPP G PPPPPP + P G P Sbjct: 434 GPPPPPPSGNYGPPPPP----PSGNYGPPPPPPSGNYGPPPPPSGNYGPPP 480 Score = 42.3 bits (95), Expect = 0.014 Identities = 24/67 (35%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG-----GGXXPPPPPPXXFFFXPXXXX 451 PPP + G PPPPP PPPPP G G PPPPP + P Sbjct: 437 PPPPSGNY---GPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPS 493 Query: 452 XGGGXXP 472 G P Sbjct: 494 GNYGPPP 500 Score = 39.5 bits (88), Expect = 0.098 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G PPPP PPPPP G PPPPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPP-----SGNYGPPPPP 472 Score = 37.5 bits (83), Expect = 0.40 Identities = 25/73 (34%), Positives = 29/73 (39%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P +++ P + F K PP PPPPP PPPPP Sbjct: 612 PPPSAPQLSLQQQLPAP-QPGPAFVHQKQFGPP---------GPPPPPEPQYLPPPPPLA 661 Query: 377 XXXGGGXXPPPPP 415 G PPPPP Sbjct: 662 NVRPLG--PPPPP 672 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 226 PPPQVQVVPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 42.3 bits (95), Expect = 0.014 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPP 280 Score = 42.3 bits (95), Expect = 0.014 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPP 281 Score = 39.1 bits (87), Expect = 0.13 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP P PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 36.7 bits (81), Expect = 0.69 Identities = 24/75 (32%), Positives = 26/75 (34%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPPQ+ PP PPP PPPPP PPPPP Sbjct: 224 VVPPPQVQVVPPPPPPPPPPPPPPP----PPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Query: 371 XXXXXGGGXXPPPPP 415 PPPPP Sbjct: 280 P-------PLPPPPP 287 Score = 34.7 bits (76), Expect = 2.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPP--PPPPPPPLPPPPPPPPPLPPPPP 287 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 41.9 bits (94), Expect = 0.018 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPPP PPPPP Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP PPPPPP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPP 260 Score = 41.5 bits (93), Expect = 0.024 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPPPP PPPPP PP PPP F P Sbjct: 241 PPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFVP 291 Score = 41.1 bits (92), Expect = 0.032 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPP P Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSP 262 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP P PPP PPPPPP Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 235 Score = 37.1 bits (82), Expect = 0.52 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPP-PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP PPP PPP P PPPPPP Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269 Score = 34.3 bits (75), Expect = 3.7 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 326 PPPPPXXXXXPPP-PPXXXXXGGGXXPPPPPP 418 P PPP PPP PP PPPPPP Sbjct: 203 PQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 234 Score = 33.9 bits (74), Expect = 4.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPP 265 >UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassified, expressed; n=5; Oryza sativa|Rep: Transposon protein, putative, unclassified, expressed - Oryza sativa subsp. japonica (Rice) Length = 892 Score = 44.8 bits (101), Expect = 0.003 Identities = 24/76 (31%), Positives = 26/76 (34%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PP P ++ P G K P PPPPP PPPPP Sbjct: 304 IAAPPAPPPARSRRTPPRTRFSTGSTPDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPP 363 Query: 371 XXXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 364 PPKLNTAPKPPPPPPP 379 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 >UniRef50_Q0DSG8 Cluster: Os03g0308700 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os03g0308700 protein - Oryza sativa subsp. japonica (Rice) Length = 464 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP G PPPPP Sbjct: 282 PPPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTLAPPPPP 325 Score = 41.1 bits (92), Expect = 0.032 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPP PPPPPP ++ P Sbjct: 280 PPPPPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQP 317 Score = 37.9 bits (84), Expect = 0.30 Identities = 25/87 (28%), Positives = 27/87 (31%), Gaps = 4/87 (4%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----P 358 + PPP P + PP PPP PPPPP P Sbjct: 263 LPPPPSTPPRWTRSPTPPPPPPSPPHATPPPPPPPPPREMVAPPPPPPPPYYGQPTLAPP 322 Query: 359 PPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP P PP P F P Sbjct: 323 PPPPPPYCGHPTLAPLPPRPLHFGASP 349 Score = 33.9 bits (74), Expect = 4.9 Identities = 25/83 (30%), Positives = 26/83 (31%), Gaps = 2/83 (2%) Frame = +2 Query: 197 PPPQIPFWGXKK--KCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 P Q PFW C P F PPP G PP PPPP Sbjct: 383 PAGQRPFWSPPTVPPCYPAPFWGAPFWG-AQPPPPRPSPLPHWGHIRSPPAPALHQPPPP 441 Query: 371 XXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP F+ P Sbjct: 442 TLQLQ--QQQSPPPPPGVFWGRP 462 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 >UniRef50_Q5BXW2 Cluster: SJCHGC01957 protein; n=3; Eukaryota|Rep: SJCHGC01957 protein - Schistosoma japonicum (Blood fluke) Length = 180 Score = 44.8 bits (101), Expect = 0.003 Identities = 42/133 (31%), Positives = 43/133 (32%), Gaps = 10/133 (7%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP--------PXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPX 442 PP F KGG PPP P P P GGG PP PP F Sbjct: 49 PPFFAPPKKKGGGPPPGKNLAQRGGPKKFFLKNPFPVFQGEGGGKTPPRGPPFPFKGGKT 108 Query: 443 XXXXG--GGXXPLXXXKKXXXGVGXXXXXFFFFXXLGGGGXKXXXXFXKKKXXXRAPPPP 616 GG + KK FFF GGG K F KK PPPP Sbjct: 109 RGRVPQRGGKGGIPLKKKRLN-----PPPFFFPFRTRGGGKKILPLFLKKGPFF-PPPPP 162 Query: 617 PXXXXKKKXXPXP 655 P K P P Sbjct: 163 PFKNPPPKGGPPP 175 Score = 33.1 bits (72), Expect = 8.5 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -1 Query: 369 GGGGGXXFXXGG---GGGXPPXKKXXKKGGGXXF*XXN-FPKXSXXGG 238 GGGGG F GGG PP K ++GG F N FP GG Sbjct: 44 GGGGGPPFFAPPKKKGGGPPPGKNLAQRGGPKKFFLKNPFPVFQGEGG 91 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 44.8 bits (101), Expect = 0.003 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 GG PPPPP PPPPP GG PPP PP Sbjct: 676 GGVPPPPPPPGGVPPPPPPP----GGVPPPPAPP 705 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP GG PPPPPP Sbjct: 666 GLVPPPPPPPGGVPPPPPPP----GGVPPPPPPP 695 Score = 35.5 bits (78), Expect = 1.6 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPP--PPXXXXXGGGXXPP--PPPP 418 GG PPPPP PPP PP G PP P PP Sbjct: 686 GGVPPPPPPPGGVPPPPAPPGVPAPPGVPAPPGAPAPP 723 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G P P PPPPP GG PPPPPP Sbjct: 659 GGAPAAPGLVPPPPPPP------GGVPPPPPPP 685 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 44.8 bits (101), Expect = 0.003 Identities = 27/85 (31%), Positives = 29/85 (34%), Gaps = 7/85 (8%) Frame = +2 Query: 185 KKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX--- 355 +K PPP P PP + PP PPPPP Sbjct: 590 QKAAPPPPPP----PPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPPPPPPPPPGGK 645 Query: 356 ----PPPPPXXXXXGGGXXPPPPPP 418 PPPPP GG PPPPPP Sbjct: 646 TGAPPPPPPPPGAKAGGPPPPPPPP 670 Score = 44.0 bits (99), Expect = 0.005 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP PPPPP PPPPP G PPPPP P GG Sbjct: 619 PPPSVPKSTNNSAPPPPP-----PPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGGK 673 Query: 467 XP 472 P Sbjct: 674 AP 675 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP G PPPPP PP GG PP P Sbjct: 637 PPPPPPGGKTGAPPPPPPPPGAKAGGPPPPPPPPGGKAPPLP 678 >UniRef50_A6R7X5 Cluster: Putative uncharacterized protein; n=1; Ajellomyces capsulatus NAm1|Rep: Putative uncharacterized protein - Ajellomyces capsulatus NAm1 Length = 1481 Score = 44.8 bits (101), Expect = 0.003 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-PPPPPXXXXXGG--GXXPPPPPP 418 P PF PPPPP PPPPP GG G PPPPPP Sbjct: 1385 PAPFADAPPTAPPPPPPPAFSAAAPPPPPPPPPVGGAPGGPPPPPPP 1431 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPPP PPP P PPPPPP F Sbjct: 1376 PPPPP-----PPPVPAPFADAPPTAPPPPPPPAF 1404 >UniRef50_Q8N8S7 Cluster: Protein enabled homolog; n=9; Tetrapoda|Rep: Protein enabled homolog - Homo sapiens (Human) Length = 591 Score = 44.8 bits (101), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP PPPPPP Sbjct: 335 GPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPP 367 Score = 34.7 bits (76), Expect = 2.8 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + PPP PPPPP G PPPPPP Sbjct: 316 PPPLPPGPAQASVALPPPPGP--PPPPP---LPSTGPPPPPPPP 354 >UniRef50_UPI0000E46C2C Cluster: PREDICTED: similar to transcription elongation regulator 1; n=4; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to transcription elongation regulator 1 - Strongylocentrotus purpuratus Length = 1099 Score = 44.4 bits (100), Expect = 0.003 Identities = 31/89 (34%), Positives = 38/89 (42%), Gaps = 8/89 (8%) Frame = +2 Query: 197 PPPQI--PFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPP----PPXXXXXP 358 PP Q+ P+ G + + PP + +F PPPF + G PP PP P Sbjct: 50 PPDQMRGPYGGHRPRGPPPRDFRNRFGG----PPPFDPRY---GPPPRNRFGPPPRNMPP 102 Query: 359 PPPPXXXXXGGGXXPPP--PPPXXFFFXP 439 PP GGG PPP PPP F P Sbjct: 103 MPPNMQPPMGGGMMPPPGMPPPGMPPFFP 131 >UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein cappuccino; n=1; Tribolium castaneum|Rep: PREDICTED: similar to Protein cappuccino - Tribolium castaneum Length = 1011 Score = 44.4 bits (100), Expect = 0.003 Identities = 34/99 (34%), Positives = 34/99 (34%), Gaps = 6/99 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP G PPP G PPPP PPPPP Sbjct: 460 PPPPPPMPGIGAPPPPPMPGIGA-----PPPPPMPGI---GAHPPPPMPGIVGPPPPPM- 510 Query: 377 XXXGGGXXP------PPPPPXXFFFXPXXXXXGGGXXPL 475 GG P PPPPP P GG PL Sbjct: 511 PGIGGPPPPPMPGTGPPPPPPPMGGVPPPPPPMGGPVPL 549 Score = 42.7 bits (96), Expect = 0.011 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP G PPPPP PPPP G G PPPP P P GG Sbjct: 459 PPPPPPPMPGIGAPPPPPMPGIGAPPPP--PMPGIGAHPPPPMPGIVGPPPPPMPGIGGP 516 Query: 467 XP 472 P Sbjct: 517 PP 518 Score = 39.5 bits (88), Expect = 0.098 Identities = 28/74 (37%), Positives = 29/74 (39%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P G PP G PPP G PPPPP PPPP Sbjct: 495 PPPPMP--GIVGPPPPPMPGIGG-----PPPPPMP-----GTGPPPPPPPMGGVPPPPPP 542 Query: 377 XXXGGGXXPPPPPP 418 GG P PPPP Sbjct: 543 M---GGPVPLPPPP 553 >UniRef50_UPI00006A2591 Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=1; Xenopus tropicalis|Rep: Wiskott-Aldrich syndrome protein (WASp). - Xenopus tropicalis Length = 451 Score = 44.4 bits (100), Expect = 0.003 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PP PP GG PPPPPP Sbjct: 336 PPPPPPSRSTPPIPPPTARSGGPPPPPPPPP 366 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP GG PPPPP P PPP G PPPPPP Sbjct: 349 PPPTAR---SGGPPPPPPPPPSIPAPPPT-----SGPAPPPPPP 384 Score = 41.9 bits (94), Expect = 0.018 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP +G PPPP PP P GG PPPPPP Sbjct: 327 PPPV-----RGSSAPPPPPPSRSTPPIPPPTARSGGPPPPPPPP 365 >UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF16309, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 283 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPP GG PPPPP Sbjct: 151 PPPTGVLDQSSTAPPPPPATGIGFPPPPPPPVPGGVSVPPPPP 193 Score = 39.5 bits (88), Expect = 0.098 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX---PPPPPXXXXXGG---GXXPPPPPP 418 PPP G PPPPP PPPPP G PPPPPP Sbjct: 224 PPPLPISPSNGISPPPPPPPMTGSGFPPPPPLNHSGSTGRLGRLPPPPPP 273 Score = 35.9 bits (79), Expect = 1.2 Identities = 28/83 (33%), Positives = 28/83 (33%), Gaps = 8/83 (9%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXX--FXKG---GXPPPPPXXXXX- 355 T PP P G PP G PPP G G P PP Sbjct: 162 TAPPPPPATGIGFPPPPPPPVPGGVSV--PPPPPLAPGGAACSGIDFGLPLPPTMVSPTC 219 Query: 356 --PPPPPXXXXXGGGXXPPPPPP 418 PPPPP G PPPPPP Sbjct: 220 LPPPPPPLPISPSNGISPPPPPP 242 Score = 33.1 bits (72), Expect = 8.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +2 Query: 326 PPPPPXXXXXP----PPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPPPP PPPP G PPPP P P GG Sbjct: 149 PPPPPTGVLDQSSTAPPPPPATGIGFPPPPPPPVPGGVSVPPPPPLAPGG 198 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 44.4 bits (100), Expect = 0.003 Identities = 25/74 (33%), Positives = 25/74 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPPPP PPPPP Sbjct: 394 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP-PPPPSPPPPPPPSPPPPPPPSP 452 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 453 PPPPPPSPPPPPPP 466 Score = 42.3 bits (95), Expect = 0.014 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPP P PPPPP Sbjct: 203 PPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPS 262 Query: 377 XXXGGGXXPPPPPP 418 P PPPP Sbjct: 263 PPPPSPPPPSPPPP 276 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPPPP PPPPPP Sbjct: 251 PPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP PPPPPP Sbjct: 269 PPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 40.7 bits (91), Expect = 0.042 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPPPP PPPPPP Sbjct: 308 PPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 40.7 bits (91), Expect = 0.042 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP PP PPPPP PPPPPP Sbjct: 309 PPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 352 Score = 40.3 bits (90), Expect = 0.056 Identities = 23/75 (30%), Positives = 24/75 (32%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP PPP P PPPPP Sbjct: 254 SPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 313 Query: 374 XXXXGGGXXPPPPPP 418 P PPPP Sbjct: 314 SPPPPSPPPPSPPPP 328 Score = 39.9 bits (89), Expect = 0.074 Identities = 23/75 (30%), Positives = 24/75 (32%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP PPPPP P PPP Sbjct: 417 SPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476 Query: 374 XXXXGGGXXPPPPPP 418 P PPPP Sbjct: 477 SPPPPSPPPPSPPPP 491 Score = 39.5 bits (88), Expect = 0.098 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP PP PP PPPPP Sbjct: 324 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPPPPS 381 Query: 374 XXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 382 PPPPPPPSPPPPPPP 396 Score = 39.1 bits (87), Expect = 0.13 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PPP P PPPP Sbjct: 378 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421 Score = 39.1 bits (87), Expect = 0.13 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PP PP PPPPP Sbjct: 439 PPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP--PSPPPPSPPPPSPPPPPPPSP 496 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 497 PPPPPPSPPPPPPP 510 Score = 39.1 bits (87), Expect = 0.13 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PPP P PPPP Sbjct: 492 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 535 Score = 38.7 bits (86), Expect = 0.17 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPPPP PPPP Sbjct: 342 PPPSPP--PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 399 Query: 377 XXXGGGXXPPPPPP 418 PPPP P Sbjct: 400 PPSPPPPSPPPPSP 413 Score = 38.7 bits (86), Expect = 0.17 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPPPP PPPP Sbjct: 456 PPPSPP--PPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPP 513 Query: 377 XXXGGGXXPPPPPP 418 PPPP P Sbjct: 514 PPSPPPPSPPPPSP 527 Score = 38.3 bits (85), Expect = 0.23 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPP P PPPPPP Sbjct: 500 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPP 543 Score = 37.9 bits (84), Expect = 0.30 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPPP PP PP Sbjct: 259 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPP 318 Query: 377 XXXGGGXXPPPPPP 418 PP PPP Sbjct: 319 SPPPPSPPPPSPPP 332 Score = 36.7 bits (81), Expect = 0.69 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PP PP PPPPP Sbjct: 307 PPPPPPPSPPPPSPPPPSPPPPSPPPPPPP 336 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP PP PPP Sbjct: 527 PPPPSPPPPSPPPPPPPSPPPPSPPPPSPPP 557 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPPPP P PPPP Sbjct: 528 PPPSPPPPSPPPPPPPSPPPPSPPPPSPPPP 558 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPP P PPPP P Sbjct: 303 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSP 346 Score = 35.1 bits (77), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G P PPP P PPP P PPPP Sbjct: 188 GIPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 220 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPP P PPP PP Sbjct: 386 PPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPP 429 Score = 34.3 bits (75), Expect = 3.7 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPPP PPPP Sbjct: 474 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPP-PSPPPPSPPPPSPPPPSP 532 Query: 377 XXXGGGXXPPPPPP 418 PPP PP Sbjct: 533 PPPSPPPPPPPSPP 546 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPP P PPP PPPP P Sbjct: 512 PPPPSPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPSPPPPSP 555 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 253 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 291 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 270 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 308 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 327 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 365 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 371 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 409 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 425 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 463 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 433 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPP 471 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 441 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 479 Score = 33.5 bits (73), Expect = 6.4 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP PPP P PPP P Sbjct: 482 SPPPPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPP---PSPPPPSPPPPSPPPPSPP 538 Query: 374 XXXXGGGXXPPPPPP 418 P PPPP Sbjct: 539 PPPPPSPPPPSPPPP 553 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 485 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPP 523 Score = 33.1 bits (72), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP PP PP PP PPP Sbjct: 194 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 224 Score = 33.1 bits (72), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP P PPP P PPPP Sbjct: 195 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 225 Score = 33.1 bits (72), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP PP PP PP PPP Sbjct: 199 PPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP 229 Score = 33.1 bits (72), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP P PPP P PPPP Sbjct: 200 PSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 230 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 279 PSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPPSPPP 317 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 388 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 426 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 502 PSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 540 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 17 PPPHCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 Score = 39.1 bits (87), Expect = 0.13 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP PPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP PPPPPP Sbjct: 16 PPPPHCPPPPPPPPPPPPPPPPPPPPPPPPP 46 >UniRef50_A5C4F9 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 1064 Score = 44.4 bits (100), Expect = 0.003 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPP PPPPP PPPPP PPPPPP F Sbjct: 751 PPPLXKNLSTRAVPPPPPPPP--PPPPPSHSGKTTSPVPPPPPPAPAF 796 Score = 34.3 bits (75), Expect = 3.7 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP PPPPPP Sbjct: 745 PPPP-----PPPPPLXKNLSTRAVPPPPPP 769 Score = 33.1 bits (72), Expect = 8.5 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 745 PPPPP-----PPPPLXKNLSTRAVPPPPPPP 770 >UniRef50_A5BPY4 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 341 Score = 44.4 bits (100), Expect = 0.003 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP---XXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP KG PPPPP PPPPP G P PPPP Sbjct: 27 PPPLPMMPLKGSVPPPPPPKNGAAPPPPPPPLPMMPLKGSVPAPPPP 73 Score = 36.3 bits (80), Expect = 0.91 Identities = 23/78 (29%), Positives = 23/78 (29%), Gaps = 5/78 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX-----PP 361 PPP P PP PPP PPPPP P Sbjct: 10 PPPTKPLKNGAAPSPPPPPPLPMMPLKGSVPPPPPPKNGAAPPPPPPPLPMMPLKGSVPA 69 Query: 362 PPPXXXXXGGGXXPPPPP 415 PPP G P PPP Sbjct: 70 PPPPVPLKNGAAPPLPPP 87 Score = 35.9 bits (79), Expect = 1.2 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 7/42 (16%) Frame = +2 Query: 314 KGGXPPPPPXXXXX-------PPPPPXXXXXGGGXXPPPPPP 418 KG P PPP PPPPP G PPPPPP Sbjct: 4 KGSVPAPPPTKPLKNGAAPSPPPPPPLPMMPLKGSVPPPPPP 45 Score = 34.3 bits (75), Expect = 3.7 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPP----PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP P PPPPP G PPPPPP Sbjct: 26 PPPPLPMMPLKGSVPPPPPPK----NGAAPPPPPP 56 >UniRef50_Q0KI93 Cluster: CG12946-PB, isoform B; n=4; Sophophora|Rep: CG12946-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 630 Score = 44.4 bits (100), Expect = 0.003 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPPP PP PP G G PPPPPP Sbjct: 488 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 530 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P P PPP GG PPPPPP Sbjct: 488 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 Score = 35.5 bits (78), Expect = 1.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PP P PPPP G PPPPP Sbjct: 501 PPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 543 Score = 33.1 bits (72), Expect = 8.5 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPP G PPPPP Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 543 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 44.4 bits (100), Expect = 0.003 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG--GGXXPPPPPPXXFFFXPXXXXXGG 460 PPP PPPPP PPPPP G PPPPPP G Sbjct: 584 PPPTDLAGAPPVAPPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGA 643 Query: 461 GXXP 472 G P Sbjct: 644 GILP 647 Score = 40.3 bits (90), Expect = 0.056 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP G PP PPP PPPPP PPPP Sbjct: 584 PPPTDLAGAPPVAPPPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVG- 642 Query: 380 XXGGGXXPPPPPP 418 G PPPPPP Sbjct: 643 --AGILPPPPPPP 653 Score = 39.9 bits (89), Expect = 0.074 Identities = 26/75 (34%), Positives = 27/75 (36%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P PP G PPP G PPPP PPPPP Sbjct: 595 VAPPPP-PVGAPPPPPPPPPPPPGVAAAAPPPPPP--PPGLAGLVPPPPVGAGILPPPPP 651 Query: 371 XXXXXGGGXXPPPPP 415 G PPPPP Sbjct: 652 P---PGAPGMPPPPP 663 Score = 34.7 bits (76), Expect = 2.8 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP PPPPP PPP G PPPP P G Sbjct: 598 PPPPVGAPPPPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPPVGAGILPPPPPPPGAPG 657 Query: 467 XP 472 P Sbjct: 658 MP 659 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 44.4 bits (100), Expect = 0.003 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 1091 PPPPPPPPPPPPPPPPPGAIGLTAPPPPPPP 1121 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 1090 PPPPPPPPPPPPPPPPPPGAIGLTAPPPPPP 1120 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 1093 PPPPPPPPPPPPPPPGAIGLTAPPPPPPPPP 1123 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPP Sbjct: 1089 PPPPPPPPPPPPPPPPPPPGAIGLTAPPPPP 1119 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 1092 PPPPPPPPPPPPPPPPGAIGLTAPPPPPPPP 1122 >UniRef50_Q9NZ56 Cluster: Formin-2; n=13; Eumetazoa|Rep: Formin-2 - Homo sapiens (Human) Length = 1865 Score = 44.4 bits (100), Expect = 0.003 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1184 IPPPPPLPGAGIPP--PPPLPGAG-------IPPP--PPLPGAGIPPPPPLPGAGIPPPP 1232 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1233 PLP---GAGIPPPPPLPGVGIPPPPPLPGAGIPP 1263 Score = 44.4 bits (100), Expect = 0.003 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1228 IPPPPPLPGAGIPP--PPPLPGVG-------IPPP--PPLPGAGIPPPPPLPGAGIPPPP 1276 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1277 PLP---GAGIPPPPPLPRVGIPPPPPLPGAGIPP 1307 Score = 44.0 bits (99), Expect = 0.005 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1129 IPPPPPLPGAGIPP--PPPLPGAG-------IPPP--PPLPGAGIPPPPPLPGAGIPPPP 1177 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1178 PLP---GAGIPPPPPLPGAGIPPPPPLPGAGIPP 1208 Score = 44.0 bits (99), Expect = 0.005 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1151 IPPPPPLPGAGIPP--PPPLPGAG-------IPPP--PPLPGAGIPPPPPLPGAGIPPPP 1199 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1200 PLP---GAGIPPPPPLPGAGIPPPPPLPGAGIPP 1230 Score = 44.0 bits (99), Expect = 0.005 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1206 IPPPPPLPGAGIPP--PPPLPGAG-------IPPP--PPLPGAGIPPPPPLPGVGIPPPP 1254 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1255 PLP---GAGIPPPPPLPGAGIPPPPPLPGAGIPP 1285 Score = 44.0 bits (99), Expect = 0.005 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1272 IPPPPPLPGAGIPP--PPPLPRVG-------IPPP--PPLPGAGIPPPPPLPGAGIPPPP 1320 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1321 PLPGVG---IPPPPPLPGVGIPPPPPLPGAGIPP 1351 Score = 43.6 bits (98), Expect = 0.006 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1085 IPPPPPLP--GAAIPPPPPLPGAGI-----PLPPPLPG----AGIPPPPPLPGAGIPPPP 1133 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1134 PLP---GAGIPPPPPLPGAGIPPPPPLPGAGIPP 1164 Score = 43.6 bits (98), Expect = 0.006 Identities = 32/94 (34%), Positives = 34/94 (36%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP + G PPPPP PPPP Sbjct: 1261 IPPPPPLPGAGIPP--PPPLPGAG-------IPPP--PPLPRVGIPPPPPLPGAGIPPPP 1309 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1310 PLP---GAGIPPPPPLPGVGIPPPPPLPGVGIPP 1340 Score = 43.2 bits (97), Expect = 0.008 Identities = 34/106 (32%), Positives = 35/106 (33%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1283 IPPPPPLPRVGIPP--PPPLPGAG-------IPPP--PPLPGAGIPPPPPLPGVGIPPPP 1331 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPLXXXKKXXXGVG 508 G PPPPP P G G P G G Sbjct: 1332 PLPGVG---IPPPPPLPGAGIPPPPPLPGMGIPPAPAPPLPPPGTG 1374 Score = 42.7 bits (96), Expect = 0.011 Identities = 29/76 (38%), Positives = 30/76 (39%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1173 IPPPPPLPGAGIPP--PPPLPGAG-------IPPP--PPLPGAGIPPPPPLPGAGIPPPP 1221 Query: 371 XXXXXGGGXXPPPPPP 418 G G PPPP P Sbjct: 1222 --PLPGAGIPPPPPLP 1235 Score = 42.7 bits (96), Expect = 0.011 Identities = 29/76 (38%), Positives = 30/76 (39%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 1250 IPPPPPLPGAGIPP--PPPLPGAG-------IPPP--PPLPGAGIPPPPPLPRVGIPPPP 1298 Query: 371 XXXXXGGGXXPPPPPP 418 G G PPPP P Sbjct: 1299 --PLPGAGIPPPPPLP 1312 Score = 41.5 bits (93), Expect = 0.024 Identities = 32/99 (32%), Positives = 33/99 (33%), Gaps = 5/99 (5%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXG-----KFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX 355 I PPP +P G PP G PPP G PPPPP Sbjct: 1096 IPPPPPLP--GAGIPLPPPLPGAGIPPPPPLPGAGIPPPP---PLPGAGIPPPPPLPGAG 1150 Query: 356 PPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPP G PPPPP P G G P Sbjct: 1151 IPPPPPLP---GAGIPPPPPLPGAGIPPPPPLPGAGIPP 1186 Score = 38.7 bits (86), Expect = 0.17 Identities = 31/103 (30%), Positives = 33/103 (32%), Gaps = 8/103 (7%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 ++ PPP P G PP G PP G PPPPP PPP Sbjct: 1049 EMLPPPPPPLPGAGIPPPPPLPGAGILPL-----PPLPG----AGIPPPPPLPGAAIPPP 1099 Query: 368 PXXXXXG--------GGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 P G G PPPPP P G G P Sbjct: 1100 PPLPGAGIPLPPPLPGAGIPPPPPLPGAGIPPPPPLPGAGIPP 1142 Score = 37.5 bits (83), Expect = 0.40 Identities = 29/94 (30%), Positives = 30/94 (31%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PP P Sbjct: 1316 IPPPPPLPGVGIPP--PPPLPGVG-------IPPP--PPLPGAGIPPPPPLPGMGIPPAP 1364 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPP P G P Sbjct: 1365 APPLPPPGTGIPPPPLLPVSGPPLLPQVGSSTLP 1398 Score = 35.5 bits (78), Expect = 1.6 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 P PPP PPP G G PPPP P P G G P Sbjct: 1040 PQPPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGIL-PLPPLPGAGIPP 1087 Score = 34.7 bits (76), Expect = 2.8 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 7/51 (13%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP-------PXXXXXGGGXXPPPPPP 418 PPP PPP P PPPP P G G PPPP P Sbjct: 1042 PPPLQGTEMLPPPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLP 1092 Score = 33.1 bits (72), Expect = 8.5 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 7/57 (12%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXG-------GGXXPPPPPPXXFFFXPXXXXXGGGXXPL 475 PPPPP PPPP G G PPPPP P G PL Sbjct: 1053 PPPPPLPGAGIPPPPPLPGAGILPLPPLPGAGIPPPPPLPGAAIPPPPPLPGAGIPL 1109 >UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: Enabled homolog - Rattus norvegicus (Rat) Length = 526 Score = 44.0 bits (99), Expect = 0.005 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP PPPPPP Sbjct: 290 GPPPPPPLPSAGPPPPPPPPPPLPNQVPPPPPP 322 Score = 37.1 bits (82), Expect = 0.52 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP PPPPP G PPPPPP Sbjct: 272 PPPLPSGPAYASALPPPPGP---PPPPP---LPSAGPPPPPPPP 309 Score = 35.5 bits (78), Expect = 1.6 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPP PP Sbjct: 294 PPPLPSAGPPPPPPPPPPLPNQVPPPPP----------PPPAPP 327 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 1409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPP 1452 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 1410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 1411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP PPPPPP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 1439 >UniRef50_A6G120 Cluster: Putative periplasmic protein TonB; n=1; Plesiocystis pacifica SIR-1|Rep: Putative periplasmic protein TonB - Plesiocystis pacifica SIR-1 Length = 807 Score = 44.0 bits (99), Expect = 0.005 Identities = 22/46 (47%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -1 Query: 417 GGGGGGXXPP--PXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G GGGG P P GGGGG GGGG P +K KGGG Sbjct: 621 GAGGGGVPAPGVPAPSLGGGGGGGRGGGGGGGAAKPGEKSKGKGGG 666 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 44.0 bits (99), Expect = 0.005 Identities = 27/73 (36%), Positives = 28/73 (38%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP G PPP G PPPPP PPPPP Sbjct: 614 PPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPPP-----GMPGMPPPPPGMPGMPPPPP-- 666 Query: 377 XXXGGGXXPPPPP 415 G PPPPP Sbjct: 667 ---GMPGMPPPPP 676 Score = 44.0 bits (99), Expect = 0.005 Identities = 25/60 (41%), Positives = 25/60 (41%), Gaps = 2/60 (3%) Frame = +2 Query: 287 PPPFXXXFXKG--GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGG 460 PPP G G PPPPP PPPPP G PPPPP F F P G Sbjct: 693 PPPPGMPGMPGMPGMPPPPPGMPGMPPPPP------GMPGMPPPPPGGFGFRPAAPVING 746 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG----GGXXPPPPPP 418 PPP PPPPP PPPPP G G PPPPPP Sbjct: 587 PPPPPPGASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPP 634 Score = 43.2 bits (97), Expect = 0.008 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP G PPPPP Sbjct: 680 GMPPPPPGMPGMPPPPPGMPGMPGMPGMPPPPP 712 Score = 39.9 bits (89), Expect = 0.074 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 2/77 (2%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFX--KGGXPPPPPXXXXXPPP 364 + PPP P PP G PPP G PPPPP PP Sbjct: 585 LAPPPPPP---GASSIPPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPP 641 Query: 365 PPXXXXXGGGXXPPPPP 415 PP G PPPPP Sbjct: 642 PPPPPGMPG--MPPPPP 656 Score = 38.3 bits (85), Expect = 0.23 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 G PPPPP PPPPP G PPPPP Sbjct: 670 GMPPPPPGMPGMPPPPP-----GMPGMPPPPP 696 Score = 35.5 bits (78), Expect = 1.6 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP-----PPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PPPP G PPPPPP Sbjct: 599 PPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPG--MPPPPPP 645 Score = 34.3 bits (75), Expect = 3.7 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 2/75 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP--PPPP 370 PPP P PP PPP G PPPPP P PPPP Sbjct: 598 PPPPPPPGASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPPPPP--PGMPGMPPPP 655 Query: 371 XXXXXGGGXXPPPPP 415 G PPPPP Sbjct: 656 ----PGMPGMPPPPP 666 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 44.0 bits (99), Expect = 0.005 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPPP G PPPPP Sbjct: 502 PPPPPSKSSGPPPPPPPPPKSSGPPPPPPP 531 Score = 38.3 bits (85), Expect = 0.23 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 335 PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP G PPPPPP Sbjct: 492 PPISSPPPPPPPPPPSKSSGPPPPPPPP 519 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP G PPPPPP Sbjct: 492 PPISSPPPPPPPPPPSKSSGPPPPPPPPP 520 Score = 34.3 bits (75), Expect = 3.7 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP G PPPPP PPPP PPPP Sbjct: 501 PPPPPPSKSSGPPPPPPPPPKSSGPPPPPPPKSS----PPPP 538 Score = 33.9 bits (74), Expect = 4.9 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP PPPPP G PPPPP Sbjct: 497 PPPP-----PPPPPPSKSSGPPPPPPPPP 520 >UniRef50_Q54ER5 Cluster: Formin homology domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Formin homology domain-containing protein - Dictyostelium discoideum AX4 Length = 2546 Score = 44.0 bits (99), Expect = 0.005 Identities = 20/33 (60%), Positives = 20/33 (60%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP GGG PPPPPP Sbjct: 1056 GGPPPPP-----PPPPPPGKSSGGGP-PPPPPP 1082 Score = 43.6 bits (98), Expect = 0.006 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 7/41 (17%) Frame = +2 Query: 317 GGXPPPPPXXXXX-------PPPPPXXXXXGGGXXPPPPPP 418 GG PPPPP PPPPP GG PPPPPP Sbjct: 1056 GGPPPPPPPPPPPGKSSGGGPPPPPPPPPKGGKGGPPPPPP 1096 >UniRef50_P41484 Cluster: Proline-rich antigen; n=21; Mycobacterium|Rep: Proline-rich antigen - Mycobacterium leprae Length = 249 Score = 44.0 bits (99), Expect = 0.005 Identities = 21/51 (41%), Positives = 22/51 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPPPP PPPPP GG PPPPP + P Sbjct: 39 PPPTAPPVGGSYPPPPPPGGSYPPPPPP------GGSYPPPPPSTGAYAPP 83 Score = 34.7 bits (76), Expect = 2.8 Identities = 24/70 (34%), Positives = 25/70 (35%) Frame = +2 Query: 161 PXFXXXXLKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP 340 P F L PPP P G PP G + PPP G PPPPP Sbjct: 27 PSFAPSELGSAYPPPTAPPVGGSY--PPPPPPGGSYPP----PPP-----PGGSYPPPPP 75 Query: 341 XXXXXPPPPP 370 PPPP Sbjct: 76 STGAYAPPPP 85 Score = 33.9 bits (74), Expect = 4.9 Identities = 22/63 (34%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +2 Query: 290 PPFXXXFXKGGXPPP--PPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 P F PPP PP PPPPP GG PPPPP + P G Sbjct: 27 PSFAPSELGSAYPPPTAPPVGGSYPPPPPP----GGSY--PPPPPPGGSYPPPPPSTGAY 80 Query: 464 XXP 472 P Sbjct: 81 APP 83 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 44.0 bits (99), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 46 PPPTVEEQPPPPPPPPPPPPPPPPPPPPQIEPDKFEEAPPPPPP 89 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 60 PPPPPPPPPPPPPPQIEPDKFEEAPPPPPPP 90 >UniRef50_P22357 Cluster: Anther-specific protein SF18 precursor; n=3; core eudicotyledons|Rep: Anther-specific protein SF18 precursor - Helianthus annuus (Common sunflower) Length = 161 Score = 44.0 bits (99), Expect = 0.005 Identities = 28/80 (35%), Positives = 29/80 (36%) Frame = -1 Query: 555 PPPPKXXKKKKXXXXXPTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXX 376 PP P + PTP G PP G GG GGG PPP Sbjct: 84 PPAPPGKGEGDAPHPPPTPSPPGGDGGSGPAPPAG----GGSPPPAGGDGGGGAPPP-AG 138 Query: 375 XXGGGGGXXFXXGGGGGXPP 316 GGGG G GGG PP Sbjct: 139 GDGGGGAPPPAGGDGGGAPP 158 Score = 34.3 bits (75), Expect = 3.7 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 320 GXPPPPPXXXXX--PPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PP PP P PPP GG P PP P GGG P Sbjct: 82 GTPPAPPGKGEGDAPHPPPTPSPPGGDGGSGPAPPAGGGSPPPAGGDGGGGAP 134 Score = 33.1 bits (72), Expect = 8.5 Identities = 27/81 (33%), Positives = 27/81 (33%), Gaps = 10/81 (12%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXX-FXKGGXPPPPPXXXXXPPP--- 364 PPP P PP GK PPP GG P PP PPP Sbjct: 73 PPPGAPGTPGTPPAPP-----GKGEGDAPHPPPTPSPPGGDGGSGPAPPAGGGSPPPAGG 127 Query: 365 ------PPXXXXXGGGXXPPP 409 PP GGG PPP Sbjct: 128 DGGGGAPPPAGGDGGGGAPPP 148 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 43.6 bits (98), Expect = 0.006 Identities = 25/72 (34%), Positives = 26/72 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P G PP G PPP PPPPP PPP Sbjct: 306 PPPPVPGLGSAPPPPPPPPPPGPAGLFSPPPPP----------PPPPPGFAGLASPPPPP 355 Query: 377 XXXGGGXXPPPP 412 GG PPPP Sbjct: 356 PPPGGLSIPPPP 367 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP G PPPPP PPPPP PPPPPP F Sbjct: 304 PPPPPPVPGLGSAPPPPP-----PPPPPGPAGLFSPPPPPPPPPPGF 345 Score = 39.1 bits (87), Expect = 0.13 Identities = 28/86 (32%), Positives = 29/86 (33%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP 361 L + PPP P G PP PPP G PPPP PP Sbjct: 299 LSNVIPPPPPPVPGLGSAPPP--------------PPPPPPPGPAGLFSPPPP-----PP 339 Query: 362 PPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPPPPP P Sbjct: 340 PPPPGFAGLASPPPPPPPPGGLSIPP 365 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPPP PPPPP Sbjct: 916 PPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALPPPPP 958 Score = 39.9 bits (89), Expect = 0.074 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPP Sbjct: 915 PPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALPPPPP 958 Score = 36.7 bits (81), Expect = 0.69 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPP G PPPPP Sbjct: 889 PPPPPPPPPPQPPPSSGSAPGAPPAPPPPP 918 Score = 36.7 bits (81), Expect = 0.69 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP P PPP G PPPPP Sbjct: 889 PPPPPPPPPPQPPPSSGSAPGAPPAPPPPP 918 Score = 36.7 bits (81), Expect = 0.69 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP P PPP PPPPP Sbjct: 914 PPPPPLLSEAPLPPPPPPPPQAALPPPPPP 943 Score = 34.7 bits (76), Expect = 2.8 Identities = 23/79 (29%), Positives = 24/79 (30%), Gaps = 5/79 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP PP + PPP P PPP PPPP Sbjct: 900 PPPSSGSAPGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPPPAPDAALPPPPPA 959 Query: 377 XXXGGGXXP-----PPPPP 418 G P PPPPP Sbjct: 960 PPPPGPPLPFDVAGPPPPP 978 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PP PPP + P P P PP GPP Sbjct: 908 PGAPPAPPPPPLLSEAPLPPPPPPPPQAALPPPPPPGPP 946 >UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: diaphanous protein - Entamoeba histolytica HM-1:IMSS Length = 1176 Score = 43.6 bits (98), Expect = 0.006 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP G PPPPPP Sbjct: 618 PPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPG--MPPPPPPP 659 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP G PPPPPP Sbjct: 606 PPPPPPGASSIPPPPPPPGMPGMPPPPPPPGMPG--MPPPPPPP 647 Score = 43.2 bits (97), Expect = 0.008 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP G PPPPPP Sbjct: 630 PPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPG---MPPPPPP 670 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G PPPPP PPPP G PPPPP Sbjct: 617 PPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPP 659 Score = 42.7 bits (96), Expect = 0.011 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 G PPPPP PPPPP G PPPPP F F P Sbjct: 695 GMPPPPPGMPGMPPPPP------GMPGMPPPPPGGFGFRP 728 Score = 40.7 bits (91), Expect = 0.042 Identities = 27/75 (36%), Positives = 27/75 (36%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP P PP G PPP G PPPPP PPPP Sbjct: 616 IPPPPPPPGMPGMPPPPPPPGMPGM-------PPPPPPPGMPGMPPPPPPPGMPGMPPPP 668 Query: 371 XXXXXGGGXXPPPPP 415 G PPPPP Sbjct: 669 PPGMPG---MPPPPP 680 Score = 39.5 bits (88), Expect = 0.098 Identities = 27/73 (36%), Positives = 27/73 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP G PPP G PPPPP PPPPP Sbjct: 642 PPPPPPGMPGMPPPPPPPGMPGM----PPPPPP-----GMPGMPPPPPGMPGMPPPPP-- 690 Query: 377 XXXGGGXXPPPPP 415 G PPPPP Sbjct: 691 --PGMPGMPPPPP 701 >UniRef50_UPI0000498407 Cluster: hypothetical protein 13.t00006; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 13.t00006 - Entamoeba histolytica HM-1:IMSS Length = 510 Score = 43.6 bits (98), Expect = 0.006 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPP--PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP PP PPPPP PPPPPP Sbjct: 387 PPPVAPAIGNPPPPPPIAPPKQAGNPPPPPPIRSTNSAGNPPPPPP 432 Score = 39.9 bits (89), Expect = 0.074 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX--PPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 372 PPPPPTAPMMDNIPPPPPVAPAIGNPPPPPPIAPPKQAGNPPPPPP 417 >UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: FH2 domain protein - Entamoeba histolytica HM-1:IMSS Length = 1212 Score = 43.6 bits (98), Expect = 0.006 Identities = 30/89 (33%), Positives = 31/89 (34%), Gaps = 6/89 (6%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P PP G PPP G PPPPP PPPP Sbjct: 623 VPPPPPPP---GASSVPPPPPPPGA----SSVPPPPPPPGMPGMPPPPPPPGMPGMPPPP 675 Query: 371 XXXXXGGGXXPP------PPPPXXFFFXP 439 G PP PPPP F F P Sbjct: 676 PLPGMPGMPPPPPGMPGMPPPPPGFGFRP 704 Score = 41.9 bits (94), Expect = 0.018 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 614 PPPPPGASSVPPPPPPP---GASSVPPPPPP 641 Score = 39.5 bits (88), Expect = 0.098 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP G PPPPP Sbjct: 613 PPPPPPGASSVPPPPPPPGASSVPPPPPPP----GASSVPPPPP 652 Score = 37.1 bits (82), Expect = 0.52 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 KG PPP PPPPP PPPPPP P G P Sbjct: 600 KGVVPPPSNTATAPPPPPPG----ASSVPPPPPPPGASSVPPPPPPPGASSVP 648 >UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear polyhedrosis virus|Rep: ORF1629 - Leucania separata nuclear polyhedrosis virus (LsNPV) Length = 589 Score = 43.6 bits (98), Expect = 0.006 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP PPPPP G PPPPPP Sbjct: 244 PAPPPQPIPPPPPPPPMPVESGSPPPPPPPP 274 Score = 39.9 bits (89), Expect = 0.074 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP G PPPPPP Sbjct: 246 PPPQPIPPPPPPPPMPVESGSPPPPPPPPP 275 Score = 37.1 bits (82), Expect = 0.52 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP G PPPPP PPPPP Sbjct: 255 PPPPPMPVESGSPPPPPPPPPPPPPPPP 282 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP + G PPPPP PPPPP Sbjct: 254 PPPPPPMPVESGSPPPPPPPPPPPPPPP 281 >UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2; Vibrio harveyi|Rep: Insecticidal toxin, SepC/Tcc class - Vibrio harveyi HY01 Length = 378 Score = 43.6 bits (98), Expect = 0.006 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 K PPP PPPPP PPPPP GGG PPPP P Sbjct: 79 KPAPPPPPPP-RMAPPPPPPPAGGMPPPPPP---PMGGGAPPPPPGP 121 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/59 (38%), Positives = 23/59 (38%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPLXXXKK 490 K PPPPP PPPPP G PPPPPP P G P KK Sbjct: 79 KPAPPPPPPPRMAPPPPPPP-----AGGMPPPPPPPMGGGAPPPPPGPGAPPPPPGAKK 132 Score = 33.5 bits (73), Expect = 6.4 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 K PPP P + PP G PPP GG PPPPP PPPP Sbjct: 79 KPAPPPPPP---PRMAPPPPPPPAGGMPP--PPPPPMG-----GGAPPPPPGPGAPPPPP 128 >UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis thaliana|Rep: F23H11.22 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 929 Score = 43.6 bits (98), Expect = 0.006 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP PPPPP G G PPPPPP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAG--PPPPPP 426 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +2 Query: 260 GKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G+F P P PPPPP PPPPP G PPPPPP Sbjct: 364 GQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPP--PKKGPAAPPPPPPP 414 Score = 42.7 bits (96), Expect = 0.011 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPP G PPPPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 36.7 bits (81), Expect = 0.69 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 585 KXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGG--GPPXXG 719 K P PPPPPP KK P P K P PPG GP G Sbjct: 402 KKGPAAPPPPPPPG--KKGAGPPPPPPMSKKGPPKPPGNPKGPTKSG 446 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPP G PP P Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 >UniRef50_Q2R360 Cluster: C2 domain containing protein, expressed; n=1; Oryza sativa (japonica cultivar-group)|Rep: C2 domain containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 347 Score = 43.6 bits (98), Expect = 0.006 Identities = 25/77 (32%), Positives = 26/77 (33%), Gaps = 3/77 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP---P 367 PPP + PP F PPP G PPPPP PPP P Sbjct: 201 PPPPSSYPPPPPPPPPPPHVTQSFAPNSSYPPPPPPSQYIAGYPPPPPSNFYPPPPAGYP 260 Query: 368 PXXXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 261 APSFPSPTSTYPPPPPP 277 Score = 37.1 bits (82), Expect = 0.52 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G P PPP PP P PPPPP Sbjct: 162 PPPTSTTTTTSGAPYPPPAMASYPPLPSLSATPSASLYPPPPP 204 Score = 35.5 bits (78), Expect = 1.6 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 6/40 (15%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXX------GGGXXPPPPPPXXF 427 PPPPP PPPPP PPPPPP + Sbjct: 200 PPPPPSSYPPPPPPPPPPPHVTQSFAPNSSYPPPPPPSQY 239 Score = 35.1 bits (77), Expect = 2.1 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 8/59 (13%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX--------PPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP + PPPPP PPPPP G PPPPP F+ P Sbjct: 200 PPPPPSSYPPPPPPPPPPPHVTQSFAPNSSYPPPPPPSQYIAGY---PPPPPSNFYPPP 255 >UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; Pisum sativum|Rep: Putative uncharacterized protein - Pisum sativum (Garden pea) Length = 306 Score = 43.6 bits (98), Expect = 0.006 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPPPP PPPPP PPPPPP F Sbjct: 78 PPPPPRRSSPPPPPPRIRSPPPPRPPPPPPPPLLF 112 Score = 40.7 bits (91), Expect = 0.042 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFF 433 PPPP PPPPP PPPPPP F Sbjct: 78 PPPPPRRSSPPPPPPRIRSPPPPRPPPPPPPPLLF 112 Score = 38.7 bits (86), Expect = 0.17 Identities = 26/89 (29%), Positives = 31/89 (34%) Frame = +2 Query: 161 PXFXXXXLKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP 340 P F + P P K++ PP + PPP + PPPPP Sbjct: 37 PHFHLYNQNSNSYPSSTPLEESKRRSPPPRRRSPPPPPRRSPPPPPR----RSSPPPPPP 92 Query: 341 XXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP P PPPPPP F Sbjct: 93 RIRSPPPPRP---------PPPPPPPLLF 112 >UniRef50_A2YNB7 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 444 Score = 43.6 bits (98), Expect = 0.006 Identities = 24/59 (40%), Positives = 25/59 (42%) Frame = -1 Query: 462 PPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 PP G GGGGGG P GGGGG GGGGG P + GGG Sbjct: 172 PPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGP--GGGGGGGGAPERVIGGGGGG 228 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/58 (39%), Positives = 23/58 (39%) Frame = -1 Query: 459 PPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 PP G GGGGG P GGGGG GGGGG P GGG Sbjct: 172 PPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGPGGGGGGGGAPERVIGGGGGGG 229 Score = 41.9 bits (94), Expect = 0.018 Identities = 22/62 (35%), Positives = 24/62 (38%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKG 292 G P G + GGGGGG P GGG GGGGG P + G Sbjct: 93 GGGGAPGPLGGGGARPPGGGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGGGG 152 Query: 291 GG 286 GG Sbjct: 153 GG 154 Score = 41.1 bits (92), Expect = 0.032 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -1 Query: 459 PPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 PP G GGGGGG P GGGGG GGGGG Sbjct: 160 PPGGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGG 204 Score = 40.7 bits (91), Expect = 0.042 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXX--FXXGGGGGXPPXKKXXKKGGG 286 GGGGGG P GGGGG GGGGG K+ GGG Sbjct: 210 GGGGGGGAPERVIGGGGGGGGALKCVVGGGGGGGGALKRAAGSGGG 255 Score = 39.5 bits (88), Expect = 0.098 Identities = 24/74 (32%), Positives = 27/74 (36%) Frame = -1 Query: 507 PTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGG 328 P P G P G + GGGGG PP GGGG GGGG Sbjct: 82 PLPIKLLGLPPGGGGAPGPLGGGGARPPGGGGGGGPPSLPP--GAGGGGGARPPAPGGGG 139 Query: 327 GXPPXKKXXKKGGG 286 G ++ GGG Sbjct: 140 GGGAPRRVLGGGGG 153 Score = 39.5 bits (88), Expect = 0.098 Identities = 21/59 (35%), Positives = 23/59 (38%) Frame = -1 Query: 462 PPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 PP G + GGGGGG P GGGG GGG G + GGG Sbjct: 121 PPGAGGGGGARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGG 179 Score = 38.7 bits (86), Expect = 0.17 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGG GG P GGGG GGGGG P + GGG Sbjct: 162 GGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGG 205 Score = 38.3 bits (85), Expect = 0.23 Identities = 23/65 (35%), Positives = 25/65 (38%), Gaps = 3/65 (4%) Frame = -1 Query: 471 GXXPPPXXXXXGX---KKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXX 301 G PP G ++ GGGGGG P GG G GGGGG P Sbjct: 129 GARPPAPGGGGGGGAPRRVLGGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGG 188 Query: 300 KKGGG 286 GGG Sbjct: 189 GGGGG 193 Score = 37.9 bits (84), Expect = 0.30 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GG GG PP GGG G GGGGG P GGG Sbjct: 163 GGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGG 206 Score = 37.5 bits (83), Expect = 0.40 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G K GGGGGG GGGGG GGGG K GGG Sbjct: 230 GALKCVVGGGGGGGGALKRAAGSGGGGGALECEIGGGGGGGGTDRNKGGGG 280 Score = 35.9 bits (79), Expect = 1.2 Identities = 21/60 (35%), Positives = 23/60 (38%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGGXXF*XXNFPKXSXXGG 238 GGGGGG GGGG GGGGG + GGG N + GG Sbjct: 238 GGGGGGGALKRAAGSGGGGGALECEIGGGGGGGGTDRNKGGGGGGGGALENAREDGAEGG 297 Score = 34.7 bits (76), Expect = 2.8 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKG 292 G P G + GGGGGG P GGG GGGGG K G Sbjct: 183 GRAPGGGGGGGGPGRAPGGGGGGGG---PGGGGGGGGAPERVIGGGGGGGGALKCVVGGG 239 Query: 291 GG 286 GG Sbjct: 240 GG 241 Score = 34.7 bits (76), Expect = 2.8 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -1 Query: 429 KXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 K GGGGG GGGGG GGG G P GGG Sbjct: 276 KGGGGGGGGALENAREDGAEGGGGGGGGGGGGGHGAPELGFSGGGGGG 323 Score = 34.3 bits (75), Expect = 3.7 Identities = 21/55 (38%), Positives = 22/55 (40%), Gaps = 11/55 (20%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGG-----------XXFXXGGGGGXPPXKKXXKKGGG 286 GGG GG PP GGGGG GGGGG K + GGG Sbjct: 338 GGGAGGVFPPTPDLGGGGGGGGGGTKVRVCAPKDISGGGGGGGGMLDKPDEAGGG 392 Score = 33.9 bits (74), Expect = 4.9 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G K G GGGG GGGGG GGGGG Sbjct: 244 GALKRAAGSGGGGGALECEIGGGGGGGGTDRNKGGGGG 281 Score = 33.5 bits (73), Expect = 6.4 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G + GGGGGG GGG GGGGG + GGG Sbjct: 271 GTDRNKGGGGGGGGALENAREDGAEGGGGGGGGGGGGGHGAPELGFSGGGG 321 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 43.6 bits (98), Expect = 0.006 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 7/41 (17%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPP-------PXXXXXGGGXXPPPPPP 418 GG PPPPP PPPP P GG PPPPPP Sbjct: 1058 GGPPPPPPPPPPPPPPPGGLPGAAPPMPGAGGPPPPPPPPP 1098 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 6/39 (15%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPP------PXXXXXGGGXXPPPPPP 418 G PPPPP PPPP P GG PPPPPP Sbjct: 1029 GPPPPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPPPPPP 1067 Score = 42.3 bits (95), Expect = 0.014 Identities = 28/74 (37%), Positives = 28/74 (37%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP G PPP G PPPPP PPPP Sbjct: 1068 PPPPPPPGGLPGAAPPMPGAGGPPPPPPPPPPPPMPGM--AGMPPPPP------PPPPMP 1119 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 1120 GMP--GMPPPPPPP 1131 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP P P GG PPPPPP Sbjct: 1038 PPPPPPPGFLPGAPAPIPGAGGPPPPPPPPP 1068 Score = 35.1 bits (77), Expect = 2.1 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP F G P P P PPPPP PPPPPP GG Sbjct: 1039 PPPPPPGFLPGA-PAPIPGAGGPPPPPPP-------PPPPPPPPGGLPGAAPPMPGAGGP 1090 Query: 467 XP 472 P Sbjct: 1091 PP 1092 >UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 429 Score = 43.6 bits (98), Expect = 0.006 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP G PPPPPP Sbjct: 352 GAPPPPPP----PPPPPPPPASSGSPAPPPPPP 380 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP---XXXXXGGGXXPPPPPP 418 PPPPP PPP P G PPPPPP Sbjct: 327 PPPPPKTTAAPPPLPAVSSEPPKTTGAPPPPPPP 360 >UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eutheria|Rep: Protein diaphanous homolog 2 - Homo sapiens (Human) Length = 1101 Score = 43.6 bits (98), Expect = 0.006 Identities = 24/64 (37%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGG 460 PP G PPPPP P PPP G PPPPPP F P G Sbjct: 551 PPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLG 610 Query: 461 GXXP 472 G P Sbjct: 611 GVPP 614 Score = 42.7 bits (96), Expect = 0.011 Identities = 23/57 (40%), Positives = 23/57 (40%), Gaps = 5/57 (8%) Frame = +2 Query: 317 GGXPPPPPXXXXXP-----PPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P PPPP G PPPPPP F P GG P Sbjct: 559 GVGPPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLFGGPPPPPPLGGVPPP 615 Score = 40.3 bits (90), Expect = 0.056 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXX-GGGXXPPPPPP 418 G P PP PPPPP GG PPPPPP Sbjct: 550 GPPAAPPLPGVGPPPPPPAPPLPGGAPLPPPPPP 583 Score = 39.1 bits (87), Expect = 0.13 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP 364 PPP P G PP G PPP GG PPPPP PPP Sbjct: 565 PPPAPPLPGGAPLPPPPPPLPGMMGIPPPPPPPLLF----GGPPPPPPLGGVPPPP 616 Score = 35.9 bits (79), Expect = 1.2 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPP 409 PPP G PPPPP PPPP GG PPP Sbjct: 579 PPPPPLPGMMGIPPPPPPPLLFGGPPPPPPL---GGVPPPP 616 >UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n=2; Nucleopolyhedrovirus|Rep: Essential structural protein pp78-81 - Lymantria dispar multicapsid nuclear polyhedrosis virus (LdMNPV) Length = 555 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P G PPPP PPPPP PPPPPP Sbjct: 230 PEPIRQETPTGLFAPPPPPPPPPPPPPPEPLQQKSSAVPPPPPP 273 Score = 41.1 bits (92), Expect = 0.032 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 244 PPPPPPPPPPPPPPEPLQQKSSAVPPPPPPP 274 >UniRef50_Q9LMQ1 Cluster: F7H2.17 protein; n=2; Arabidopsis thaliana|Rep: F7H2.17 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 1006 Score = 43.2 bits (97), Expect = 0.008 Identities = 24/76 (31%), Positives = 27/76 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP +P PP PPP + PPP P PPPPP Sbjct: 348 LPPPPSLPVTPCSPPPPPIIVNGA--------PPPPCVTCVQVSPPPPTPVPCSPPPPPP 399 Query: 371 XXXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 400 IPVPCPPPPSPPPPPP 415 Score = 38.3 bits (85), Expect = 0.23 Identities = 22/76 (28%), Positives = 23/76 (30%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + P P P CPP PPP PP PP P PPP Sbjct: 119 LVPSPPPPLHPRPSPCPPPLMPSPPPLVPSPPPPP-PSPLVPSPPPPSPPPFFFFPSPPP 177 Query: 371 XXXXXGGGXXPPPPPP 418 P PPPP Sbjct: 178 PVIVFPPPLVPSPPPP 193 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 P PPP PPPPP PP PPP FF P Sbjct: 140 PSPPPLVPSPPPPPPSPLVPS--PPPPSPPPFFFFPSP 175 Score = 33.9 bits (74), Expect = 4.9 Identities = 26/87 (29%), Positives = 30/87 (34%), Gaps = 11/87 (12%) Frame = +2 Query: 191 ITPPPQIPFWGXKKK----CPPXXEXXGKFXX*KXXPPPFXXXFXKG--GXPPPPPXXXX 352 ++PPP +P + PP G PPP G G PPPP Sbjct: 538 LSPPPPLPGGTVSQPPFTMTPPPLLGGGAPGTTDSPPPPLLGSGAPGITGSPPPPLLGGG 597 Query: 353 XP-----PPPPXXXXXGGGXXPPPPPP 418 P PPPP G PPPP Sbjct: 598 APGITGSPPPPLLGGGAPGITGSPPPP 624 Score = 33.9 bits (74), Expect = 4.9 Identities = 27/85 (31%), Positives = 29/85 (34%), Gaps = 9/85 (10%) Frame = +2 Query: 191 ITPPPQIPFW--GXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKG--GXPPPPPXXXXXP 358 +TPPP + G PP G PPP G G PPPP P Sbjct: 556 MTPPPLLGGGAPGTTDSPPPPLLGSGAPGITGSPPPPLLGGGAPGITGSPPPPLLGGGAP 615 Query: 359 -----PPPPXXXXXGGGXXPPPPPP 418 PPPP G PPPP Sbjct: 616 GITGSPPPPLLGGGAPGITGSPPPP 640 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP PPPPP G PPPPPP P G P Sbjct: 323 GAPPPPPSRGSAPPPPPARM----GTAPPPPPPSRSSQRPPPPSRGAPPPP 369 Score = 41.9 bits (94), Expect = 0.018 Identities = 26/77 (33%), Positives = 28/77 (36%), Gaps = 2/77 (2%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 T PP P ++ PP PPP PPPPP PPPPP Sbjct: 344 TAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPP--PPPPPPVGGPPPPPPPI 401 Query: 374 XXXXGG--GXXPPPPPP 418 G PPPPPP Sbjct: 402 EGRPPSSLGNPPPPPPP 418 Score = 36.7 bits (81), Expect = 0.69 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 10/54 (18%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP----PXXXXXG------GGXXPPPPPP 418 PPP PPPP PPPP P G GG PPPPPP Sbjct: 335 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPP 388 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPP----PPPP 418 PPP +G PPPPP PPPP PP PPPP Sbjct: 327 PPP-----SRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 369 Score = 34.3 bits (75), Expect = 3.7 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPP---PXXXXXGGGXXPPPPP 415 G PPPPP PPPP G PPPPP Sbjct: 304 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPP 339 >UniRef50_A2EVR8 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 434 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPP PPPPP GGG PPPPP Sbjct: 299 PPPMKPQSF-AAIPPPGALPPPPPPPPPPPKAPGGGSLPPPPP 340 Score = 38.7 bits (86), Expect = 0.17 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P F G PPPPP PPPPP GG PPPPP Sbjct: 304 PQSFAAIPPPGALPPPPP-----PPPPPPKAPGGGSL--PPPPP 340 >UniRef50_Q6CEK4 Cluster: Similar to tr|O42854 Schizosaccharomyces pombe Hypothetical 170.5 kDa protein; n=1; Yarrowia lipolytica|Rep: Similar to tr|O42854 Schizosaccharomyces pombe Hypothetical 170.5 kDa protein - Yarrowia lipolytica (Candida lipolytica) Length = 1329 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP +G PPPPP PPPP PPPPPP Sbjct: 885 PPPIPQSPERGAPPPPPPATERSAPPPPPER----AAAPPPPPP 924 >UniRef50_A4R9P2 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 216 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPPP PPPPP PPPPPP Sbjct: 75 PPAPAKDGADGAAPPPPAKDGAAPPPPPAKDGGDAAPPPPPPPP 118 >UniRef50_A3LN86 Cluster: Protein involved in actin organization and endocytosis; n=2; Saccharomycetales|Rep: Protein involved in actin organization and endocytosis - Pichia stipitis (Yeast) Length = 1373 Score = 43.2 bits (97), Expect = 0.008 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP P PPP G PPPPPP Sbjct: 1278 PPIPVGGPSSFAPPPPPPPPPPPGPPPIPNAPFGAPPPPPPPP 1320 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 43.2 bits (97), Expect = 0.008 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 43.2 bits (97), Expect = 0.008 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPP G PPP PP PP G PPPPPP Sbjct: 438 PPPLPGPGATSPLPPPPPPLPPPLPGSGTTSPPPPPPPPPPLPPPLPGSGTISPPPPPPP 497 Score = 41.1 bits (92), Expect = 0.032 Identities = 26/74 (35%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P G PP K PPP PPPPP P PPP Sbjct: 496 PPPPLPGTGAVSP-PPPPPLPSLPDSHKTQPPP----------PPPPPLPGMCPVPPPPP 544 Query: 377 XXXGGGXXPPPPPP 418 G PPPP P Sbjct: 545 LPRAGQIPPPPPLP 558 Score = 39.5 bits (88), Expect = 0.098 Identities = 26/80 (32%), Positives = 27/80 (33%), Gaps = 6/80 (7%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP------XXXXX 355 +PPP P PP G PPP PPPPP Sbjct: 468 SPPPPPP---PPPPLPPPLPGSGTISPPPPPPPPPLPGTGAVSPPPPPPLPSLPDSHKTQ 524 Query: 356 PPPPPXXXXXGGGXXPPPPP 415 PPPPP G PPPPP Sbjct: 525 PPPPPPPPLPGMCPVPPPPP 544 Score = 37.5 bits (83), Expect = 0.40 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPP PPPPP G PPPPPP Sbjct: 476 PPPLPPPLPGSGTISPPPP----PPPPPLPGT--GAVSPPPPPP 513 >UniRef50_UPI0000499326 Cluster: actin binding protein; n=1; Entamoeba histolytica HM-1:IMSS|Rep: actin binding protein - Entamoeba histolytica HM-1:IMSS Length = 986 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 2/51 (3%) Frame = +2 Query: 326 PPPPPXXXXXP--PPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPPP P PPPP G PPPPPP P G G P Sbjct: 503 PPPPPGTQPIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPPPPPMGKGMPP 553 Score = 40.3 bits (90), Expect = 0.056 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP--PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPP P PPPPP G PPPPPP Sbjct: 504 PPPPGTQPIPGVPPPPPGVPGATGVPPPPPPPGMPGA---PPPPPP 546 Score = 37.5 bits (83), Expect = 0.40 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 1/71 (1%) Frame = +2 Query: 200 PPQIPFWGXKKKCP-PXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PP IP + P G PPP G PPPPP PPPP Sbjct: 487 PPSIPTTSQQSSSSLPPPPPPGTQPIPGVPPPPPGVPGATGVPPPPPPPGMPGAPPPP-- 544 Query: 377 XXXGGGXXPPP 409 G G PPP Sbjct: 545 PPMGKGMPPPP 555 >UniRef50_UPI0000D8C71D Cluster: Wiskott-Aldrich syndrome protein (WASp).; n=3; Danio rerio|Rep: Wiskott-Aldrich syndrome protein (WASp). - Danio rerio Length = 490 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 + G PPPP PPP GGG PPPPPP Sbjct: 350 RSGPLPPPPTNRSGGLPPPLPEPSGGGPPPPPPPP 384 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP GG PPP P PPPP P PPP F P Sbjct: 356 PPPTNR---SGGLPPPLPEPSGGGPPPPPPPPAAPPPPPAAPPPMNFGSSP 403 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 536 PPPPPPPPPPPPPPPPPLPSAEPPVPPPPPP 566 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 537 PPPPPPPPPPPPPPPPLPSAEPPVPPPPPPP 567 Score = 41.5 bits (93), Expect = 0.024 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 538 PPPPPPPPPPPPPPPLPSAEPPVPPPPPPPP 568 Score = 39.9 bits (89), Expect = 0.074 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP P PPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPP 564 Score = 39.9 bits (89), Expect = 0.074 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPLPSAEPPVPPPPP 565 Score = 34.3 bits (75), Expect = 3.7 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPPXXG 719 P PPPPPP P P PP G PP G Sbjct: 534 PPPPPPPPPPPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLPG 575 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPPP F P Sbjct: 953 PPPPPPPPPPPPPPPQQQFQLPSQFPPPPPTARIFLRP 990 Score = 37.9 bits (84), Expect = 0.30 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPPP G PP PP Sbjct: 1081 PPPPPPAPVTGPTPPPPPP--PPPPPPPPAPVTGPTPPAPPLPP 1122 Score = 37.5 bits (83), Expect = 0.40 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 G P PPP PPPPP PPPPP Sbjct: 1232 GDFPSPPPECACFPPPPPASELFPPPPPPPPPP 1264 Score = 36.7 bits (81), Expect = 0.69 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G PPPP PPPPP G PP PP Sbjct: 1080 PPPPPPPAPVTGPTPPPPPPPPPPPPPPAPVT---GPTPPAPP 1119 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXX--FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP F PPPPP P PPP PPPPPP Sbjct: 1067 PPPADTSAAFIAAPPPPPPPAPVTGPTPPPPPP-----PPPPPPPP 1107 Score = 35.1 bits (77), Expect = 2.1 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +2 Query: 290 PPFXXXFXKGGXPP-PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP GG PPP PPPPP PPPPPP F P Sbjct: 928 PPRDLLCLNGGLEESPPPAPTPSPPPPPPPPP----PPPPPPPPQQQFQLP 974 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPPPXXXXX----PPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP G PPPPPP Sbjct: 1066 PPPPADTSAAFIAAPPPPPPPAPVTGPTPPPPPPP 1100 Score = 33.1 bits (72), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PP PP GG PPPPPP Sbjct: 868 PAAPPAFIPPPPTSAHALQVNGGSFPPPPPP 898 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPSPPAPAPPPPPP 303 Score = 40.3 bits (90), Expect = 0.056 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPP P Sbjct: 275 PPPPPPPPPPPPPPPPPSPPAPAPPPPPPAP 305 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPSPPAPAPPPPP 302 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPP PP Sbjct: 276 PPPPPPPPPPPPPPPPSPPAPAPPPPPPAPP 306 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PP PPP Sbjct: 277 PPPPPPPPPPPPPPPSPPAPAPPPPPPAPPP 307 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PP PP PPPPPP Sbjct: 280 PPPPPPPPPPPPSPPAPAPPPPPPAPPPPPP 310 Score = 36.7 bits (81), Expect = 0.69 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP PPPP P Sbjct: 274 PPPPPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 >UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 359 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPP----PPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPP PP GG PPPPPP Sbjct: 78 PPPPPPGGELPPPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPPPPPPP 125 Score = 39.5 bits (88), Expect = 0.098 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPP---PPPP 418 G PPPPP PPPPP G G PP PPPP Sbjct: 76 GAPPPPPPGGELPPPPPP--PPGGYGAPPPAWGPPPP 110 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP G P PPPPP GG PPPPPP + P Sbjct: 55 PPPPPAPAPASGPSEPGGPVWGAPPPPP----PGGELPPPPPPPPGGYGAP 101 Score = 34.3 bits (75), Expect = 3.7 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = +2 Query: 203 PQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXX 382 P P WG PP E PPP GG PPP PPPP Sbjct: 70 PGGPVWGAPPPPPPGGELP-------PPPPP-----PPGGYGAPPPAWG--PPPPSGAPG 115 Query: 383 XGGGXXPPPPPP 418 G PPPP P Sbjct: 116 GWGPPPPPPPMP 127 >UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|Rep: Adhesin FhaB - Bordetella avium Length = 2621 Score = 42.7 bits (96), Expect = 0.011 Identities = 26/80 (32%), Positives = 28/80 (35%), Gaps = 6/80 (7%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX------P 358 PPP++ PP K PPP K PPPPP P Sbjct: 2412 PPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2471 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPPP Sbjct: 2472 PPPPPPPPKVKKVDPPPPPP 2491 Score = 40.3 bits (90), Expect = 0.056 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P KK PP K PPP PPPP PPPPP Sbjct: 2328 PPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPP---------PPPPPKVKKVDPPPPPPP 2378 Query: 377 XXXGGGXXPPPPPP 418 PPPPP Sbjct: 2379 PPPKVKKVDPPPPP 2392 Score = 40.3 bits (90), Expect = 0.056 Identities = 30/89 (33%), Positives = 32/89 (35%), Gaps = 10/89 (11%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXG----KFXX*KXXPPPFXXXFXKGGXPPPPPX-- 343 +KK+ PPP P KK PP K PPP K PPPPP Sbjct: 2337 VKKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2396 Query: 344 ----XXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP Sbjct: 2397 PPKVKKVDPPPPPPPPPPKVKKVDPPPPP 2425 Score = 40.3 bits (90), Expect = 0.056 Identities = 25/79 (31%), Positives = 27/79 (34%), Gaps = 5/79 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPX-----XXXXPP 361 PPP++ PP K PPP K PPPPP PP Sbjct: 2363 PPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPP 2422 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP PPPPP Sbjct: 2423 PPPPPPPPKVKKVDPPPPP 2441 Score = 39.5 bits (88), Expect = 0.098 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P KK PP K PPP PPPP PPPPP Sbjct: 2407 PPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPP------PPPPPPPPKVKKVDPPPPPPP 2460 Query: 377 XXXGGGXXPPPPPP 418 PPPPP Sbjct: 2461 PPPKVKKVDPPPPP 2474 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP PPPPP PPPPPP Sbjct: 2319 PSPPPPPPPPPPPPPPPKVKKVDPPPPPPPP 2349 Score = 38.7 bits (86), Expect = 0.17 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP KK P P K P PP PP Sbjct: 2326 PPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPPP 2364 Score = 37.9 bits (84), Expect = 0.30 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P F K P PP PPPPP PPPPPP Sbjct: 2306 PKFLMRERKNKIDPSPPPPPPPPPPPPPPPKVKKVDPPPPPPP 2348 Score = 37.1 bits (82), Expect = 0.52 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKK--KKXXXXPXXPXXXKXXPXPPGGGPP 710 KK P PPPPPP KK P P K P PP PP Sbjct: 2352 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2396 Score = 37.1 bits (82), Expect = 0.52 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKK--KKXXXXPXXPXXXKXXPXPPGGGPP 710 KK P PPPPPP KK P P K P PP PP Sbjct: 2401 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2445 Score = 37.1 bits (82), Expect = 0.52 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKK--KKXXXXPXXPXXXKXXPXPPGGGPP 710 KK P PPPPPP KK P P K P PP PP Sbjct: 2450 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2494 Score = 36.3 bits (80), Expect = 0.91 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKK---KKXXXXPXXPXXXKXXPXPPGGGPP 710 KK P PPPPPP KK P P K P PP PP Sbjct: 2368 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPP 2413 Score = 36.3 bits (80), Expect = 0.91 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKK---KKXXXXPXXPXXXKXXPXPPGGGPP 710 KK P PPPPPP KK P P K P PP PP Sbjct: 2417 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPPPPPPP 2462 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKK---KXXXXPXXPXXXKXXPXPPGGGPP 710 KK P PPPPPP KK P P K P PP PP Sbjct: 2384 KKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2429 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKK---KXXXXPXXPXXXKXXPXPPGGGPP 710 KK P PPPPPP KK P P K P PP PP Sbjct: 2433 KKVDPPPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2478 Score = 35.5 bits (78), Expect = 1.6 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPP 695 KK P PPPPPP KK P P K PP Sbjct: 2466 KKVDPPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPP 2503 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP KK P P K PP PP Sbjct: 2325 PPPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPPPPPP 2363 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 KK P PPPPP P P K P PP PP Sbjct: 2338 KKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPPPPPPP 2380 Score = 33.9 bits (74), Expect = 4.9 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P KK PP K PPP PPPP PPPPP Sbjct: 2440 PPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPP-------PPPPPPPKVKKVDPPPPPPP 2492 Query: 377 XXXGGGXXPPP 409 PPP Sbjct: 2493 PPKVKKVDPPP 2503 >UniRef50_A4T9C9 Cluster: Integral membrane protein-like protein; n=1; Mycobacterium gilvum PYR-GCK|Rep: Integral membrane protein-like protein - Mycobacterium gilvum PYR-GCK Length = 335 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/42 (50%), Positives = 22/42 (52%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP +GG PPPPP PPPPP GG PPPP Sbjct: 11 PPP-----PQGGYPPPPPSEGGYPPPPPE-----GGYPPPPP 42 Score = 39.9 bits (89), Expect = 0.074 Identities = 27/71 (38%), Positives = 29/71 (40%), Gaps = 9/71 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP----PXXXXXGGGXXPP-----PPPPXXFFFXP 439 PPP +GG PPPPP PPP P GG PP PPPP + P Sbjct: 30 PPP-----PEGGYPPPPPAGGYQQPPPGGAYPPPPGPGGYPPPPGQGGYPPPPGGYGMPP 84 Query: 440 XXXXXGGGXXP 472 GGG P Sbjct: 85 --AGFGGGYPP 93 Score = 35.9 bits (79), Expect = 1.2 Identities = 26/66 (39%), Positives = 28/66 (42%), Gaps = 4/66 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPX-XXXXPPPPP---XXXXXGGGXXPPPPPPXXFFFXPXXXXX 454 PPP +GG PPPPP PPPPP GG PPPP P + P Sbjct: 21 PPP-----SEGGYPPPPPEG--GYPPPPPAGGYQQPPPGGAYPPPPGPGGY---PPPPGQ 70 Query: 455 GGGXXP 472 GG P Sbjct: 71 GGYPPP 76 Score = 34.7 bits (76), Expect = 2.8 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 GG PPPP PPPPP GG PPPP Sbjct: 8 GGYPPPP--QGGYPPPPPSE----GGYPPPPP 33 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPP P + + P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 40.3 bits (90), Expect = 0.056 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 G PP PP PPPPP PPPPPP + P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP 413 Score = 40.3 bits (90), Expect = 0.056 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPP PP + P Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 39.9 bits (89), Expect = 0.074 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP PPPPP P PPP PPPPPP + Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVY 434 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP P PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 34.3 bits (75), Expect = 3.7 Identities = 23/79 (29%), Positives = 26/79 (32%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP + PPPPP PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYV---YPPPPPPYVYPPPPSPPY 442 Query: 377 XXXGGGXXPPPPPPXXFFF 433 PPPP P + + Sbjct: 443 V-----YPPPPPSPQPYMY 456 >UniRef50_A2F9Y4 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 214 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPP--PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP + G PPPP PPPPP G PPPPPP Sbjct: 93 PPSSAPSPQAGVPPPPAADGAPAPPPPPPPPGAGADGQAPPPPPP 137 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 42.7 bits (96), Expect = 0.011 Identities = 22/73 (30%), Positives = 24/73 (32%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP+ P G PP + PP PPPPP PPPP Sbjct: 409 PPKAP--GPAPPLPPASSRPPPMLPTRSPAPPQAPPLPTSNAPPPPPLPATQAPPPPPLP 466 Query: 380 XXGGGXXPPPPPP 418 PPP PP Sbjct: 467 ATSAPPPPPPAPP 479 Score = 41.9 bits (94), Expect = 0.018 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPP PPPPP GG PPPPPP Sbjct: 495 PPPMPPMPAPSGGAPPPP-----PPPPPGGM---GGVPPPPPPP 530 Score = 38.7 bits (86), Expect = 0.17 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP-PXXXXXGGGXXPPPPPP 418 PPP PP P PPPP P GG PPPPPP Sbjct: 471 PPPPPPAPPAPPAPPLPAAHAPPPPPPMPPMPAPSGGAPPPPPPP 515 Score = 37.5 bits (83), Expect = 0.40 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP GG PPPP P Sbjct: 513 PPPPPGGMGGVPPPPPPPPPGG--MPPPPAP 541 Score = 36.7 bits (81), Expect = 0.69 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPF + PPPPP PPPPP PP P Sbjct: 374 PPPFTG---QRSVPPPPPSRSSVPPPPPPRNSAAQPPLPPKAP 413 Score = 34.3 bits (75), Expect = 3.7 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP P P PPPPP PP P Sbjct: 450 PPPPLPATQAPPP-PPLPATSAPPPPPPAPPAPPAPPLPAAHAPPPPPP---MPPMP--- 502 Query: 377 XXXGGGXXPPPPPP 418 GG PPPPPP Sbjct: 503 APSGGAPPPPPPPP 516 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 99 PPPPPPPPPPPPPPPAPTTTQAPQYPPPPPP 129 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 100 PPPPPPPPPPPPPPAPTTTQAPQYPPPPPPP 130 Score = 38.3 bits (85), Expect = 0.23 Identities = 23/74 (31%), Positives = 25/74 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P P ++ PPP K PPPPP PPPP Sbjct: 100 PPPPPPPPPPPPPPAPTTTQAPQYPPPPPPPPPPAPTTSKAAPPPPPP--PPPPPPPAPP 157 Query: 377 XXXGGGXXPPPPPP 418 PPP PP Sbjct: 158 APKPSKPAPPPQPP 171 >UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 305 Score = 42.7 bits (96), Expect = 0.011 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G G PPPPPP Sbjct: 74 PPPPPGYGEPPPPPPP----GYGEQPPPPPP 100 Score = 40.3 bits (90), Expect = 0.056 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 85 PPPPPGYGEQPPPPP----PGYAAEPPPPPP 111 Score = 34.3 bits (75), Expect = 3.7 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP--PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + G PPP P PPPPP G PPPPPP Sbjct: 84 PPPPPPGY---GEQPPPPPPGYAAEPPPPPP------GMQPPPPPP 120 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 42.7 bits (96), Expect = 0.011 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPPPP P Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPSLLPP 93 Score = 42.3 bits (95), Expect = 0.014 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 F PPPPP PPPPP PPPPPP Sbjct: 52 FMASPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 >UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14; Mammalia|Rep: Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 502 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPP-PPXXXXXGGGXXPPPPPP 418 PPP +GG PPPPP P PP GG PPPPPP Sbjct: 360 PPP-----GRGGPPPPPPPATGRSGPLPPPPPGAGGPPMPPPPPP 399 Score = 42.7 bits (96), Expect = 0.011 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP-----PPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP P PPPP G G PPP PP Sbjct: 369 PPPPPATGRSGPLPPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPP 417 Score = 39.9 bits (89), Expect = 0.074 Identities = 23/73 (31%), Positives = 24/73 (32%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G + P K P P PPP PPPPP Sbjct: 314 PPPPPPSRGGNQLPRPPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPPP 373 Query: 377 XXXGGGXXPPPPP 415 G PPPPP Sbjct: 374 ATGRSGPLPPPPP 386 Score = 38.3 bits (85), Expect = 0.23 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP + G PP P PPP P G PPPPPP Sbjct: 329 PPIVGGNKGRSGPLPPVPLGIAPPPPTPRGPPPPGRGGPPPPPP 372 >UniRef50_Q9JL04 Cluster: Formin-2; n=4; Murinae|Rep: Formin-2 - Mus musculus (Mouse) Length = 1567 Score = 42.7 bits (96), Expect = 0.011 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 932 IPPPPPLPGMGIPP--PPPLPGVGI-----PPPPPLPGV----GIPPPPPLPGVGIPPPP 980 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 981 PLPGVG---IPPPPPLPGVGIPPPPPLPGVGIPP 1011 Score = 41.9 bits (94), Expect = 0.018 Identities = 23/62 (37%), Positives = 23/62 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP G PPPPP PPPP G PPPPP P G G Sbjct: 909 PPPPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMG---IPPPPPLPGVGIPPPPPLPGVGI 965 Query: 467 XP 472 P Sbjct: 966 PP 967 Score = 41.9 bits (94), Expect = 0.018 Identities = 31/92 (33%), Positives = 31/92 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P G PP G PPP G PPPPP PPPP Sbjct: 910 PPPAPPLPGMGIPPPPPLPGMGI-----PPPPPLPGM----GIPPPPPLPGVGIPPPPPL 960 Query: 377 XXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 961 PGVG---IPPPPPLPGVGIPPPPPLPGVGIPP 989 Score = 41.9 bits (94), Expect = 0.018 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 954 IPPPPPLPGVGIPP--PPPLPGVGI-----PPPPPLPGV----GIPPPPPLPGVGIPPPP 1002 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP P G G P Sbjct: 1003 PLPGVG---IPPPPPLPGVGIPPPPPLPGMGIPP 1033 Score = 41.5 bits (93), Expect = 0.024 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 998 IPPPPPLPGVGIPP--PPPLPGVGI-----PPPPPLPGM----GIPPPPPLPGSGIPPPP 1046 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPP P P G G P Sbjct: 1047 ALP--GVAIPPPPPLPGMGVPPPAPPPPGAGIPP 1078 Score = 41.5 bits (93), Expect = 0.024 Identities = 31/91 (34%), Positives = 32/91 (35%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPP PPPP Sbjct: 1009 IPPPPPLPGVGIPP--PPPLPGMG-------IPPP--PPLPGSGIPPPPALPGVAIPPPP 1057 Query: 371 XXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 G G PP PPP P G G Sbjct: 1058 --PLPGMGVPPPAPPPPGAGIPPPPLLPGSG 1086 Score = 40.7 bits (91), Expect = 0.042 Identities = 29/76 (38%), Positives = 30/76 (39%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 I PPP +P G PP G PPP G PPPPP PPPP Sbjct: 976 IPPPPPLPGVGIPP--PPPLPGVGI-----PPPPPLPGV----GIPPPPPLPGVGIPPPP 1024 Query: 371 XXXXXGGGXXPPPPPP 418 G G PPPP P Sbjct: 1025 --PLPGMGIPPPPPLP 1038 Score = 37.9 bits (84), Expect = 0.30 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 P PPP PPPP G PPPPP P G G P Sbjct: 897 PQPPPLPGLGVPPPPPAPPLPGMGIPPPPPLPGMGIPPPPPLPGMGIPP 945 Score = 35.9 bits (79), Expect = 1.2 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP P PP PPPPP G PPPPP P G G Sbjct: 899 PPPLPGLGVPPPPPAPPLPGMGIPPPPPLP----GMGIPPPPPLPGMGIPPPPPLPGVGI 954 Query: 467 XP 472 P Sbjct: 955 PP 956 Score = 33.5 bits (73), Expect = 6.4 Identities = 27/89 (30%), Positives = 28/89 (31%), Gaps = 6/89 (6%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP-- 364 I PPP +P G PP G PPP PPPP PPP Sbjct: 1031 IPPPPPLPGSGI----PPPPALPGV----AIPPPPPLPGMGVPPPAPPPPGAGIPPPPLL 1082 Query: 365 ----PPXXXXXGGGXXPPPPPPXXFFFXP 439 PP G P P F F P Sbjct: 1083 PGSGPPHSSQVGSSTLPAAPQGCGFLFPP 1111 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 42.7 bits (96), Expect = 0.011 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Frame = +2 Query: 317 GGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 GG PPPPP PPPPP G PPPPPP Sbjct: 585 GGPPPPPPPPPPITGSCPPPPPPPLPPPATGSCPPPPPP 623 Score = 39.9 bits (89), Expect = 0.074 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPP-PPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PP PPP PPPPP G PPPPP Sbjct: 594 PPPITGSCPPPPPPPLPPPATGSCPPPPPPPPPPIIGSCPPPPP 637 Score = 39.5 bits (88), Expect = 0.098 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXX---GGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 592 PPPPPITGSCPPPPPPPLPPPATGSCPPPPPPPP 625 Score = 37.1 bits (82), Expect = 0.52 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PP PP PPPPPP Sbjct: 589 PPPPPPPPITGSCPPPPP-----PPLPPPATGSCPPPPPPPPPP 627 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPP 97 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 42.7 bits (96), Expect = 0.011 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 Score = 37.1 bits (82), Expect = 0.52 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 G PPP P PPPPP PPPPP Sbjct: 57 GVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPP 88 >UniRef50_Q9GYL4 Cluster: Putative uncharacterized protein R04E5.8; n=2; Caenorhabditis elegans|Rep: Putative uncharacterized protein R04E5.8 - Caenorhabditis elegans Length = 997 Score = 37.1 bits (82), Expect = 0.52 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPPP GG PPPPPP Sbjct: 123 PPPPPPRKSRAGGSSPPPPPP 143 Score = 37.1 bits (82), Expect(2) = 0.012 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPPP GG PPPPPP Sbjct: 124 PPPPPRKSRAGGSSPPPPPPP 144 Score = 24.6 bits (51), Expect(2) = 0.012 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPP 367 GG PPP P PPP Sbjct: 67 GGYPPPYPYQHPHQPPP 83 >UniRef50_UPI00015B55AC Cluster: PREDICTED: similar to GA10757-PA; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to GA10757-PA - Nasonia vitripennis Length = 1350 Score = 42.3 bits (95), Expect = 0.014 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP-------XXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPPP GGG PPPP Sbjct: 1177 PPPSYLYGPPGSFPPPPPPGSFLPPPPPPPELVGSRPPPLGGGRLSSPPPP 1227 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 42.3 bits (95), Expect = 0.014 Identities = 29/79 (36%), Positives = 30/79 (37%), Gaps = 5/79 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXK-----GGXPPPPPXXXXXPP 361 PPPQ+P PP PPP F G PPPPP PP Sbjct: 911 PPPQLP------PPPPLSGMTPPKPTGVIPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPP 964 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP G PPPPPP Sbjct: 965 PPPPLP----GMAPPPPPP 979 Score = 39.9 bits (89), Expect = 0.074 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP G PPPPP PPPP G PPPPPP P G G Sbjct: 955 PPPLP-----GMVPPPPPPLPGMAPPPPPPFP--GMTPPPPPPPPGCGPPPPPLPPGIGP 1007 Query: 467 XP 472 P Sbjct: 1008 PP 1009 Score = 35.5 bits (78), Expect = 1.6 Identities = 27/80 (33%), Positives = 29/80 (36%), Gaps = 4/80 (5%) Frame = +2 Query: 191 ITPPPQIPFWGXKK----KCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP 358 I PPP +P + K PP G PPP PP P P Sbjct: 933 IPPPPPLPGFVPPPPVVGKAPPPPPLPGMVPP----PPPPLPGMAPPPPPPFPGMTPPPP 988 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 PPPP G G PPP PP Sbjct: 989 PPPP-----GCGPPPPPLPP 1003 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 42.3 bits (95), Expect = 0.014 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 +G PPPPP PPPPP PPPPP Sbjct: 171 RGASPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPP 205 Score = 41.5 bits (93), Expect = 0.024 Identities = 24/81 (29%), Positives = 27/81 (33%), Gaps = 2/81 (2%) Frame = +2 Query: 182 LKKITPPP--QIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX 355 L +TP P + W +C P PPP PPP P Sbjct: 146 LASLTPSPVWSVALWDTAHQCCPVTRGASP----PPPPPPSPPPPPPPSPPPPSPPPPSP 201 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP P Sbjct: 202 PPPPPPSPPPPPPPSPPPPSP 222 Score = 39.1 bits (87), Expect = 0.13 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PPP P PPPP Sbjct: 197 PPPSPPPPPPPSPPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240 Score = 37.9 bits (84), Expect = 0.30 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPP P PPPPP Sbjct: 187 PPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPPPSPP--PPSPPPPSPPPPSPPPPPPPS 244 Query: 377 XXXGGGXXPPPPPP 418 P PPPP Sbjct: 245 PPPPSPPPPSPPPP 258 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 181 PSPPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPPSPPP 219 >UniRef50_Q01HL2 Cluster: H0211F06-OSIGBa0153M17.6 protein; n=12; Magnoliophyta|Rep: H0211F06-OSIGBa0153M17.6 protein - Oryza sativa (Rice) Length = 1510 Score = 42.3 bits (95), Expect = 0.014 Identities = 42/149 (28%), Positives = 45/149 (30%), Gaps = 14/149 (9%) Frame = +2 Query: 314 KGGXPP-PPPXXXXX-----PPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGG-GXXP 472 +GG PP PPP PPPP G G PPPPPP P GG G Sbjct: 1078 QGGIPPLPPPLPPTLGDYGVAPPPPSI---GAGAPPPPPPPGGITGVPPPPPIGGLGGHQ 1134 Query: 473 LXXXKKXXXGVGXXXXXFFFFXXLGG-------GGXKXXXXFXKKKXXXRAPPPPPXXXX 631 G+G LGG G + PPPPP Sbjct: 1135 APPAPPLPEGIGGVPPP-PPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHG 1193 Query: 632 KKKXXPXPXXXPXXKXXTXXPXGGPPXXG 718 P P P P G PP G Sbjct: 1194 GVGGPPTPPGAPTPPMPPGVPGGPPPPPG 1222 Score = 40.3 bits (90), Expect = 0.056 Identities = 32/107 (29%), Positives = 34/107 (31%), Gaps = 1/107 (0%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-PXXXXXPPPP 367 + PPP G PP G PPP P PP P PPP Sbjct: 1097 VAPPPPSIGAGAPPPPPPPGGITGV-----PPPPPIGGLGGHQAPPAPPLPEGIGGVPPP 1151 Query: 368 PXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPLXXXKKXXXGVG 508 P GG P PPPP F GG P + GVG Sbjct: 1152 PPVGGLGG--PPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVG 1196 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 42.3 bits (95), Expect = 0.014 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 KGG PPPPP PPP PPPPPP Sbjct: 522 KGGVPPPPPPPPPPKAPPPKGPPPKVAPPPPPPPP 556 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPP----PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP P PPPPP G PPPPP Sbjct: 371 PPPPGGLRPPGKAPPPPPPPPPMFAGKMKAPPPPP 405 Score = 35.5 bits (78), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 338 PXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 P PPPPP G PPPPPP F Sbjct: 364 PSGLPPPPPPPGGLRPPGKAPPPPPPPPPMF 394 Score = 33.1 bits (72), Expect = 8.5 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 G PPPPP PP G PPPPPP F Sbjct: 366 GLPPPPPPPGGLRPP-------GKAPPPPPPPPPMF 394 >UniRef50_Q7S8Q9 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 719 Score = 42.3 bits (95), Expect = 0.014 Identities = 23/67 (34%), Positives = 26/67 (38%), Gaps = 5/67 (7%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGG-----GGXPPXKK 307 G PPP G + GGGGG PPP G G G GG PP ++ Sbjct: 636 GPPPPPFGRSRGGDRYLPGGGGGRDEPPPRRGGGGSGDEPRSRFDGAPLPTFGGGPPRRR 695 Query: 306 XXKKGGG 286 GGG Sbjct: 696 RRGHGGG 702 Score = 34.7 bits (76), Expect = 2.8 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = -1 Query: 459 PPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 PP + GG GG PPP GG GGGG P + G G Sbjct: 615 PPHREAERRRGRMGGGDGGRSGPPPPPFGRSRGGDRYLPGGGGGRDEPPPRRGGGGSG 672 >UniRef50_Q6FSY6 Cluster: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c; n=1; Candida glabrata|Rep: Similar to sp|P47068 Saccharomyces cerevisiae YJL020c - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1039 Score = 42.3 bits (95), Expect = 0.014 Identities = 25/79 (31%), Positives = 27/79 (34%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP 361 +K PPP P + P PPP G PPPPP P Sbjct: 635 MKSAPPPP--PMMSERSVEPQGDRSIPPVPMSGIPPPPSDHSGPHGAPPPPPPPTHTAHP 692 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP PPPPPP Sbjct: 693 PPPPPTH---AAHPPPPPP 708 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPPP G PP PP Sbjct: 680 PPPPPPPTHTAHPPPPPPTHAAHPPPPPPTAGHDGQAPPPLPP 722 >UniRef50_A4RD40 Cluster: Putative uncharacterized protein; n=2; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 512 Score = 42.3 bits (95), Expect = 0.014 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP GG PPPP Sbjct: 480 PPPPPPSAAPPPPPPGPPGASGGYSAVPPPP 510 Score = 37.5 bits (83), Expect = 0.40 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 470 PPPPPSDAAPPPPPPP------SAAPPPPPP 494 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 206 PPPPPPPPLPPPPPPPPPPSPPPPSPPPPPP 236 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 207 PPPPPPPLPPPPPPPPPPSPPPPSPPPPPPP 237 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP PPPPPP Sbjct: 207 PPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPP 250 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPP Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPP 235 Score = 37.9 bits (84), Expect = 0.30 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPP PPPP PPPPPP Sbjct: 216 PPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPPP 259 Score = 37.9 bits (84), Expect = 0.30 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP PPPP PPPP Sbjct: 2702 SPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPL 2761 Query: 374 XXXXGGGXXPPPPPP 418 PPPP P Sbjct: 2762 PPAPSPPPSPPPPSP 2776 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPPPP PPPP P Sbjct: 209 PPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSP 252 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP PP PPPPP PPP PP Sbjct: 210 PPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPP 253 Score = 36.7 bits (81), Expect = 0.69 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPP P PP PPP Sbjct: 2681 PPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPP 2724 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PP PPP Sbjct: 2670 PPPPPSPPPSPPPPSPPPSPPPSPPPPSPPP 2700 Score = 36.3 bits (80), Expect = 0.91 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP P PPP P PPP Sbjct: 2712 SPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPP-PSPPPPSPPPPLPPAPSPPPS 2770 Query: 374 XXXXGGGXXPPPPPP 418 PPPP P Sbjct: 2771 PPPPSPPPSPPPPSP 2785 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPP P PP PPP Sbjct: 2533 PPPSPPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPP 2576 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PP PP PP PPP Sbjct: 2672 PPPSPPPSPPPPSPPPSPPPSPPPPSPPPPSPPPPSPPPPSPPP 2715 Score = 35.5 bits (78), Expect = 1.6 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP---PPPXXXXXGGGXXPPPPPP 418 PPP P PPP PP PPP PPPPPP Sbjct: 211 PPPLPPPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 35.5 bits (78), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP P PPPP Sbjct: 1175 PPPPPSPPPPSPPPPPSPPPPSPPPPLPPPP 1205 Score = 35.5 bits (78), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPPP PPPPPP Sbjct: 1182 PPPSPPPPPSPPPPSPPPPLPPPPSPPPPPP 1212 Score = 35.5 bits (78), Expect = 1.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPP PPPP Sbjct: 2273 PPPSPPPPTPPPSPPPPPPTPPPSPPPPSPPPPSPPPPSPPPP 2315 Score = 35.5 bits (78), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP PPPP P Sbjct: 2277 PPPPTPPPSPPPPPPTPPPSPPPPSPPPPSP 2307 Score = 35.5 bits (78), Expect = 1.6 Identities = 22/74 (29%), Positives = 22/74 (29%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PPPP PPPP Sbjct: 2681 PPPSPP--PSPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPPSPPPPSPPPPSPPPPSPP 2738 Query: 377 XXXGGGXXPPPPPP 418 PPPP P Sbjct: 2739 PPSPPPPSPPPPSP 2752 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP PPPP PP PPP Sbjct: 2537 PPPSPPPSPPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPP 2580 Score = 33.9 bits (74), Expect = 4.9 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 + + PP PP PP PP PP PPP Sbjct: 2248 YNENSPPPSPPPPSPHPPSPPPPSPPPPSPPPPTPPP 2284 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPP P PPP P PPPP Sbjct: 2257 PPPPSPHPPSPPPPSPPPPSPPPPTPPPSPPPPPPTPPPSPPPP 2300 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 216 PPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPPPSPPP 254 Score = 33.5 bits (73), Expect = 6.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPP P PPP PPPP PPP PP F Sbjct: 2545 PPPPLPPPPSPPPPSPPPPSPPPSPPPPSPPPSPPPPSPPPYPPCHEF 2592 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 203 PSPPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPPPSPPP 241 Score = 33.1 bits (72), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PP PP PP PPP Sbjct: 2532 PPPPSPPPSPPPSPPPPLPPPPSPPPPSPPP 2562 Score = 33.1 bits (72), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP P PPP PPPP P Sbjct: 2668 PSPPPPPSPPPSPPPPSPPPSPPPSPPPPSP 2698 Score = 33.1 bits (72), Expect = 8.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPP P P PPPP Sbjct: 2671 PPPPSPPPSPPPPSPPPSPPPSPPPPSPPPP 2701 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 40.7 bits (91), Expect = 0.042 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPP PPPPP PPPPPP F Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPAF 338 Score = 39.1 bits (87), Expect = 0.13 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPPPP PPPPP PPPPPP F Sbjct: 307 PPPPPPPPPPPPPPPPPPPP---PPPPPPPPPPAF 338 >UniRef50_Q6ML35 Cluster: Putative uncharacterized protein; n=1; Bdellovibrio bacteriovorus|Rep: Putative uncharacterized protein - Bdellovibrio bacteriovorus Length = 265 Score = 41.9 bits (94), Expect = 0.018 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXX-----PPPPPPXXF 427 G PPPPP PPPPP GGG PPPPPP F Sbjct: 222 GDIPPPPPP----PPPPPFGDDFGGGFGGDSDFPPPPPPPPF 259 >UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region; n=1; Caulobacter sp. K31|Rep: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region - Caulobacter sp. K31 Length = 608 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 41.9 bits (94), Expect = 0.018 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + PPPPP PPPPP PPPPPP Sbjct: 992 PPPPPPPAARPAPPPPPPVVRPPPPPPP-----AARPAPPPPPP 1030 Score = 39.1 bits (87), Expect = 0.13 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPPP PPPPP Sbjct: 1015 PPPPPAARPAPPPPPPVVRPPPPPPPPPPP 1044 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP P PPP PPPPPP Sbjct: 1013 PPPPPPPAARPAPPPPPPVVRPPPPPPPPPP 1043 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 1014 PPPPPPAARPAPPPPPPVVRPPPPPPPPPPP 1044 Score = 37.9 bits (84), Expect = 0.30 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 963 PPPPPVVRQAPPPPP-----AARPAPPPPPP 988 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + PPPP PPPPP PPPPPP Sbjct: 963 PPP--PPVVRQAPPPPPAARPAPPPPPPVV------RPPPPPPP 998 Score = 34.3 bits (75), Expect = 3.7 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP P PPPP Sbjct: 933 PPPPPVVRPPPPPPPP------AAHPAPPPP 957 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 488 PPPPPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 489 PPPPPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 40.3 bits (90), Expect = 0.056 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPPP PPPPP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 40.3 bits (90), Expect = 0.056 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 493 PPPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP---PPPPPPPP 533 Score = 40.3 bits (90), Expect = 0.056 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP---PPPPPPPP 534 Score = 39.9 bits (89), Expect = 0.074 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 GG PPPP PPPPP PP PPP Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPP 515 Score = 39.5 bits (88), Expect = 0.098 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP P PPPP Sbjct: 483 GVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPP 516 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPP 520 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP P PPPPPP Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PP PP PPPPPP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPP Sbjct: 487 PPPPPPPPPPPPPPPPPSPPPPPPPSPPPPP 517 Score = 37.5 bits (83), Expect = 0.40 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 F + G PPP PPPPP PPP PP Sbjct: 478 FLRSGGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPP 514 Score = 33.5 bits (73), Expect = 6.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPPXXG 719 P PPPPPP P P P PP PP G Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPG 535 >UniRef50_Q6XJQ7 Cluster: FCA protein; n=86; BEP clade|Rep: FCA protein - Triticum aestivum (Wheat) Length = 743 Score = 41.9 bits (94), Expect = 0.018 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXP--PPXXXXXGGGGGXXFXXGGGGG 325 G PPP G GGGGG P P GGGG + GGGGG Sbjct: 40 GGSPPPHRSSRGGSSDGGGGGGGRFHPYRAPSEYVVGGGGTGGYRGGGGGG 90 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPP 271 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPP 277 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 249 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 39.9 bits (89), Expect = 0.074 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP + PP PP PPPPP PPPPPP Sbjct: 231 PPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPPPPPP 274 Score = 39.1 bits (87), Expect = 0.13 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP PPPPP PPPPPP Sbjct: 245 PMPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 275 Score = 36.3 bits (80), Expect = 0.91 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP P PPPPP PPPPPP Sbjct: 218 PPSSPPPPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPP 261 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P P P PPPPP PPP PP Sbjct: 224 PPPSASSPPSSPSPSPRPPPPPMPPPPPPPPPPPPPPPPPPSPP 267 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 41.9 bits (94), Expect = 0.018 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP PP PPPPP PPPPPP Sbjct: 205 PPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPP 248 Score = 41.9 bits (94), Expect = 0.018 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP P PPPP Sbjct: 217 PPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 41.5 bits (93), Expect = 0.024 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPP--PPPPXXFFFXP 439 PPP PPPPP PPPPP PP P PP F F P Sbjct: 228 PPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPPLPPPSIPSPPFAFGFRP 280 Score = 38.3 bits (85), Expect = 0.23 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP PPPPP PPP PP Sbjct: 209 PPPPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPP 252 Score = 34.7 bits (76), Expect = 2.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP PP PPPP P PPPP Sbjct: 211 PPPSPSPPPSPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 33.1 bits (72), Expect = 8.5 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 225 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPP 263 >UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=1; Arabidopsis thaliana|Rep: Uncharacterized protein At1g54215.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 169 Score = 41.9 bits (94), Expect = 0.018 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKP 87 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPP---------PPPPPP 63 Score = 33.5 bits (73), Expect = 6.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 335 PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP PPPPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPP 62 >UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliophyta|Rep: Cell wall protein like - Arabidopsis thaliana (Mouse-ear cress) Length = 428 Score = 41.9 bits (94), Expect = 0.018 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P K PP K PPP+ PPPP PPPP Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPY 136 Query: 377 XXXGGGXXPPPPP 415 PPPPP Sbjct: 137 TPPPPTVKPPPPP 149 Score = 39.1 bits (87), Expect = 0.13 Identities = 28/77 (36%), Positives = 30/77 (38%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP IP CPP K K PPP+ PPPPP PPPPP Sbjct: 69 PPPYIP-------CPPPPYTP-KPPTVKPPPPPYVK-------PPPPPT--VKPPPPPYV 111 Query: 377 XXXGGGXXPPPPPPXXF 427 PPPPP + Sbjct: 112 KPPPPPTVKPPPPPTPY 128 >UniRef50_Q8MQE6 Cluster: Wasp (Actin cytoskeleton modulator) homolog protein 1, isoform b; n=3; Caenorhabditis|Rep: Wasp (Actin cytoskeleton modulator) homolog protein 1, isoform b - Caenorhabditis elegans Length = 781 Score = 41.9 bits (94), Expect = 0.018 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPP--FXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP F PPPPP PPPP G G PPPPPP Sbjct: 615 PPPQSFGMAPISSAAPPPPP-----PPPPMGLPAVGAGAPPPPPPP 655 >UniRef50_Q54CQ8 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 910 Score = 41.9 bits (94), Expect = 0.018 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 F G PPPPP PPPPP G PPPPP F Sbjct: 715 FNSGFAPPPPPMMSSGPPPPPGSSF---GAPPPPPPGGAF 751 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 41.9 bits (94), Expect = 0.018 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPPP G G PPPPP Sbjct: 664 PPPPPPPPPPPPPPPPPPRMGNG--PPPPP 691 Score = 37.5 bits (83), Expect = 0.40 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG---GGXXPPPPPP 418 PPP P PP PPPPP G PPPPPP Sbjct: 586 PPPASSATAPTAVGPAPPPGLPPPPPPPGYKAGGSASSAPLPPPPPP 632 Score = 37.1 bits (82), Expect = 0.52 Identities = 24/74 (32%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP + G PPP G PP P PP Sbjct: 602 PPPGLP----PPPPPPGYKAGGSASSAPLPPPPPPPG---GSGVSSPPAGLPPPHPPGLP 654 Query: 377 XXXGGGXXPPPPPP 418 GG PPPPPP Sbjct: 655 PPTGGPKQPPPPPP 668 Score = 34.7 bits (76), Expect = 2.8 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXK--GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PP G PPP GG PPP PPPPP PPPP Sbjct: 630 PPPPGGSGVSSPPAGLPPPHPPGLPPPTGGPKQPPPPPPPPPPPPP----------PPPP 679 Query: 413 PP 418 PP Sbjct: 680 PP 681 Score = 33.1 bits (72), Expect = 8.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG 388 K PPP PPPPP PPPPP G Sbjct: 661 KQPPPPPPPPPPPPPPPPPPPRMGNGPPPPPGKGASG 697 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPP Sbjct: 475 PPPPPGKNAPPPPPPPPPPPPHGKKAPPPPP 505 Score = 41.5 bits (93), Expect = 0.024 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP G PPPPPP Sbjct: 476 PPPPGKNAPPPPPPPPPPPPHGKKAPPPPPP 506 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPPP Sbjct: 466 PPPRTPPPPPPPPPGKNAPPPPPPPPPPP 494 Score = 33.9 bits (74), Expect = 4.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P PPPPP PPPPPP Sbjct: 462 PSSSPPPRTPPPPPPPPPGKNAPPPPPPPPP 492 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 41.9 bits (94), Expect = 0.018 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP KG PPPPP PPPPP G PPPP Sbjct: 367 PPPPPPPPPKGAPPPPPP----PPPPPPPPGPPPPGQLPPPP 404 Score = 39.5 bits (88), Expect = 0.098 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 353 PPPQQQQNKSAPPPPPPP-----PPPPPKGAPPPPPPPPPPPPP 391 Score = 39.1 bits (87), Expect = 0.13 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPP---PPPP 418 PPPPP PPPPP G PP PPPP Sbjct: 371 PPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPPPP 404 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 585 KXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 K P PPPPPP K P P P PPG PP Sbjct: 361 KSAPPPPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPPGQLPP 402 Score = 36.7 bits (81), Expect = 0.69 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 369 PPPPPPPKGAPPPPPP-------PPPPPPPP 392 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 43 PPPPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 42 PPPPPPPPPASPPPPPPPPPPPPPPPPPPPP 72 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPP P Sbjct: 45 PPPPPPASPPPPPPPPPPPPPPPPPPPPPEP 75 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP P PPPP Sbjct: 54 PPPPPPPPPPPPPPPPPPPPEPEPQPAPPPP 84 Score = 38.7 bits (86), Expect = 0.17 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP PPPPP PPPPPP Sbjct: 1942 PPRPPTLAPPPPPPPPPPTEDPPPPPPPPP----AEAPPPPPP 1980 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPP P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEPEPQPAPPPPETP 87 Score = 37.1 bits (82), Expect = 0.52 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPP P Sbjct: 1952 PPPPPPPPTEDPPPPPPPPPAEAPPPPPPTP 1982 >UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 205 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 108 PPPPPTTVVPPPPPPPPPTHTTHPHPPPPPP 138 Score = 40.3 bits (90), Expect = 0.056 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 120 PPPPPPTHTTHPHPPPPP-----PPPPPASSTKSAEAPPPPPPP 158 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP PPPPPP Sbjct: 109 PPPPTTVVPPPPPPPPPTHTTHPHPPPPPPP 139 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPP Sbjct: 107 PPPPPPTTVVPPPPPPPPPTHTTHPHPPPPP 137 Score = 38.3 bits (85), Expect = 0.23 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP-----PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP P PPPPP PPPPPP Sbjct: 109 PPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPP 157 Score = 34.3 bits (75), Expect = 3.7 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP PP PPP PPPPP PPPPP Sbjct: 109 PPPPTTVVPPPPPPPPPTHTTHPHPPPPPPPPPPASSTKSAEAPPPPPPPPPPPPPPP 166 >UniRef50_Q1DS16 Cluster: Putative uncharacterized protein; n=1; Coccidioides immitis|Rep: Putative uncharacterized protein - Coccidioides immitis Length = 307 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 87 PPPPPTSTQAPPPPPPPPAETTTQAPPPPPP 117 Score = 35.9 bits (79), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P P PPPPP PPPPPP Sbjct: 74 PRPSPTSQAPPPPPPPPPTSTQAPPPPPPPP 104 Score = 33.1 bits (72), Expect = 8.5 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP---XXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP + PPPPP PPPPP PPPPP Sbjct: 86 PPPPPPTSTQAPPPPPPPPAETTTQAPPPPPPAETT--TQAPPPPP 129 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 290 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 41.9 bits (94), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 39.9 bits (89), Expect = 0.074 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP + PPPP PPPPP PPPPPP Sbjct: 241 PPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPPP 283 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPPPP PPPPPP Sbjct: 254 PPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP PPPPP PPPPPP Sbjct: 258 PSPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 288 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP P PPPPPP Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 38.7 bits (86), Expect = 0.17 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PP PP PPPPPP Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 37.9 bits (84), Expect = 0.30 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPP P PP PPP Sbjct: 270 PPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPP 313 Score = 37.5 bits (83), Expect = 0.40 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PP P P Sbjct: 265 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSP 308 Score = 36.7 bits (81), Expect = 0.69 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP P PPP PPPP PPPPPP Sbjct: 230 PPSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPP 272 Score = 35.9 bits (79), Expect = 1.2 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P + PPP P PPP P PPPPPP Sbjct: 231 PSPQPTASSRPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPPPP 274 Score = 34.7 bits (76), Expect = 2.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PP PPP PP Sbjct: 274 PPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSPP 317 Score = 34.3 bits (75), Expect = 3.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PP PPPP P Sbjct: 273 PPPPSPPPPPPPPPPPPPPPPPPSPSPPRKPPSPSPPVPPPPSP 316 Score = 33.9 bits (74), Expect = 4.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 >UniRef50_Q9Y4D1 Cluster: Disheveled-associated activator of morphogenesis 1; n=37; Amniota|Rep: Disheveled-associated activator of morphogenesis 1 - Homo sapiens (Human) Length = 1078 Score = 41.9 bits (94), Expect = 0.018 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXG 457 PPPPP PPPP GG PP PPP P G Sbjct: 552 PPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMG 595 Score = 39.9 bits (89), Expect = 0.074 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP PPPP G PPP P Sbjct: 550 PPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAP 593 Score = 34.3 bits (75), Expect = 3.7 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 GG P PPPPP GG PPPPPP Sbjct: 537 GGPFPSSVPGSLLPPPPPPPLP--GGMLPPPPPP 568 >UniRef50_Q7Z5R6 Cluster: Amyloid beta A4 precursor protein-binding family B member 1- interacting protein; n=34; Euteleostomi|Rep: Amyloid beta A4 precursor protein-binding family B member 1- interacting protein - Homo sapiens (Human) Length = 666 Score = 41.9 bits (94), Expect = 0.018 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP-----PPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PP PPP G PPPPPP Sbjct: 556 PPPPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPP 604 Score = 37.5 bits (83), Expect = 0.40 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPP----PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + PPP PP PPPP G PPPPPP Sbjct: 558 PPPPPLDDPELPPPPPDFMEPPPDFVPPPPPSYAGIAGSELPPPPPPP 605 >UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit; n=5; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to DNA-dependent protein kinase catalytic subunit - Strongylocentrotus purpuratus Length = 1729 Score = 41.5 bits (93), Expect = 0.024 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 1649 PPPPPPFGAAPPPPPPPC---GAPPPPPPPP 1676 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 1648 PPPPPPPFGAAPPPPPPPCGAPPPPPPPPPP 1678 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP F PPPPP PPPPP Sbjct: 1648 PPPPPPPFGAAPPPPPPPCGAPPPPPPP 1675 >UniRef50_UPI00004D7E7F Cluster: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV.; n=4; Xenopus tropicalis|Rep: CDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. - Xenopus tropicalis Length = 1182 Score = 41.5 bits (93), Expect = 0.024 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP F PPP P PPPPP G PPPPP F P Sbjct: 632 PPPLLPGFPSVPPPPPLPGSSSVPPPPP---LPGISSAPPPPPLPGFSSVP 679 Score = 40.7 bits (91), Expect = 0.042 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP PPPPP PPP PPPP P P GGG Sbjct: 645 PPPLPG---SSSVPPPPPLPGISSAPPPPPLPGFSSVPPPPPLPDLSSVPPPPPFPGGGP 701 Query: 467 XP 472 P Sbjct: 702 PP 703 Score = 40.7 bits (91), Expect = 0.042 Identities = 27/83 (32%), Positives = 29/83 (34%), Gaps = 3/83 (3%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP +P PP G PPP PPPP PPPPP Sbjct: 654 VPPPPPLP---GISSAPPPPPLPGF----SSVPPPPPLPDLSSVPPPPPFPGGGPPPPPP 706 Query: 371 XXXXXGGGXXPPP---PPPXXFF 430 G PPP P P FF Sbjct: 707 PFPGYGSSAVPPPLPLPLPGLFF 729 Score = 34.3 bits (75), Expect = 3.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP P PP G PPPPP Sbjct: 631 PPPPLLPGFPSVPPPPPLPGSSSVPPPPP 659 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 41.5 bits (93), Expect = 0.024 Identities = 24/79 (30%), Positives = 26/79 (32%), Gaps = 5/79 (6%) Frame = +2 Query: 197 PPPQIPFW---GXKKKCPPXXEXXGKFXX*KXXPPP--FXXXFXKGGXPPPPPXXXXXPP 361 PPP P+W PP + PPP P PPP P Sbjct: 147 PPPPPPWWQAPSASPSPPPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSP 206 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP PPPPPP Sbjct: 207 PPPSPPPPSPPPPPPPPPP 225 Score = 39.5 bits (88), Expect = 0.098 Identities = 22/74 (29%), Positives = 23/74 (31%), Gaps = 1/74 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCP-PXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 PPP P+W P P P P PP PP PPPPP Sbjct: 164 PPPPPPWWQAPSASPSPPPPSISPSPPSSASPTPPPPSASPSPPPPSPPPPSPPPPPPPP 223 Query: 374 XXXXGGGXXPPPPP 415 P PPP Sbjct: 224 PPPPPSPPSPNPPP 237 Score = 39.1 bits (87), Expect = 0.13 Identities = 19/52 (36%), Positives = 21/52 (40%), Gaps = 1/52 (1%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXP-PPPPPXXFFFXP 439 PPP PPPP PPPPP P PPPPP ++ P Sbjct: 123 PPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPPPPPPPWWQAP 174 Score = 37.5 bits (83), Expect = 0.40 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PP PP P PPPP Sbjct: 37 PPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSPPPP 80 Score = 37.1 bits (82), Expect = 0.52 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP PPPP P PPPP Sbjct: 59 PPPLPPPSPSPPSPPPPSPPPPSPPPPSPPSPPPSPPPPSPPPP 102 Score = 36.7 bits (81), Expect = 0.69 Identities = 23/75 (30%), Positives = 24/75 (32%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP P PPP PPPP Sbjct: 81 SPPPPSP--PSPPPSPPPPSPPPPSPPPPSPPPPSPPP--PSPPPSPPPSPSPPSPPPPS 136 Query: 374 XXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 137 PPPPSISPSPPPPPP 151 Score = 36.3 bits (80), Expect = 0.91 Identities = 25/87 (28%), Positives = 26/87 (29%) Frame = +2 Query: 158 SPXFXXXXLKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP 337 SP L +PPP P PP PPP PP P Sbjct: 36 SPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPP-PSPPPPSPPPPSPPSPPPSP 94 Query: 338 PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PP PP PP PPP Sbjct: 95 PPPSPPPPSPPPPSPPPPSPPPPSPPP 121 Score = 34.7 bits (76), Expect = 2.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP-PPPPXXXXXGGGXXPPPPPP 418 PPP PP PP P PPPP PPPP P Sbjct: 33 PPPSPPPLPPPLPPPSPPPPSPPPSPPPPLPPPSPSPPSPPPPSP 77 Score = 34.3 bits (75), Expect = 3.7 Identities = 22/82 (26%), Positives = 25/82 (30%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP P P PP PP P PPP Sbjct: 76 SPPPPSPPPPSPPSPPPSPPPPSPPPPSPPPPSPPPPSPPPPSPPPSPPPSPSPPSPPPP 135 Query: 374 XXXXGGGXXPPPPPPXXFFFXP 439 PPPPP ++ P Sbjct: 136 SPPPPSISPSPPPPPPPWWQAP 157 Score = 33.9 bits (74), Expect = 4.9 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPP-----PPXXXXXGGGXXPPPPPP 418 PPP PPPP PPP PP PPPPPP Sbjct: 212 PPPSPPPPPPPPPPPPPSPPSPNPPPSASPSPPFGRSLRSPPPPPPPPP 260 Score = 33.1 bits (72), Expect = 8.5 Identities = 23/79 (29%), Positives = 23/79 (29%), Gaps = 5/79 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX-----PP 361 PPP P PP P P PPPPP PP Sbjct: 105 PPPSPPPPSPPPPSPPPSPPPSPSPPSPPPPSPPPPSISPSPPPPPPPWWQAPSASPSPP 164 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP P PPPP Sbjct: 165 PPPPPWWQAPSASPSPPPP 183 >UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 1115 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP GG PPPPPP Sbjct: 563 PPPPPLPQNLSGAPPPPPPPPPMLGGPPPPPPPP 596 Score = 39.9 bits (89), Expect = 0.074 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPP G P P PPPPP G PPPPPP P GG Sbjct: 544 PPPIAGLLAANGTNVPIPP----PPPPPLPQNLSGAPPPPPPPPPMLGGPPPPPPPPGG 598 Score = 33.5 bits (73), Expect = 6.4 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGG---XXPPPPPP 418 P PPP PPPP G PPPPPP Sbjct: 533 PAPPPVSSIPPPPPIAGLLAANGTNVPIPPPPPP 566 >UniRef50_Q54BJ4 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 792 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = +2 Query: 320 GXPPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPPP G PPPPPP Sbjct: 356 GLPPPPPSLSSYGDLPPPPPPPSFTSFGDFPPPPPP 391 Score = 34.7 bits (76), Expect = 2.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP F G PPPP PPP PPPP P Sbjct: 372 PPPPPPSFTSFGDFPPPPPPSISDLPPPINFNTKPPTQPPPPIP 415 >UniRef50_O01864 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 988 Score = 41.5 bits (93), Expect = 0.024 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = +2 Query: 197 PPPQ-IPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 PPPQ IP G PP F PPPF PPPP PPP Sbjct: 727 PPPQGIPPMGFDPNKPPPPMFQQGFNA-GAPPPPFGRGAGPMSSFPPPPRGGMHHMPPPP 785 Query: 374 XXXXGGGXXPPPPPP 418 G G PPPP Sbjct: 786 SFRGGRGGHGGPPPP 800 Score = 34.7 bits (76), Expect = 2.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 G PP PP PPPP G PPPP Sbjct: 714 GYPPAPPPPGVGPPPPQGIPPMGFDPNKPPPP 745 Score = 34.7 bits (76), Expect = 2.8 Identities = 26/93 (27%), Positives = 28/93 (30%) Frame = -1 Query: 555 PPPPKXXKKKKXXXXXPTPXXXFXYXXRGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXX 376 PPPP+ P P G PPP G GG P Sbjct: 726 PPPPQGIPPMGFDPNKPPPPMFQQGFNAGAPPPPFGRGAGPMSSFPPPPRGGMHHMPPPP 785 Query: 375 XXGGGGGXXFXXGGGGGXPPXKKXXKKGGGXXF 277 GG GG GG PP + GGG F Sbjct: 786 SFRGG------RGGHGGPPPPHFDRRGGGGPPF 812 >UniRef50_A0CRC9 Cluster: Chromosome undetermined scaffold_25, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_25, whole genome shotgun sequence - Paramecium tetraurelia Length = 1300 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +2 Query: 314 KGGXPPPPPXXXX--XPPPPPXXXXXGGGXXPPPPPP 418 K PP PP PPPPP GG PPPPPP Sbjct: 774 KANPPPEPPTVKVAPPPPPPPPPSLKPGGPPPPPPPP 810 Score = 34.7 bits (76), Expect = 2.8 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXP--PPPPXXXXXGGGXXPPPPPPXXFFF 433 K PPP PPPPP P PPPP G P P F F Sbjct: 774 KANPPPEPPTVKVAPPPPPPPPPSLKPGGPPPPPPPPMKGAQQAPKPQDILFPF 827 >UniRef50_A0CFX0 Cluster: Chromosome undetermined scaffold_177, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_177, whole genome shotgun sequence - Paramecium tetraurelia Length = 1328 Score = 41.5 bits (93), Expect = 0.024 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP PP PP GG PPPPPP Sbjct: 806 PPPLGAKTGASSPAPPPPPGGPKPPGPPP-----GGAPPPPPPP 844 Score = 36.3 bits (80), Expect = 0.91 Identities = 23/75 (30%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = +2 Query: 182 LKKITPPPQIPFW-GXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP 358 + ++ PPP P PP K PPP G PP PP P Sbjct: 784 ISQVPPPPPPPGTISVSALAPPPPPLGAKTGASSPAPPPPPG----GPKPPGPPPGGAPP 839 Query: 359 PPPPXXXXXGGGXXP 403 PPPP GG P Sbjct: 840 PPPPPGPRPPGGPDP 854 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P GG PP PPP Sbjct: 791 PPPPGTISVSALAPPPPPLGAKTGASSPAPPPPPGGPKPPGPPP 834 >UniRef50_Q7SFQ1 Cluster: Predicted protein; n=1; Neurospora crassa|Rep: Predicted protein - Neurospora crassa Length = 283 Score = 41.5 bits (93), Expect = 0.024 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP----XXXXXGGGXXPPPPPP 418 PPPPP PPPPP GG PPPPPP Sbjct: 108 PPPPPASSGSPPPPPQSSVPPASSGGPSAPPPPPP 142 Score = 34.7 bits (76), Expect = 2.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 G PP PP PP PP G PPPPP Sbjct: 159 GAPPAPPASSGAPPAPP---ASSGSPSPPPPP 187 >UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1648 Score = 41.5 bits (93), Expect = 0.024 Identities = 32/81 (39%), Positives = 33/81 (40%), Gaps = 4/81 (4%) Frame = +2 Query: 188 KITPPPQIP-FWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP 364 K PPQ P F G PP G+ PP F G PPPPP PPP Sbjct: 971 KTNGPPQAPGFNGPPPPPPPPPPMPGQ------GPPGF------NGPPPPPP-----PPP 1013 Query: 365 PPXXXXX---GGGXXPPPPPP 418 PP G G PPPPPP Sbjct: 1014 PPGMNAPVAPGFGGPPPPPPP 1034 Score = 40.3 bits (90), Expect = 0.056 Identities = 26/67 (38%), Positives = 26/67 (38%), Gaps = 2/67 (2%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG--GGXXPPPPPPXXFFFXPXXXX 451 K PP F G PPPPP PPP P G G PPPPPP P Sbjct: 971 KTNGPPQAPGF--NGPPPPPPP----PPPMPGQGPPGFNGPPPPPPPPPPPGMNAPVAPG 1024 Query: 452 XGGGXXP 472 GG P Sbjct: 1025 FGGPPPP 1031 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 41.5 bits (93), Expect = 0.024 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPP PPPPP PPPPPP Sbjct: 287 PPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAA---PPPPPP 327 Score = 41.1 bits (92), Expect = 0.032 Identities = 25/77 (32%), Positives = 28/77 (36%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP 361 L++ PPP P G PP G PPP +G PPPP P Sbjct: 272 LRRQAPPPPPPSRGGPPPPPPPPHNSGP------PPPPARG---RGAPPPPPSRAPTAAP 322 Query: 362 PPPXXXXXGGGXXPPPP 412 PPP PPPP Sbjct: 323 PPPPPSRPSVAVPPPPP 339 Score = 40.7 bits (91), Expect = 0.042 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP +GG PPPPP PPPP G PPPPP Sbjct: 280 PPP-----SRGGPPPPPPPPHNSGPPPPPARGRGA---PPPPP 314 Score = 40.7 bits (91), Expect = 0.042 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP G PPPPPP Sbjct: 322 PPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSG--PPPPPP 363 Score = 37.9 bits (84), Expect = 0.30 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPPPXXXXX----PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 344 PPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPP 378 Score = 37.9 bits (84), Expect = 0.30 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP----XXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G PPPPP PPPPP G PPPPP Sbjct: 346 PPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPG---PPPPP 389 Score = 33.5 bits (73), Expect = 6.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGP 707 P GPPPPPP P P P PP G P Sbjct: 355 PSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLP 392 >UniRef50_Q8IV90 Cluster: Wiskott-Aldrich syndrome protein family member 4; n=37; Euteleostomi|Rep: Wiskott-Aldrich syndrome protein family member 4 - Homo sapiens (Human) Length = 625 Score = 41.5 bits (93), Expect = 0.024 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXP--PPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP P G PP P PP PPPP PPPP Sbjct: 451 PPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPP 510 Query: 371 XXXXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 511 LSQPTRGAPPPPPPPP 526 Score = 39.9 bits (89), Expect = 0.074 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PP F PPPPP PPPP G PPPP F Sbjct: 437 PPSSKPGFAPPPAPPPPPPPMIGIPPPPPPIGFGSPGTPPPPSSPSF 483 Score = 39.9 bits (89), Expect = 0.074 Identities = 24/73 (32%), Positives = 25/73 (34%), Gaps = 2/73 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKK--CPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP P + PP PPP G PPPPP PPPPP Sbjct: 476 PPPSSPSFPPHPDFAAPPPLPPPPAADYPTLPPPPLSQPTR--GAPPPPPPPPPGPPPPP 533 Query: 371 XXXXXGGGXXPPP 409 G PPP Sbjct: 534 FTGADGQPAVPPP 546 Score = 37.9 bits (84), Expect = 0.30 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP G G PPPP F P Sbjct: 451 PPPPPPMIGIPPPPPPI---GFGSPGTPPPPSSPSFPP 485 Score = 37.1 bits (82), Expect = 0.52 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP +G PPPPP PP PP G P PPP Sbjct: 507 PPPPLSQPTRGAPPPPPP----PPPGPPPPPFTGADGQPAVPPP 546 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 41.5 bits (93), Expect = 0.024 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPP PPPPP P PPP PPPPP + GGG Sbjct: 162 PPPSPPSPPPPSPPPPPPPSPPPPSPPPPSPSPPPPPASPPPPPPALPYPQCGIKKGGG 220 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP P PPPP P Sbjct: 152 PPPPPPPPSPPPPSPPSPPPPSPPPPPPPSP 182 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PP PP PPP PP Sbjct: 153 PPPPPPPSPPPPSPPSPPPPSPPPPPPPSPP 183 >UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin - Gallus gallus (Chicken) Length = 1213 Score = 41.5 bits (93), Expect = 0.024 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPPP G PPPPP Sbjct: 657 PPPPPPPPPPPPPPPFSDSSLPGLVPPPPP 686 Score = 38.3 bits (85), Expect = 0.23 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 F P PPP PP PP G PPPP P FF Sbjct: 715 FQAPAPPAPPPLPGLGPPVPPPLPGSGLPPPPPPPGPGLFF 755 Score = 34.7 bits (76), Expect = 2.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXP---PPPPP 418 P PPP PPPPP P PPPPP Sbjct: 653 PSPPPPPPPPPPPPPPPPPFSDSSLPGLVPPPPP 686 >UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L splicing variant; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to FHOS2L splicing variant - Strongylocentrotus purpuratus Length = 1146 Score = 41.1 bits (92), Expect = 0.032 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP G PPPPP PPPPP G G PPPP Sbjct: 585 PPPLPGL----GIPPPPPI-PGAPPPPPPPAMKGPGAPPPPP 621 Score = 38.7 bits (86), Expect = 0.17 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPP G PPPPPP Sbjct: 580 GAPPPPPPLPGLGIPPPPPIP----GAPPPPPPP 609 Score = 37.9 bits (84), Expect = 0.30 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G PPPP PPPPP G PPPPP Sbjct: 582 PPPPPPLPGLGIPPPPPIPGAPPPPPPPAMKGPGA---PPPPP 621 >UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 191 Score = 41.1 bits (92), Expect = 0.032 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPP------XXXXXGGGXXPPPPPP 418 PP PPPPP PPPPP G G PPPPPP Sbjct: 94 PPAPPPRDGSSPPPPPPRDGSSPPPPPPSKRAASPPPPGDGSSPPPPPP 142 Score = 39.9 bits (89), Expect = 0.074 Identities = 29/93 (31%), Positives = 31/93 (33%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P G PP + PPP G PPPPP P PP Sbjct: 104 SPPPPPPRDGSSPPPPPPSKRAAS------PPPP-----GDGSSPPPPPPRDGSSPRPPP 152 Query: 374 XXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPPP P G P Sbjct: 153 PR---DGSSPPPPPPRDGSSPPPPPPRDGSAPP 182 Score = 39.5 bits (88), Expect = 0.098 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +2 Query: 317 GGXPP-PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PP PPP PPPPP G PPPPPP P G P Sbjct: 91 GASPPAPPPRDGSSPPPPPPRD----GSSPPPPPPSKRAASPPPPGDGSSPPP 139 Score = 37.9 bits (84), Expect = 0.30 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPPP G PPPPP Sbjct: 160 PPPPPRDGSSPPPPPPR----DGSAPPPPP 185 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 K PPPP PPPPP G PP PPP P G P Sbjct: 69 KRSASPPPPRDGSSPPPPPPR----DGASPPAPPPRDGSSPPPPPPRDGSSPP 117 Score = 33.1 bits (72), Expect = 8.5 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + G PPPP PPP G PPP P Sbjct: 150 PPP-----PRDGSSPPPPPPRDGSSPPPPPPRDGSAPPPPPSGP 188 >UniRef50_UPI0000D9F058 Cluster: PREDICTED: hypothetical protein; n=1; Macaca mulatta|Rep: PREDICTED: hypothetical protein - Macaca mulatta Length = 149 Score = 41.1 bits (92), Expect = 0.032 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP GGG PPPP Sbjct: 74 PPPPPLLPPLPPPPLHLRPTGGGRPEAPPPP 104 Score = 39.9 bits (89), Expect = 0.074 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPP GG P PPP Sbjct: 70 GSLPPPPPPLLPPLPPPPLHLRPTGGGRPEAPPP 103 >UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; n=2; Eukaryota|Rep: hypothetical protein 42.t00003 - Entamoeba histolytica HM-1:IMSS Length = 1575 Score = 41.1 bits (92), Expect = 0.032 Identities = 26/75 (34%), Positives = 26/75 (34%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 TPPP P PP PPP PPPPP PPPPP Sbjct: 1420 TPPPPPPTLSMPPPPPPTLSMPPPPPPTLSMPPPPPPTL---SMPPPPPPTLSMPPPPPP 1476 Query: 374 XXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 1477 TL-----SMPPPPPP 1486 >UniRef50_Q9FF14 Cluster: Similarity to unknown protein; n=3; Arabidopsis thaliana|Rep: Similarity to unknown protein - Arabidopsis thaliana (Mouse-ear cress) Length = 464 Score = 41.1 bits (92), Expect = 0.032 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP PPPPPP Sbjct: 19 PPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPP 62 Score = 33.9 bits (74), Expect = 4.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 326 PPPPPXXXXXPP-PPPXXXXXGGGXXPPPPPP 418 PPPPP P PPP PPPPPP Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPP 48 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 41.1 bits (92), Expect = 0.032 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP K PPPP PPP P PPPPPP Sbjct: 549 PPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Score = 41.1 bits (92), Expect = 0.032 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPPPPP Sbjct: 591 PPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPP 639 Score = 39.5 bits (88), Expect = 0.098 Identities = 27/81 (33%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 ++ PPP P G K PP + P G PPPPP PP P Sbjct: 648 RLVPPPPAPGIGNKFPAPPPPPPPPR----SSSRTPTGAATSSKGPPPPPP-----PPLP 698 Query: 368 PXXXXXGGGXX----PPPPPP 418 P G G PPPPPP Sbjct: 699 PANRTNGPGVPSAPPPPPPPP 719 Score = 39.1 bits (87), Expect = 0.13 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 6/65 (9%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX------PPPPPXXXXXGGGXX 400 PP G PPP K P PPP PPPPP G Sbjct: 719 PPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTV 778 Query: 401 PPPPP 415 PPPPP Sbjct: 779 PPPPP 783 Score = 37.9 bits (84), Expect = 0.30 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 544 PPPPPP----PPPPPSGNKPAFSPPPPPPPP 570 Score = 37.9 bits (84), Expect = 0.30 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP PPPPPP Sbjct: 572 PPPLPQSNYASSQPPPPP-----PPPPLPNCLVPSPPPPPPPPP 610 Score = 37.1 bits (82), Expect = 0.52 Identities = 23/74 (31%), Positives = 24/74 (32%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P + PP PPP PPPP PPPP Sbjct: 604 PPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPP-------PPPPPPPSLPNRLVPPPPAP 656 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 657 GIGNKFPAPPPPPP 670 Score = 36.7 bits (81), Expect = 0.69 Identities = 22/74 (29%), Positives = 23/74 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP +P PP PPP K PPPPP P Sbjct: 623 PPPPLPNHSVLPP-PPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSSRTPTG 681 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 682 AATSSKGPPPPPPP 695 Score = 34.3 bits (75), Expect = 3.7 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGG---GXXPPPPPP 418 P P P PPPPP G PPPPPP Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPP 568 Score = 33.5 bits (73), Expect = 6.4 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP---PPPPXXXXXGGGXXPP 406 PP K PPP PPPPP P PPPP G PP Sbjct: 736 PPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRPHPP 794 >UniRef50_Q7F0U2 Cluster: OJ1116_C07.3 protein; n=4; Oryza sativa|Rep: OJ1116_C07.3 protein - Oryza sativa subsp. japonica (Rice) Length = 195 Score = 41.1 bits (92), Expect = 0.032 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -1 Query: 462 PPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXP 319 PPP G GGGG PPP GGGGG GGGG P Sbjct: 94 PPPYSGGGGGSST---GGGGIYYPPPTGGGGGGGGGWQQGGGGGGAYP 138 Score = 33.9 bits (74), Expect = 4.9 Identities = 25/63 (39%), Positives = 25/63 (39%), Gaps = 4/63 (6%) Frame = -1 Query: 462 PPPXXXXXGXKKXXXGGGGGGXX----PPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKK 295 PPP G GGGGGG PPP GGGG GGG PP Sbjct: 70 PPPPSYPSGG----GGGGGGGTVMYTSPPPPY---SGGGGGSSTGGGGIYYPPPTGGGGG 122 Query: 294 GGG 286 GGG Sbjct: 123 GGG 125 >UniRef50_Q585V1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 713 Score = 41.1 bits (92), Expect = 0.032 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX------PPPPPXXXXXGGGXXPPPPPP 418 PPP KG PPPPP PPPPP G P PPPP Sbjct: 253 PPPVQMAKAKGTLPPPPPPMPTGKLKAPPPPPPPFASIAGKTRAPLPPPP 302 Score = 33.5 bits (73), Expect = 6.4 Identities = 26/80 (32%), Positives = 27/80 (33%), Gaps = 5/80 (6%) Frame = +2 Query: 194 TPPP-QIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXK--GGXPPPP--PXXXXXP 358 TPPP Q+ PP GK PPPF K PPPP P Sbjct: 252 TPPPVQMAKAKGTLPPPPPPMPTGKLKAPPPPPPPFASIAGKTRAPLPPPPPAPTGKTQA 311 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 P P G P PPP Sbjct: 312 PAAPPPAPTGKTQAPAAPPP 331 Score = 33.5 bits (73), Expect = 6.4 Identities = 20/76 (26%), Positives = 22/76 (28%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + PPP P + P GK PP PPP P P P Sbjct: 298 LPPPPPAPTGKTQAPAAPPPAPTGKTQAPAAPPPAPTGKTQAPAAPPPAPTGKTQAPAAP 357 Query: 371 XXXXXGGGXXPPPPPP 418 G P PPP Sbjct: 358 PPAPTGKTQAPAAPPP 373 Score = 33.1 bits (72), Expect = 8.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P P PPP G PPPPPP Sbjct: 246 PPPLP-----PTPPPVQMAKAKGTLPPPPPP 271 >UniRef50_Q54U84 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 674 Score = 41.1 bits (92), Expect = 0.032 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 312 PPPPPPPSSPPPPPPPSPPRVPFLPPPPPPP 342 >UniRef50_Q23G58 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 385 Score = 41.1 bits (92), Expect = 0.032 Identities = 31/104 (29%), Positives = 33/104 (31%), Gaps = 2/104 (1%) Frame = +2 Query: 167 FXXXXLKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPP--FXXXFXKGGXPPPPP 340 F + I PPP + PP G F PPP PPPPP Sbjct: 224 FPPPPMMNIPPPPPM-------NIPPAPTAPGIFVNNNAPPPPPSLPGIVVNANAPPPPP 276 Query: 341 XXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 P P GG PPPPPP P GG P Sbjct: 277 LSLGLPGVP------GGSSLPPPPPPNMSLPPPPISAPGGLPIP 314 Score = 35.5 bits (78), Expect = 1.6 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 6/80 (7%) Frame = +2 Query: 191 ITPPPQIP-FWGXKKKCPPXXEXXGKFXX*KXXPPP---FXXXFXKGGX--PPPPPXXXX 352 I P P P + PP G PPP GG PPPPP Sbjct: 240 IPPAPTAPGIFVNNNAPPPPPSLPGIVVNANAPPPPPLSLGLPGVPGGSSLPPPPPPNMS 299 Query: 353 XPPPPPXXXXXGGGXXPPPP 412 PPPP GG PPPP Sbjct: 300 LPPPP--ISAPGGLPIPPPP 317 Score = 33.1 bits (72), Expect = 8.5 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 3/76 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKG---GXPPPPPXXXXXPPPP 367 PPP +P PP PPP F PPPPP PP P Sbjct: 188 PPPGLPGIVVSSNAPPAPSLPNIVVN-SGAPPPPPLNFPPPPMMNIPPPPPM--NIPPAP 244 Query: 368 PXXXXXGGGXXPPPPP 415 PPPPP Sbjct: 245 TAPGIFVNNNAPPPPP 260 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 41.1 bits (92), Expect = 0.032 Identities = 24/74 (32%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P+ PP + PPP PPPPP PPPP Sbjct: 397 PPPPAPY------PPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPP 450 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 451 PPP--SPPPPPPPP 462 Score = 34.3 bits (75), Expect = 3.7 Identities = 22/81 (27%), Positives = 25/81 (30%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P+ P PPP PPPPP PPPPP Sbjct: 404 PPPSAPYPAPYTPPSPPPPPCPVPCPPPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPPC 463 Query: 377 XXXGGGXXPPPPPPXXFFFXP 439 P P P ++ P Sbjct: 464 PIPCPEPYPVPVPIPEPYYVP 484 >UniRef50_A2DM31 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 560 Score = 41.1 bits (92), Expect = 0.032 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP G PPPPP PPPPP G G PPPP Sbjct: 458 PPPVAPPPPGIGLPPPPPPAFGIPPPPP-----GVGVPPPPP 494 Score = 39.5 bits (88), Expect = 0.098 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 449 PPPPPMA---PPPPPVAPPPPGIGLPPPPPP 476 Score = 34.3 bits (75), Expect = 3.7 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +2 Query: 326 PPPPPXXXXXP----PPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXG 457 P PPP P PPPP G PPPPP F P G Sbjct: 441 PSPPPPVAPPPPPMAPPPPPVAPPPPGIGLPPPPPPAFGIPPPPPGVG 488 >UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 1083 Score = 41.1 bits (92), Expect = 0.032 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 583 PPPPPPP---PPPPPPVQQTGTSLPPPPPPP 610 Score = 39.1 bits (87), Expect = 0.13 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 591 PPPPPVQQTGTSLPPPPPPPPIQTTGGPPPPPPP 624 >UniRef50_Q4WNW8 Cluster: KH domain protein; n=13; Pezizomycotina|Rep: KH domain protein - Aspergillus fumigatus (Sartorya fumigata) Length = 503 Score = 41.1 bits (92), Expect = 0.032 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPPP G G PPPPP Sbjct: 467 PPPPPPASEAPPPPP----PGSGSPPPPPP 492 >UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 996 Score = 41.1 bits (92), Expect = 0.032 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 943 PPPPP-----PPPPPSLIPFGASPPPPPPPP 968 Score = 39.5 bits (88), Expect = 0.098 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PP PPPPP G PPPPPP Sbjct: 938 PQPPSPPPPPPPPPPSLIPFGASPPPPPPP 967 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P P PPPPP G PPPPPP Sbjct: 936 PQPQPPSPPPPPPPPPPSLIPFGASPPPPPP 966 Score = 36.3 bits (80), Expect = 0.91 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP G PPPPP PPPPP Sbjct: 948 PPPPPSLIPFGASPPPPPPPPPPPPPPP 975 Score = 34.3 bits (75), Expect = 3.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP 367 PPP F PPPPP PPPP Sbjct: 950 PPPSLIPFGASPPPPPPPPPPPPPPPP 976 >UniRef50_UPI0000F2B52B Cluster: PREDICTED: similar to diaphanous 1; n=1; Monodelphis domestica|Rep: PREDICTED: similar to diaphanous 1 - Monodelphis domestica Length = 1186 Score = 40.7 bits (91), Expect = 0.042 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP PPPPP PPP P G PPPP Sbjct: 598 PPPLPGSISIPPPPPPPPPLPVLPPPSPLPLPGSTGIPPPPP 639 Score = 36.7 bits (81), Expect = 0.69 Identities = 26/82 (31%), Positives = 28/82 (34%), Gaps = 6/82 (7%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 + P P +P G PP G PPP P P P PPPPP Sbjct: 583 VPPAPPLPS-GIN--VPPPPPLPGSISIPPPPPPPPPLPVLPPPSPLPLPGSTGIPPPPP 639 Query: 371 XXXXXG------GGXXPPPPPP 418 G G PPPPPP Sbjct: 640 LLGGPGIPPPLPGMCLPPPPPP 661 >UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 101.t00009 - Entamoeba histolytica HM-1:IMSS Length = 863 Score = 40.7 bits (91), Expect = 0.042 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 KG PPPP PPPP GG PPPPPP Sbjct: 17 KGANAPPPPPPAGAPPPP------SGGMPPPPPPP 45 Score = 34.7 bits (76), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 G PPPP PPPPP PPPP Sbjct: 29 GAPPPPSGGMPPPPPPPAGAPPPPVGMPPPP 59 Score = 33.9 bits (74), Expect = 4.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 K+ PPPPPP P P P PP G PP Sbjct: 15 KRKGANAPPPPPPAGAPPPPSGGMPPPPPPPAGAPPPPVGMPP 57 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 GG PPPP PPPP G PPP Sbjct: 268 GGMMPPPPPSNCPPPPPSNNLPPPGPANVPPP 299 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 GG PPPP PPPP G PPP Sbjct: 508 GGMMPPPPPSNCPPPPPSNNLPPPGPANVPPP 539 Score = 33.1 bits (72), Expect = 8.5 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPP---PPPXXFFFXPXXXXXGGG 463 PPPP PPPPP G PPP PPP P G G Sbjct: 31 PPPPSGGMPPPPPPP-----AGAPPPPVGMPPPPSNHSMPKPSSAGRG 73 >UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; Gallus gallus|Rep: Putative uncharacterized protein - Gallus gallus (Chicken) Length = 1266 Score = 40.7 bits (91), Expect = 0.042 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPPPP G PPPPPP Sbjct: 682 PPPLPMVPGCPPPPPPPPVVPGCPPPPPPPP 712 Score = 37.5 bits (83), Expect = 0.40 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP PPPPP PPPPP G PPPP Sbjct: 682 PPPLPMVPGCPPPPPPPPVVPGCPPPPPPPPMVPG--CPPPP 721 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 40.7 bits (91), Expect = 0.042 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 G PPPPP PPPPP PPPPPP F Sbjct: 229 GFAPPPPPPPPPPPPPPPPPPPP---PPPPPPPPPPF 262 >UniRef50_Q9S858 Cluster: HRGP=HYDROXYPROLINE-rich glycoprotein; n=2; Viridiplantae|Rep: HRGP=HYDROXYPROLINE-rich glycoprotein - Glycine max (Soybean) Length = 60 Score = 40.7 bits (91), Expect = 0.042 Identities = 19/50 (38%), Positives = 21/50 (42%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 K PPP + K PPPP PPP P PPPPPP + Sbjct: 13 KSPPPPSPTPYYKSPPPPPPYYYKSPPPPSPAPYYY---KSPPPPPPYYY 59 >UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; Musa acuminata|Rep: Putative uncharacterized protein - Musa acuminata (Banana) Length = 390 Score = 40.7 bits (91), Expect = 0.042 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPP P PPPPPP Sbjct: 185 GPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPPP 218 Score = 38.7 bits (86), Expect = 0.17 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPPP PPPP PPPPPP Sbjct: 175 PPTPEPPPPPGPEPPPPPGPEPPPPPAPEPPPPPAPEPPPPPP 217 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 40.7 bits (91), Expect = 0.042 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPPPP P PPPP Sbjct: 524 PPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPP 567 Score = 37.9 bits (84), Expect = 0.30 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PPP P PPP P PPP Sbjct: 519 SPPPSPPP-SPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPP 577 Query: 374 XXXXGGGXXPPPPPP 418 P PPPP Sbjct: 578 SPPPPPSPPPSPPPP 592 Score = 37.1 bits (82), Expect = 0.52 Identities = 24/82 (29%), Positives = 25/82 (30%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P PP PP PPPPP PPPPP Sbjct: 535 SPPPPSPSPPPSPPPPPSPPPGSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPPP- 593 Query: 374 XXXXGGGXXPPPPPPXXFFFXP 439 PP PPP P Sbjct: 594 ------SPPPPSPPPPPVVVVP 609 Score = 36.7 bits (81), Expect = 0.69 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PP PP P PPPP Sbjct: 507 PPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPP 550 Score = 34.7 bits (76), Expect = 2.8 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 7/51 (13%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP-------PPPPXXXXXGGGXXPPPPPP 418 PPP PPP P P PPPP G PP PPP Sbjct: 516 PPPSPPPSPPPSPPPPSPPSPPPPSPSPPPSPPPPPSPPPGSAARPPSPPP 566 Score = 33.1 bits (72), Expect = 8.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP PP P PPP PP PPP Sbjct: 496 PPVSSPPPSPSPPPSPPPSPPPPSPPPSPPPSPPPPSPPSPPP 538 >UniRef50_O48682 Cluster: F3I6.8 protein; n=2; Arabidopsis thaliana|Rep: F3I6.8 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 820 Score = 40.7 bits (91), Expect = 0.042 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 241 PPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 274 >UniRef50_A7QNX2 Cluster: Chromosome chr1 scaffold_135, whole genome shotgun sequence; n=4; Magnoliophyta|Rep: Chromosome chr1 scaffold_135, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 673 Score = 40.7 bits (91), Expect = 0.042 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP PP PPPPP G P PPPP Sbjct: 66 PPSPPPPKSESPPPTPPPPSPSPPPPPPPPPSSGSGPPKPPPP 108 Score = 35.9 bits (79), Expect = 1.2 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPP--PPP 418 PPPPP PP PP PPP PPP Sbjct: 92 PPPPPSSGSGPPKPPPPSHSNSSPPPPPTSPPP 124 >UniRef50_A2Q4Q2 Cluster: Phosphoinositide-binding clathrin adaptor, N-terminal; Wiscott-Aldrich syndrome, C-terminal; n=1; Medicago truncatula|Rep: Phosphoinositide-binding clathrin adaptor, N-terminal; Wiscott-Aldrich syndrome, C-terminal - Medicago truncatula (Barrel medic) Length = 633 Score = 40.7 bits (91), Expect = 0.042 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP P PPP GG PPPPP Sbjct: 296 PPPLSLGLSSVALPPPPPLSMKPGSTPAPAPPPPMLRGNGGSAPPPPP 343 Score = 35.1 bits (77), Expect = 2.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +2 Query: 326 PPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G P PPPP Sbjct: 294 PPPPPLSLGLSSVALPPPPPLSMKPGSTPAPAPPPP 329 >UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1164 Score = 40.7 bits (91), Expect = 0.042 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGG 460 G PPPPP PPPPP GG PPPPPP F P GG Sbjct: 572 GMPPPPP-----PPPPPGFP---GGAPPPPPPP--FGAPPPPALNGG 608 Score = 35.5 bits (78), Expect = 1.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP 367 PPP GG PPPPP PPPP Sbjct: 577 PPPPPPPGFPGGAPPPPPPPFGAPPPP 603 >UniRef50_Q6CAY8 Cluster: Similarity; n=2; Fungi/Metazoa group|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 586 Score = 40.7 bits (91), Expect = 0.042 Identities = 26/74 (35%), Positives = 27/74 (36%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P +K PP G K PPP P PPP PP PP Sbjct: 111 PPPGPPPGHSEKHAPPPGPPPGHSRE-KHAPPPGPPPGLYAPPPGPPPGHHAPPPGPPPG 169 Query: 377 XXXGGGXXPPPPPP 418 G PP PPP Sbjct: 170 HD--GFAPPPGPPP 181 Score = 34.7 bits (76), Expect = 2.8 Identities = 27/81 (33%), Positives = 29/81 (35%), Gaps = 3/81 (3%) Frame = +2 Query: 185 KKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP- 361 K PP P +K PP G + PPP G PPP PP Sbjct: 122 KHAPPPGPPPGHSREKHAPPPGPPPGLYAP-PPGPPPGHHAPPPG--PPPGHDGFAPPPG 178 Query: 362 PPPXXXXXGGG--XXPPPPPP 418 PPP GGG PP PP Sbjct: 179 PPPGWNEAGGGDDGLPPSYPP 199 Score = 33.9 bits (74), Expect = 4.9 Identities = 27/82 (32%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXP-PPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 PPP P PP G P PP K PP PP PPP P Sbjct: 100 PPPGPP---PGHHAPPPGPPPGHSEKHAPPPGPPPGHSREKHAPPPGPPPGLYAPPPGPP 156 Query: 374 XXXXGGGXXPPPPPPXXFFFXP 439 G PP PPP F P Sbjct: 157 P---GHHAPPPGPPPGHDGFAP 175 >UniRef50_Q6AHS6 Cluster: Protease-1 (PRT1) protein, putative; n=58; Pneumocystis carinii|Rep: Protease-1 (PRT1) protein, putative - Pneumocystis carinii Length = 947 Score = 40.7 bits (91), Expect = 0.042 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPPP PPPPPP Sbjct: 778 PPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPP 821 Score = 39.1 bits (87), Expect = 0.13 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PP PP PPPPP Sbjct: 763 PPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPP 806 Score = 36.7 bits (81), Expect = 0.69 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPPP PPPP P Sbjct: 752 PPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAP 795 Score = 36.7 bits (81), Expect = 0.69 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPPP PPPP P Sbjct: 765 PPPAPAPAPPAPPPPPAPAPAPPAPPPPPAPAPAPPAPPPPPAP 808 Score = 34.7 bits (76), Expect = 2.8 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 1/75 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP-PX 373 PPP P PP PPP P P P PP P P Sbjct: 790 PPPPAPAPAPPAPPPPPAPAPAPAPPPPPPPPPPRPELEPEPEPEPEPEPEPQPPQPQPE 849 Query: 374 XXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 850 PPVPPPKPQPPPPPP 864 Score = 33.9 bits (74), Expect = 4.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP PP PP PPPPP Sbjct: 750 PSPPPAPAPAPPAPPPPPAPAPAPPAPPPPP 780 >UniRef50_Q4WG58 Cluster: Actin cortical patch assembly protein Pan1, putative; n=9; Fungi/Metazoa group|Rep: Actin cortical patch assembly protein Pan1, putative - Aspergillus fumigatus (Sartorya fumigata) Length = 1467 Score = 40.7 bits (91), Expect = 0.042 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP + PPPPP PP PP G PPP PP Sbjct: 1378 PPAAVPSYDPSVAPPPPPAPPMAPPAPPPGPPPPPGPLPPPAPP 1421 Score = 33.5 bits (73), Expect = 6.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPPXXG 719 P PPPPP P P P PP G PP G Sbjct: 1372 PPPPPPPPAAVPSYDPSVAPPPPPAPPMAPPAPPPGPPPPPG 1413 >UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1723 Score = 40.7 bits (91), Expect = 0.042 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 GG PPPPP PPPPP PPPPPP Sbjct: 1026 GGPPPPPP-----PPPPPGMPGMPPPPPPPPPPP 1054 Score = 35.9 bits (79), Expect = 1.2 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPPPXXXXXPPPP----PXXXXXGGGXXPPPPPP 418 PPPPP PPPP P GG PPPPPP Sbjct: 1007 PPPPP-----PPPPGMNAPVAPGFGGPPPPPPPPP 1036 Score = 33.9 bits (74), Expect = 4.9 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 9/40 (22%) Frame = +2 Query: 326 PPPPPX---------XXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 1010 PPPPPPGMNAPVAPGFGGPPPPPPPPPPPGMPGMPPPPPP 1049 Score = 33.1 bits (72), Expect = 8.5 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 308 FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 F + PPPPP PPP G PPPPPP Sbjct: 1002 FNEPAPPPPPP-----PPPGMNAPVAPGFGGPPPPPP 1033 >UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 1940 Score = 40.7 bits (91), Expect = 0.042 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG--GGXXPPPPPPXXF 427 PP P PPP PPPPP G PPPPPP F Sbjct: 1249 PPLHYGSQNSLAPGPPPPPPPPPPPPPGLSVGSNIAGPPPPPPPPPPF 1296 >UniRef50_Q99954 Cluster: Submaxillary gland androgen-regulated protein 3 homolog A precursor; n=10; Eutheria|Rep: Submaxillary gland androgen-regulated protein 3 homolog A precursor - Homo sapiens (Human) Length = 134 Score = 40.7 bits (91), Expect = 0.042 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPP-PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP F G PPP PP PPP G G PP PPP Sbjct: 38 PPPPRFPFGTGFVPPPHPPPYGPGRFPPPLSPPYGPGRIPPSPPP 82 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 40.7 bits (91), Expect = 0.042 Identities = 28/87 (32%), Positives = 29/87 (33%), Gaps = 6/87 (6%) Frame = +2 Query: 191 ITPPPQIPFW-GXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP--P 361 I PPP +P G PP PPP PPPPP P P Sbjct: 875 IPPPPPLPSGLGSLSPAPPMPPVSAGPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSP 934 Query: 362 PPPXXXXXGGGXXPP---PPPPXXFFF 433 PP PP PPPP FF Sbjct: 935 APPNPGGPPPAPPPPGLAPPPPPGLFF 961 Score = 35.5 bits (78), Expect = 1.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPG-GGPP 710 P PPPPPP P P P PP GGPP Sbjct: 904 PPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPPNPGGPP 943 >UniRef50_Q9SXE7 Cluster: T3P18.6; n=2; core eudicotyledons|Rep: T3P18.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 297 Score = 40.3 bits (90), Expect = 0.056 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 432 KKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 K GGGGGG PP G GGG GG GG PP GGG Sbjct: 39 KPPQHGGGGGGGSKPP-PHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGG 86 Score = 34.3 bits (75), Expect = 3.7 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G K GG GG PPP G GGG GGGGG Sbjct: 50 GSKPPPHHGGKGGGKPPP---HGGKGGGPPHHGGGGGG 84 Score = 33.1 bits (72), Expect = 8.5 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPP---PPP 415 PPP KGG PPP PP GGG PP PPP Sbjct: 53 PPPHHGG--KGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPP 96 >UniRef50_Q9LQZ8 Cluster: F10A5.23; n=1; Arabidopsis thaliana|Rep: F10A5.23 - Arabidopsis thaliana (Mouse-ear cress) Length = 167 Score = 40.3 bits (90), Expect = 0.056 Identities = 21/51 (41%), Positives = 23/51 (45%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G + GGGGGG GGGGG + GGGGG K GGG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 >UniRef50_Q2RAC3 Cluster: Harpin-induced protein 1 containing protein, expressed; n=2; Oryza sativa (japonica cultivar-group)|Rep: Harpin-induced protein 1 containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 342 Score = 40.3 bits (90), Expect = 0.056 Identities = 24/79 (30%), Positives = 25/79 (31%), Gaps = 5/79 (6%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKG-----GXPPPPPXXXXXP 358 +PPP P G PP PPP P PPP P Sbjct: 61 SPPPPAPAMGYPANHPPPPPSSNAAYFASAAPPPAATNGTAAFAVAYPYPAPPPHSHSHP 120 Query: 359 PPPPXXXXXGGGXXPPPPP 415 PPPP PPPPP Sbjct: 121 PPPPPHAYHHHHYPPPPPP 139 >UniRef50_Q8IRB3 Cluster: CG32241-PA; n=1; Drosophila melanogaster|Rep: CG32241-PA - Drosophila melanogaster (Fruit fly) Length = 440 Score = 40.3 bits (90), Expect = 0.056 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPP PPPPP PPPPPP + P Sbjct: 270 PPPTKKVIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTP 320 Score = 39.9 bits (89), Expect = 0.074 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPP PPPPP PPPPPP + P Sbjct: 170 PPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTP 220 Score = 34.7 bits (76), Expect = 2.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP PPPPP PPPPPP Sbjct: 157 PPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKV--VYTPPPPPP 198 Score = 34.7 bits (76), Expect = 2.8 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPPPP PPPPP PPPPP + P Sbjct: 168 PPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPP 221 Score = 33.9 bits (74), Expect = 4.9 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 3/41 (7%) Frame = +2 Query: 326 PPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPPP + P Sbjct: 281 PPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPP 321 >UniRef50_Q5TJB8 Cluster: Diaphanous-related formin dDia2; n=2; Dictyostelium discoideum|Rep: Diaphanous-related formin dDia2 - Dictyostelium discoideum (Slime mold) Length = 1087 Score = 40.3 bits (90), Expect = 0.056 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 338 PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPPPP GGG PPPPPP Sbjct: 589 PILGSPPPPPPPPMSGGGGPPPPPPPP 615 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 40.3 bits (90), Expect = 0.056 Identities = 21/57 (36%), Positives = 22/57 (38%) Frame = +2 Query: 260 GKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 G F K PP PPPPP PPPPP PP PPP F+ Sbjct: 1524 GGFGNGKRTPPHPPPSSGSSAPPPPPPPPPPPPPPPPPPP-----SPPPSPPPSPFY 1575 Score = 37.1 bits (82), Expect = 0.52 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP F PPPPP PPPPP PPPPPP Sbjct: 1171 PPPSSGSFT----PPPPPPPPPPPPPPP----------PPPPPP 1200 Score = 36.7 bits (81), Expect = 0.69 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP PPPPP PP PPP Sbjct: 1408 PPHPPPSSGSSAPPPPPH--SPPPPPPPPPPSSPPSPPPSPPP 1448 Score = 35.9 bits (79), Expect = 1.2 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G PPPP PPPPP P PPP Sbjct: 1411 PPP-----SSGSSAPPPPPHSPPPPPPPPPPSSPPSPPPSPPP 1448 >UniRef50_Q5CKJ5 Cluster: Putative uncharacterized protein; n=1; Cryptosporidium hominis|Rep: Putative uncharacterized protein - Cryptosporidium hominis Length = 996 Score = 40.3 bits (90), Expect = 0.056 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 K PPPPP PPPPP PPPPP Sbjct: 406 KNSPPPPPPPPPPPPPPPPPPPLPPSQHLLPPPPP 440 Score = 39.5 bits (88), Expect = 0.098 Identities = 24/79 (30%), Positives = 30/79 (37%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP 361 +KK++ P+ K + +F K PPP PPPPP PP Sbjct: 374 IKKVSTSPEFEVPETKNYTNSKFKDKSQFQIDKNSPPP----------PPPPPPPPPPPP 423 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP PPPP P Sbjct: 424 PPPPLPPSQHLLPPPPPLP 442 Score = 35.9 bits (79), Expect = 1.2 Identities = 25/86 (29%), Positives = 29/86 (33%), Gaps = 10/86 (11%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGX------PPP----PP 340 + PPP +P G K E P + F + G PPP P Sbjct: 435 LPPPPPLPLSGDSKVSDMQKEDPTLSFEAVTSVPKYGKPFLRKGPIRPPSSPPPLSPTSP 494 Query: 341 XXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPPP Sbjct: 495 HPTPQPPPPPPLPSTSFPQPPPPPPP 520 >UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma japonicum|Rep: SJCHGC03138 protein - Schistosoma japonicum (Blood fluke) Length = 156 Score = 40.3 bits (90), Expect = 0.056 Identities = 41/122 (33%), Positives = 45/122 (36%), Gaps = 4/122 (3%) Frame = +2 Query: 197 PPPQIPFWGX----KKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP 364 PP +PFWG + PP G PPP F K PPPPP PPP Sbjct: 4 PPWGVPFWGGFFFFRGVFPPRG---GPLFFYGAPPPPPPFFFNKKKRPPPPP---GGPPP 57 Query: 365 PPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPLXXXKKXXXGVGXXXXXFFFFXXL 544 P GGG PP F F P GGG P + +G FFF L Sbjct: 58 P-----FGGGGFPP-----FFHFFP---PPGGGVAP---PQGGGPPLGGGGFQFFFKGFL 101 Query: 545 GG 550 G Sbjct: 102 PG 103 >UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 603 Score = 40.3 bits (90), Expect = 0.056 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPP-PPPPXXF 427 PPPP PPPPP G PP PPPP F Sbjct: 383 PPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGF 416 Score = 39.5 bits (88), Expect = 0.098 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPP PPPPP PPPPPP Sbjct: 391 PPPPPPPPPPAGKAPPPPI----PPPPPGFKSMKAPPPPPPPPP 430 Score = 39.1 bits (87), Expect = 0.13 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPP-PPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPP PP PPPPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPP 427 Score = 34.3 bits (75), Expect = 3.7 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP GK PPP K PPPPP Sbjct: 384 PPPPPP---PPPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPPPPPAMMMKTAVQ 440 Query: 377 XXXGGGXXPPPPPP 418 PPPPPP Sbjct: 441 PARTMTAIPPPPPP 454 Score = 33.1 bits (72), Expect = 8.5 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP K P P K PP PP Sbjct: 390 PPPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPPPPP 428 >UniRef50_Q23248 Cluster: Putative uncharacterized protein grl-21; n=2; Caenorhabditis|Rep: Putative uncharacterized protein grl-21 - Caenorhabditis elegans Length = 172 Score = 40.3 bits (90), Expect = 0.056 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 G P P PPPPP GG PPPPPP + P Sbjct: 27 GLGPQRPQQCCCPPPPPPPPCGGGYEAPPPPPPPSYAGGP 66 >UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 370 Score = 40.3 bits (90), Expect = 0.056 Identities = 27/80 (33%), Positives = 28/80 (35%), Gaps = 6/80 (7%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKG-----GXPPPP-PXXXXXP 358 PPP P + PP PPP G G PPPP P P Sbjct: 249 PPPPYPNPYPQPPYPPPPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYP 308 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPPP Sbjct: 309 PPPPPYPEQVPPPPPPPPPP 328 Score = 40.3 bits (90), Expect = 0.056 Identities = 26/78 (33%), Positives = 28/78 (35%), Gaps = 1/78 (1%) Frame = +2 Query: 197 PPPQIPF-WGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 PPP P + PP G PPP PPPPP PPPPP Sbjct: 265 PPPPYPNPYPQPPYPPPPAPCSGPGPCPYPGPPPPPYPAPTPYPPPPPPYPEQVPPPPPP 324 Query: 374 XXXXGGGXXPPPPPPXXF 427 PPPPPP + Sbjct: 325 P--------PPPPPPPPY 334 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP+ PPPPP PPPP PPPPPP + Sbjct: 298 PPPYPAPTP---YPPPPPPYPEQVPPPPPPP-----PPPPPPPPYPY 336 >UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; Suberites domuncula|Rep: Wiskott-Aldrich syndrome protein - Suberites domuncula (Sponge) Length = 410 Score = 40.3 bits (90), Expect = 0.056 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 4/66 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGX----PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXX 454 PPP +GG PPPP PPP GG PPPPP P Sbjct: 268 PPPNRGNTSRGGGRGHPPPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVGVPAPPPPPP 327 Query: 455 GGGXXP 472 GG P Sbjct: 328 VGGTGP 333 Score = 39.9 bits (89), Expect = 0.074 Identities = 22/62 (35%), Positives = 23/62 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP +GG PPP P PP G PPPPPP P GG Sbjct: 285 PPPPRGGPGRGGPPPPSNSRGGSAPAPPPPPPVGV-PAPPPPPPVGGTGPPKPPSAAGGP 343 Query: 467 XP 472 P Sbjct: 344 PP 345 Score = 33.5 bits (73), Expect = 6.4 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP G PP G PPP G PP PP PPPPP Sbjct: 297 PPPPSNSRGGSAPAPPPPPPVG--VPAPPPPPPVG-----GTGPPKPPSAAGGPPPPPSR 349 Query: 377 XXXGGGXXPPP 409 PP Sbjct: 350 DKPSSSLPAPP 360 >UniRef50_Q96U76 Cluster: Putative uncharacterized protein B18D24.090; n=1; Neurospora crassa|Rep: Putative uncharacterized protein B18D24.090 - Neurospora crassa Length = 740 Score = 40.3 bits (90), Expect = 0.056 Identities = 23/74 (31%), Positives = 24/74 (32%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP + G PP PPP PP P PPP Sbjct: 570 PPPPQNYQGQWPPPPPGPPHQYPQHPQHPTPPPHITPSPPPNFFPPGGPMAVPPHPPPFA 629 Query: 377 XXXGGGXXPPPPPP 418 GG PPPPPP Sbjct: 630 PSSGGAWPPPPPPP 643 Score = 34.3 bits (75), Expect = 3.7 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP F G P PP PPPP G P PPP F Sbjct: 502 PPPLTS-FPTGVPPRPPQHPGVFVPPPPPPHNQPVGNFHPVPPPIGF 547 Score = 33.5 bits (73), Expect = 6.4 Identities = 24/79 (30%), Positives = 26/79 (32%) Frame = +2 Query: 203 PQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXX 382 P P G PP +F PPP +G PPPPP P P Sbjct: 540 PVPPPIGFPVGAPPLPGQPHQFPSFPVPPPPPPPQNYQGQWPPPPPGPPHQYPQHPQHPT 599 Query: 383 XGGGXXPPPPPPXXFFFXP 439 P PPP FF P Sbjct: 600 PPPHITPSPPPN---FFPP 615 >UniRef50_Q5AL62 Cluster: Putative uncharacterized protein; n=1; Candida albicans|Rep: Putative uncharacterized protein - Candida albicans (Yeast) Length = 115 Score = 40.3 bits (90), Expect = 0.056 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP P PPPP P Sbjct: 16 PPPPPPPPQPPPPPPQPPPPPPSLLPQPPPPPPLLSPP 53 >UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; n=1; Candida albicans|Rep: Putative uncharacterized protein BNI1 - Candida albicans (Yeast) Length = 1732 Score = 40.3 bits (90), Expect = 0.056 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXX---PPPPPP 418 PPPP PPPPP GG PPPPPP Sbjct: 1051 PPPPPPPPPPPPPPLPPILGGNNSSAAPPPPPP 1083 Score = 38.7 bits (86), Expect = 0.17 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP PPPPP G G PP PP Sbjct: 1066 PPILGGNNSSAAPPPPP-----PPPPPPAFLNGSGSVIPPAPP 1103 >UniRef50_Q0UAV3 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 636 Score = 40.3 bits (90), Expect = 0.056 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PP PP PPPPP G PPPPP Sbjct: 502 PPPPAGARGFSQAPPFPPGAPPFPPPPPMANQYAGQQFPPPPP 544 Score = 38.3 bits (85), Expect = 0.23 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPPF GG PPPPP P PPP Sbjct: 542 PPPFQPGAFPGGIPPPPPPNYIGPFPPP 569 Score = 37.1 bits (82), Expect = 0.52 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +2 Query: 326 PPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 525 PPPPPMANQYAGQQFPPPPPFQPGAFPGGIPPPPPP 560 Score = 35.9 bits (79), Expect = 1.2 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-----PPPPPXXXXXGGGXXPPPPP 415 PPP + PPPPP PPPPP G PPPPP Sbjct: 527 PPPMANQYAGQQFPPPPPFQPGAFPGGIPPPPPPNYI---GPFPPPPP 571 >UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 795 Score = 40.3 bits (90), Expect = 0.056 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPP PPPPP G PPPPPP Sbjct: 400 PPSIPSSLPARNTAPPPPPAPPAPPPPP----INSGPPPPPPPP 439 Score = 33.1 bits (72), Expect = 8.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PP P P Sbjct: 301 PPPPPG----PPPPPGPPPPPGPPPPPGPAP 327 >UniRef50_Q15942 Cluster: Zyxin; n=27; Theria|Rep: Zyxin - Homo sapiens (Human) Length = 572 Score = 40.3 bits (90), Expect = 0.056 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXG-----GGXXPPPPPPXXFFFXP 439 G PPPPP PPPP GG PPPPPP F P Sbjct: 61 GEIPPPPPEDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPP 106 Score = 35.9 bits (79), Expect = 1.2 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP F PP P P PPP GG P PPPP Sbjct: 97 PPPIEESF-----PPAPLEEEIFPSPPPPPEEEGGPEAPIPPPP 135 >UniRef50_O10270 Cluster: 61 kDa protein homolog; n=1; Orgyia pseudotsugata MNPV|Rep: 61 kDa protein homolog - Orgyia pseudotsugata multicapsid polyhedrosis virus (OpMNPV) Length = 474 Score = 40.3 bits (90), Expect = 0.056 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 6/50 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX------PPPPPXXXXXGGGXXPPPPPP 418 PPPF PPPPP PPPPP PPPPPP Sbjct: 269 PPPFPSADVTTSMPPPPPPFPSADVTTSMPPPPPMVDLATSMPPPPPPPP 318 >UniRef50_Q95JC9 Cluster: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)]; n=10; Eukaryota|Rep: Basic proline-rich protein precursor [Contains: Proline-rich peptide SP-A (PRP-SP-A); Proline-rich peptide SP-B (PRP-SP-B); Parotid hormone (PH-Ab)] - Sus scrofa (Pig) Length = 676 Score = 40.3 bits (90), Expect = 0.056 Identities = 28/84 (33%), Positives = 32/84 (38%), Gaps = 6/84 (7%) Frame = +2 Query: 185 KKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPP---PFXXXFXKGGXPPPPPXXXXX 355 K + PPP G + PP E G+ + PP P G PPP P Sbjct: 33 KFLRPPPG----GGPPRPPPPEESQGEGHQKRPRPPGDGPEQGPAPPGARPPPGPPPPGP 88 Query: 356 PPP---PPXXXXXGGGXXPPPPPP 418 PPP PP G P PPPP Sbjct: 89 PPPGPAPPGARPPPGPPPPGPPPP 112 Score = 37.9 bits (84), Expect = 0.30 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPP P PPPP G PPPPPP Sbjct: 382 PPPPGPAPPGARPPPGPPPPG--PPPPGPAPPGARPPPPPPPP 422 Score = 37.9 bits (84), Expect = 0.30 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP P PPPPPP Sbjct: 620 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPPP 662 Score = 35.9 bits (79), Expect = 1.2 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 452 PPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 497 Score = 35.5 bits (78), Expect = 1.6 Identities = 27/79 (34%), Positives = 27/79 (34%), Gaps = 5/79 (6%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPP--PFXXXFXKGGXPPPPPXXXXXPPP-- 364 PPP P G PP G PP P G PPP P PPP Sbjct: 247 PPPGPPPLGPP---PPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGP 303 Query: 365 -PPXXXXXGGGXXPPPPPP 418 PP G P PPPP Sbjct: 304 APPGARPPPGPPPPGPPPP 322 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 88 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 133 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 109 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 154 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 130 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 175 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 151 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 196 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 172 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 217 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 193 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 238 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 235 PPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGPPPP 280 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 298 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 343 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 319 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 364 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 340 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 385 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 361 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 406 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 473 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 518 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 494 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 539 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 515 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 560 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 536 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 581 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 557 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 602 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 578 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 623 Score = 35.1 bits (77), Expect = 2.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPP---PPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP PP G P PPPP Sbjct: 599 PPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 644 Score = 33.9 bits (74), Expect = 4.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP G PPP P PPP P G PP PPP Sbjct: 214 PPPPGPAPPGARPPPGPPPPGPPPPGPAPP---GARPPPGPPP 253 Score = 33.1 bits (72), Expect = 8.5 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +2 Query: 320 GXPPP-PPXXXXXPP---PPPXXXXXGGGXXPPPPPP 418 G PPP PP PP PPP G PP PPP Sbjct: 635 GPPPPGPPPPGPAPPGARPPPGPPPPPPGPSPPRPPP 671 >UniRef50_Q96EP5 Cluster: DAZ-associated protein 1; n=39; Euteleostomi|Rep: DAZ-associated protein 1 - Homo sapiens (Human) Length = 407 Score = 40.3 bits (90), Expect = 0.056 Identities = 25/75 (33%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGK-FXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 PPP PF PP + F PP F + G PPPPP P PP Sbjct: 256 PPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGY---GPPPPPPDQFAPPGVPPP 312 Query: 374 XXXXGGGXXPPPPPP 418 G PPPP Sbjct: 313 PATPGAAPLAFPPPP 327 Score = 33.1 bits (72), Expect = 8.5 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +2 Query: 287 PPPFXXXFXK---GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPF GG PPP PP G PPPPPP F Sbjct: 259 PPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYG----PPPPPPDQF 304 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 39.9 bits (89), Expect = 0.074 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGG--GXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 6 PPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPPP 38 Score = 33.9 bits (74), Expect = 4.9 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP G PPPPP PPPPP Sbjct: 11 PPPPPPPPPPLGAPPPPPLGAPPPPPPP 38 >UniRef50_UPI0000E4A721 Cluster: PREDICTED: similar to LOC397922 protein; n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to LOC397922 protein - Strongylocentrotus purpuratus Length = 392 Score = 39.9 bits (89), Expect = 0.074 Identities = 29/84 (34%), Positives = 31/84 (36%), Gaps = 10/84 (11%) Frame = +2 Query: 197 PPP--QIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXK-----GGXPPPPPXXXXX 355 PPP IP + PP + K PPP K PPPPP Sbjct: 181 PPPTSSIPSRNSRAPPPPKRDPPSKGST-PPPPPPQGRIDNKLSNGPSTGPPPPPPSRQP 239 Query: 356 P---PPPPXXXXXGGGXXPPPPPP 418 P PPPP G PPPPPP Sbjct: 240 PGGRPPPPPRDTPRPGTAPPPPPP 263 Score = 34.7 bits (76), Expect = 2.8 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 12/56 (21%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP----PXXXXXPPPPPXXXXXG--------GGXXPPPPPP 418 PPP GG PPPP P PPPPP G PPPPP Sbjct: 231 PPPPPSRQPPGGRPPPPPRDTPRPGTAPPPPPPSRSQGRPPSTVSSSSSRAPPPPP 286 Score = 34.3 bits (75), Expect = 3.7 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPPP P PP GG PPPPPP Sbjct: 282 PPPPPNRTSTGHSAPPPPSRDKGPRPP---SIVGG---PPPPPP 319 >UniRef50_Q08D38 Cluster: LOC779576 protein; n=3; Xenopus tropicalis|Rep: LOC779576 protein - Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Length = 1222 Score = 39.9 bits (89), Expect = 0.074 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 3/77 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXX---GKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 PPP +P G CPP F PPP PPPPP PP P Sbjct: 880 PPPPLPN-GTAFPCPPPPPPPLPLSLFGSGIPPPPPLPNGISILNAPPPPPP---PPPLP 935 Query: 368 PXXXXXGGGXXPPPPPP 418 P P PPPP Sbjct: 936 PDIGMASAAGFPVPPPP 952 Score = 36.3 bits (80), Expect = 0.91 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 9/53 (16%) Frame = +2 Query: 287 PPPFXXXFXKG-GXPPPPPXXXXX--------PPPPPXXXXXGGGXXPPPPPP 418 PP F G G PPPPP PPPPP PPPPPP Sbjct: 846 PPAPPSSFIPGIGVPPPPPLPSNLYFDSQHPMPPPPPPLPNGTAFPCPPPPPP 898 Score = 34.7 bits (76), Expect = 2.8 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFF 433 PPPP PP PP G G PPPP P +F Sbjct: 842 PPPP-----PPAPPSSFIPGIGVPPPPPLPSNLYF 871 Score = 34.7 bits (76), Expect = 2.8 Identities = 24/72 (33%), Positives = 26/72 (36%), Gaps = 1/72 (1%) Frame = +2 Query: 197 PPPQIPF-WGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 PPP PF G + P G + PPP F G P P P PPPPP Sbjct: 978 PPPPPPFPLGIGSR--PTSPSMGNYRP-PPPPPPLPVAFL-GSSPSPLPCSGPAPPPPPP 1033 Query: 374 XXXXGGGXXPPP 409 G PP Sbjct: 1034 PPPFPGSVPIPP 1045 Score = 33.5 bits (73), Expect = 6.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPPP P G PPPPPP F Sbjct: 1004 PPPPPLPVAFLGSSPSPLPCSGPAPPPPPPPPPF 1037 Score = 33.1 bits (72), Expect = 8.5 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPP----PPPXXXXXGGGXXPPPPPPXXF 427 PP G P PPP PP P G PPPPPP F Sbjct: 935 PPDIGMASAAGFPVPPPPAPPLPPGMGVSPSLPSSIGMPPPPPPPPPPPF 984 Score = 33.1 bits (72), Expect = 8.5 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 8/46 (17%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPP--------PXXXXXGGGXXPPPPPPXXFFF 433 G PPPPP PPPP P G PPPPPP F Sbjct: 971 GMPPPPPPP---PPPPFPLGIGSRPTSPSMGNYRPPPPPPPLPVAF 1013 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 642,202,577 Number of Sequences: 1657284 Number of extensions: 16573204 Number of successful extensions: 241063 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 33001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134669 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 69966202150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -