BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D22 (810 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 52 3e-07 At1g61080.1 68414.m06877 proline-rich family protein 50 1e-06 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 47 2e-05 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 44 2e-04 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 43 3e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 43 3e-04 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 42 5e-04 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 42 5e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 42 5e-04 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 41 8e-04 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 41 0.001 At4g08410.1 68417.m01390 proline-rich extensin-like family prote... 40 0.001 At1g75550.1 68414.m08780 glycine-rich protein 40 0.001 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 40 0.001 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 40 0.002 At4g18570.1 68417.m02749 proline-rich family protein common fami... 40 0.003 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 40 0.003 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 40 0.003 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 39 0.003 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 39 0.003 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 39 0.003 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 39 0.005 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 38 0.006 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 38 0.006 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 38 0.006 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 38 0.006 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 38 0.006 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 38 0.008 At4g08400.1 68417.m01388 proline-rich extensin-like family prote... 38 0.008 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 38 0.008 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 38 0.010 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 38 0.010 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 38 0.010 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 38 0.010 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 38 0.010 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 37 0.018 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 37 0.018 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 37 0.018 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 36 0.024 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 36 0.024 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 36 0.024 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 36 0.024 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 36 0.032 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 36 0.042 At3g54580.1 68416.m06039 proline-rich extensin-like family prote... 36 0.042 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 35 0.056 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 35 0.056 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 35 0.056 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 35 0.073 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 35 0.073 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 35 0.073 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 35 0.073 At1g15830.1 68414.m01900 expressed protein 35 0.073 At5g49080.1 68418.m06074 proline-rich extensin-like family prote... 34 0.097 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 34 0.097 At5g06640.1 68418.m00750 proline-rich extensin-like family prote... 34 0.097 At5g06630.1 68418.m00749 proline-rich extensin-like family prote... 34 0.097 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 34 0.097 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 34 0.097 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 34 0.097 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 34 0.097 At5g35190.1 68418.m04170 proline-rich extensin-like family prote... 34 0.13 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 34 0.13 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 34 0.13 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 34 0.13 At1g26150.1 68414.m03192 protein kinase family protein similar t... 34 0.13 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 33 0.17 At1g02710.1 68414.m00222 glycine-rich protein 33 0.17 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 33 0.17 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 33 0.22 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 33 0.30 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 33 0.30 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 33 0.30 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 32 0.39 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 32 0.39 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 32 0.39 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 32 0.39 At2g30560.1 68415.m03722 glycine-rich protein 32 0.39 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 32 0.52 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 32 0.52 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 32 0.52 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 32 0.52 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 32 0.52 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 32 0.52 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 32 0.52 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 31 0.68 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 0.68 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 31 0.68 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 31 0.68 At3g24550.1 68416.m03083 protein kinase family protein contains ... 31 0.68 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 31 0.68 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 31 0.68 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 0.90 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 31 0.90 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 31 0.90 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 31 0.90 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 31 0.90 At1g70990.1 68414.m08190 proline-rich family protein 31 0.90 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 31 0.90 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 31 0.90 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 31 0.90 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 31 1.2 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 31 1.2 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 31 1.2 At4g33660.1 68417.m04781 expressed protein 31 1.2 At3g51290.1 68416.m05614 proline-rich family protein 31 1.2 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 31 1.2 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 30 1.6 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 30 1.6 At4g30460.1 68417.m04325 glycine-rich protein 30 1.6 At4g21720.1 68417.m03145 expressed protein 30 1.6 At4g01985.1 68417.m00265 expressed protein 30 1.6 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 30 1.6 At3g24540.1 68416.m03082 protein kinase family protein contains ... 30 1.6 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 30 1.6 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 30 1.6 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 30 1.6 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 30 1.6 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 30 1.6 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 30 1.6 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 30 1.6 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 30 1.6 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 30 1.6 At1g49270.1 68414.m05524 protein kinase family protein contains ... 30 1.6 At1g29380.1 68414.m03592 hypothetical protein 30 1.6 At5g46730.1 68418.m05757 glycine-rich protein 30 2.1 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 30 2.1 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 30 2.1 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 30 2.1 At3g50180.1 68416.m05486 hypothetical protein 30 2.1 At3g18810.1 68416.m02389 protein kinase family protein contains ... 30 2.1 At3g08640.1 68416.m01003 alphavirus core protein family contains... 30 2.1 At1g27710.1 68414.m03387 glycine-rich protein 30 2.1 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 30 2.1 At1g07135.1 68414.m00759 glycine-rich protein 30 2.1 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 27 2.5 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 24 2.6 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 25 2.6 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 29 2.8 At4g08230.1 68417.m01358 glycine-rich protein 29 2.8 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 29 2.8 At3g21215.1 68416.m02681 RNA-binding protein, putative contains ... 29 2.8 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 2.8 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 29 2.8 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 29 2.8 At1g62240.1 68414.m07021 expressed protein 29 2.8 At1g15840.1 68414.m01901 expressed protein 29 2.8 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 29 3.7 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 29 3.7 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 29 3.7 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 29 3.7 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 29 3.7 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 29 3.7 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 29 3.7 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 3.7 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 29 3.7 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 29 3.7 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 29 3.7 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 29 3.7 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 28 4.2 At5g04170.1 68418.m00405 calcium-binding EF hand family protein ... 26 4.4 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 29 4.8 At5g56140.1 68418.m07003 KH domain-containing protein 29 4.8 At5g53060.1 68418.m06592 KH domain-containing protein 29 4.8 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 29 4.8 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 29 4.8 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 29 4.8 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 29 4.8 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 29 4.8 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 29 4.8 At1g53625.1 68414.m06096 expressed protein 29 4.8 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 29 4.8 At4g22770.1 68417.m03287 DNA-binding family protein contains a A... 25 5.7 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 28 6.4 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 28 6.4 At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family... 28 6.4 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 28 6.4 At3g04160.1 68416.m00440 expressed protein ; expression supporte... 28 6.4 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 28 6.4 At2g44790.1 68415.m05574 uclacyanin II strong similarity to ucla... 28 6.4 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 28 6.4 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 28 6.4 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 6.4 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 6.4 At1g55160.1 68414.m06299 expressed protein 28 6.4 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 28 6.4 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 23 6.9 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 28 8.4 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 28 8.4 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 28 8.4 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 28 8.4 At3g16510.1 68416.m02107 C2 domain-containing protein contains s... 28 8.4 At2g05440.2 68415.m00575 glycine-rich protein 28 8.4 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 28 8.4 At1g07280.1 68414.m00774 expressed protein 28 8.4 At3g54220.1 68416.m05993 scarecrow transcription factor, putativ... 23 9.1 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 52.4 bits (120), Expect = 3e-07 Identities = 30/73 (41%), Positives = 33/73 (45%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP++P + PP GK PP GG PPPPP PPPPP Sbjct: 648 PPRVP------RPPPRSAGGGKSTNLPSARPPLPG----GGPPPPPPPPGGGPPPPP--- 694 Query: 380 XXGGGXXPPPPPP 418 GGG PPPPPP Sbjct: 695 --GGGPPPPPPPP 705 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGG 394 GG PPPP PPPPP G G Sbjct: 688 GGPPPPPGGGPPPPPPPPGALGRGAG 713 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGG 394 GG PPPPP PPPPP G G Sbjct: 687 GGGPPPPPG-GGPPPPPPPPGALGRG 711 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGG 355 G PPP G GGG PPP G GGG Sbjct: 677 GGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGG 715 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGG 355 G PPP G GGG PPP G GG Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGG 714 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 2/81 (2%) Frame = +2 Query: 182 LKKITPPPQIP--FWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX 355 LK PPP P F K PP PPP PPPPP Sbjct: 487 LKHFAPPPPTPPAFKPLKGSAPPPPP-----------PPPLPTTIAAPPPPPPPPRAAVA 535 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPPP Sbjct: 536 PPPPPPPPGTAAAPPPPPPPP 556 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/78 (34%), Positives = 29/78 (37%), Gaps = 4/78 (5%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX----PPP 364 PPP P G + PP + P P G PPPPP PPP Sbjct: 549 PPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPP 608 Query: 365 PPXXXXXGGGXXPPPPPP 418 PP G PPPPPP Sbjct: 609 PPPMAMANGAAGPPPPPP 626 Score = 46.0 bits (104), Expect = 3e-05 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP G PPP PPPPP P PPP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP-PGTQAAPPPPPPPPMQNRAPSPPPMP 581 Query: 377 XXXGGGXXPPPPPP 418 G PPPPPP Sbjct: 582 MGNSGSGGPPPPPP 595 Score = 45.2 bits (102), Expect = 5e-05 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 3/82 (3%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP---PXXXX 352 LK PPP P PP F PP F PPPP P Sbjct: 469 LKHFAPPPPPPL-------PPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIA 521 Query: 353 XPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPPP Sbjct: 522 APPPPPPPPRAAVAPPPPPPPP 543 Score = 45.2 bits (102), Expect = 5e-05 Identities = 27/80 (33%), Positives = 27/80 (33%), Gaps = 7/80 (8%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX------- 355 PPP P PP G PPP G PPPPP Sbjct: 564 PPPPPPMQNRAPSPPPMP--MGNSGSGGPPPPPPPMPLANGATPPPPPPPMAMANGAAGP 621 Query: 356 PPPPPXXXXXGGGXXPPPPP 415 PPPPP G PPPPP Sbjct: 622 PPPPPRMGMANGAAGPPPPP 641 Score = 38.3 bits (85), Expect = 0.006 Identities = 26/79 (32%), Positives = 28/79 (35%), Gaps = 3/79 (3%) Frame = +2 Query: 191 ITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXX---PP 361 + PPP P G PP G PPP + PPP P PP Sbjct: 534 VAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP--PMQNRAPSPPPMPMGNSGSGGPP 591 Query: 362 PPPXXXXXGGGXXPPPPPP 418 PPP G PPPPP Sbjct: 592 PPPPPMPLANGAT-PPPPP 609 Score = 35.9 bits (79), Expect = 0.032 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 9/53 (16%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP---------XXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PP PP G PPPPPP Sbjct: 462 PPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Score = 35.5 bits (78), Expect = 0.042 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 454 PPPPP-----PPPPPPAVMPLKHFAPPPPPP 479 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP P PPP Sbjct: 416 PPPPPP----PPPPPLSFIKTASLPLPSPPP 442 Score = 31.1 bits (67), Expect = 0.90 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP F K P P PPP P PPPPPP Sbjct: 422 PPPPPLSFIKTASLPLPS-----PPPTPPIADIAISMPPPPPPP 460 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = +2 Query: 326 PPPP---PXXXXXPPPPPXXXXXG---GGXXPPPPPPXXF 427 PPPP P PPPPP PPPP P F Sbjct: 461 PPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAF 500 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 46.8 bits (106), Expect = 2e-05 Identities = 22/46 (47%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKG-GXPP-PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP KG PP PPP PPPPP G G PPPPP Sbjct: 235 PPPLPMAVRKGVAAPPLPPPGTAALPPPPPLPMAAGKGVAAPPPPP 280 Score = 35.1 bits (77), Expect = 0.056 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP G PP PP Sbjct: 224 PPPPGRAALPPPPPLPMAVRKGVAAPPLPP 253 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP P PP P PPP Sbjct: 196 PPPPPGNAAIPVEPPLTMSAEKESYAPLPPP 226 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP PPPPP G G PPPPPP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAG--PPPPPP 426 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +2 Query: 260 GKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G+F P P PPPPP PPPPP G PPPPPP Sbjct: 364 GQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPP--PKKGPAAPPPPPPP 414 Score = 42.7 bits (96), Expect = 3e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPP G PPPPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 36.7 bits (81), Expect = 0.018 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 585 KXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGG--GPPXXG 719 K P PPPPPP KK P P K P PPG GP G Sbjct: 402 KKGPAAPPPPPPPG--KKGAGPPPPPPMSKKGPPKPPGNPKGPTKSG 446 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPP G PP P Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP--XXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPPP G PP PP Sbjct: 396 PPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKG----PPKPP 436 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG 388 PPP KG PPPPP PP P G Sbjct: 408 PPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKG 441 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 3/39 (7%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPP---GGGPP 710 PPPPPP P P PP G GPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPP 422 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 42.7 bits (96), Expect = 3e-04 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPP P + + P Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPP 427 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 G PP PP PPPPP PPPPPP + P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP 413 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPP PP + P Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP PPPPP P PPP PPPPPP + Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVY 434 Score = 38.3 bits (85), Expect = 0.006 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP P PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 34.3 bits (75), Expect = 0.097 Identities = 23/79 (29%), Positives = 26/79 (32%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP + PPPPP PPP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYV---YPPPPPPYVYPPPPSPPY 442 Query: 377 XXXGGGXXPPPPPPXXFFF 433 PPPP P + + Sbjct: 443 V-----YPPPPPSPQPYMY 456 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGP 707 P PPPPPP P P P PP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPP 695 P PPPPPP P P P PP Sbjct: 397 PPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/76 (30%), Positives = 27/76 (35%), Gaps = 2/76 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXX--FXKGGXPPPPPXXXXXPPPPP 370 PPP +P + + + K PPP PPPP PPPPP Sbjct: 548 PPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Query: 371 XXXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 608 SSRSIPSPSAPPPPPP 623 Score = 39.5 bits (88), Expect = 0.003 Identities = 25/76 (32%), Positives = 27/76 (35%), Gaps = 2/76 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P + PP + PPP PPPPP PPPP Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPP------PPPPSF 628 Query: 377 XXXGG--GXXPPPPPP 418 G PPPPPP Sbjct: 629 GSTGNKRQAQPPPPPP 644 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPP 409 PPP K PPPPP PPPP G PPP Sbjct: 715 PPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP F K PPPP PPPPP PPPPPP Sbjct: 625 PPSFGSTGNKRQAQPPPPP----PPPPPTRIPAAKCAPPPPPPP 664 Score = 38.3 bits (85), Expect = 0.006 Identities = 24/80 (30%), Positives = 27/80 (33%), Gaps = 6/80 (7%) Frame = +2 Query: 197 PPPQIPFWGXKKKC----PPXXEXXGKFXX*KXXPPPFXXX--FXKGGXPPPPPXXXXXP 358 PPP G K++ PP + K PPP G PP P Sbjct: 624 PPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPP 683 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 PPPP PP PPP Sbjct: 684 PPPPPKANISNAPKPPAPPP 703 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP + G PPPPP P P PPPPP Sbjct: 701 PPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 7/38 (18%) Frame = +2 Query: 326 PPPPPXXXXX-------PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP P G PPPPPP Sbjct: 684 PPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Score = 31.5 bits (68), Expect = 0.68 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGG--GXXPPPPPPXXFF 430 PP F PPPP PPPPP PPPPPP F Sbjct: 511 PPLFMSTTSFSPSQPPPP-----PPPPPLFTSTTSFSPSQPPPPPPLPSF 555 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPP Sbjct: 482 PPPPPP----PPPPLFTSTTSFSPSQPPPPP 508 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 4/52 (7%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP----XXXXXGGGXXPPPPPPXXFF 430 PPP PPP PPPPP PPPPPP F Sbjct: 489 PPPLFTSTTSFSPSQPPP-----PPPPPPLFMSTTSFSPSQPPPPPPPPPLF 535 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP + K P PP PP Sbjct: 543 PSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPP 581 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 6/46 (13%) Frame = +3 Query: 600 GPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPG------GGPPXXG 719 G PPPPP K P P PPG GPP G Sbjct: 712 GAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLG 757 Score = 27.1 bits (57), Expect(2) = 0.84 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 PPPPPP P P PP PP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 23.4 bits (48), Expect(2) = 6.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 594 PXGPPPPPP 620 P PPPPPP Sbjct: 615 PSAPPPPPP 623 Score = 23.0 bits (47), Expect(2) = 6.6 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPP 695 PPPPPP P P P PP Sbjct: 659 PPPPPPPTSHSGSIRVGP--PSTPPPPPPPP 687 Score = 22.6 bits (46), Expect(2) = 0.84 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 594 PXGPPPPPP 620 P PPPPPP Sbjct: 525 PPPPPPPPP 533 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 41.9 bits (94), Expect = 5e-04 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P K PP K PPP+ PPPP PPPP Sbjct: 77 PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPY 136 Query: 377 XXXGGGXXPPPPP 415 PPPPP Sbjct: 137 TPPPPTVKPPPPP 149 Score = 39.1 bits (87), Expect = 0.003 Identities = 28/77 (36%), Positives = 30/77 (38%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP IP CPP K K PPP+ PPPPP PPPPP Sbjct: 69 PPPYIP-------CPPPPYTP-KPPTVKPPPPPYVK-------PPPPPT--VKPPPPPYV 111 Query: 377 XXXGGGXXPPPPPPXXF 427 PPPPP + Sbjct: 112 KPPPPPTVKPPPPPTPY 128 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P+ PPPP P P P P PPPP Sbjct: 133 PTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 41.9 bits (94), Expect = 5e-04 Identities = 26/85 (30%), Positives = 30/85 (35%), Gaps = 3/85 (3%) Frame = +2 Query: 194 TPPPQIPFWGXKKKC---PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP 364 +PPP P + PP + PPP PPPPP PPP Sbjct: 409 SPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPP 468 Query: 365 PPXXXXXGGGXXPPPPPPXXFFFXP 439 PP PPPPPP + P Sbjct: 469 PP----------PPPPPPPPVYSPP 483 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/54 (37%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXP---PPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPPPP P PPPP PPPPPP + P Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPP 513 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPPP PPPPP Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPP PP Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPP 488 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/76 (31%), Positives = 26/76 (34%), Gaps = 2/76 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP--XXXXXPPPPP 370 PPP P + PP + PPP PPPPP PPPPP Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Query: 371 XXXXXGGGXXPPPPPP 418 PPPP P Sbjct: 517 VY-----SSPPPPPSP 527 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPPPP + P Sbjct: 609 PPPPPPCIEPPPPPPCIE-----YSPPPPPPVVHYSSP 641 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPP-----PPPPXXFFFXP 439 PPPPP PPPPP PP PPPP ++ P Sbjct: 619 PPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSP 661 Score = 37.1 bits (82), Expect = 0.014 Identities = 23/81 (28%), Positives = 25/81 (30%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P + PP PPP P P P PPPPP Sbjct: 488 PPPPPPVYSPPPPPPPPPPPPVY----SPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPH 543 Query: 377 XXXGGGXXPPPPPPXXFFFXP 439 PPPP P + P Sbjct: 544 SPPPPQFSPPPPEPYYYSSPP 564 Score = 35.1 bits (77), Expect = 0.056 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGG-----XXPPPPPPXXFFFXP 439 PPP PPPP PPPPP PPPPPP + P Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSPP 673 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/76 (26%), Positives = 24/76 (31%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP P + PP + PPP + PPP P PPPP Sbjct: 512 PPPPPVYSSPPP-PPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSP 570 Query: 380 XXGGGXXPPPPPPXXF 427 P PPP + Sbjct: 571 PPHSPPPPHSPPPPIY 586 Score = 33.5 bits (73), Expect = 0.17 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP + PPPPP PPPPP PPPP + P Sbjct: 641 PPPPPVYYSS---PPPPPVYYSSPPPPPPVHYSS------PPPPEVHYHSP 682 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 469 PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 452 PPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 31.9 bits (69), Expect = 0.52 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP PP P PPP P Sbjct: 540 PPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVS 599 Query: 377 XXXGGGXXPPPPPP 418 PPPPP Sbjct: 600 SPPPTPVYSPPPPP 613 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 P PPP PPP P PPPP P + P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSP 438 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P PP PP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P P PP Sbjct: 484 PPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPP 522 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 7/57 (12%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPP-------XXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP P PPP PPPP PPPPPP + P Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPP 452 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 PPPPPP + P P P P PP Sbjct: 537 PPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPP 572 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP + PPP P PPPPP PPP P Sbjct: 672 PPPPEVHYHS---PPPSPVHYSSPPPPPSAPCE---ESPPPAP 708 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P PP PP Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPP 489 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP P P P P PP Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPP P P P PP PP Sbjct: 455 PPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPPPP P Sbjct: 50 PPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKP 87 Score = 35.9 bits (79), Expect = 0.032 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 42 PPPPPPPPPPPPPPPP---------PPPPPP 63 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 335 PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PPPPP PPPPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPP 62 Score = 31.9 bits (69), Expect = 0.52 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 1/75 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-PXXXXXPPPPPX 373 PPP P PP PPP PPPP P PPP P Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 Query: 374 XXXXGGGXXPPPPPP 418 PPP P Sbjct: 108 QKNLPRRHPPPPRSP 122 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P PP PPP K PPPP PPP Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKP 106 Query: 377 XXXGGGXXPPPPP 415 PPPP Sbjct: 107 PQKNLPRRHPPPP 119 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPP PPPPPP Sbjct: 19 PPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPP 62 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +2 Query: 326 PPPPPXXXXXPP-PPPXXXXXGGGXXPPPPPP 418 PPPPP P PPP PPPPPP Sbjct: 17 PPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPP 48 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPP 695 PPPPPP ++ P P + P PP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPP 46 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPPP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPP 36 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGP 707 ++ P PPPPPP +++ P P + P PP P Sbjct: 24 RRRAPLPPPPPPP--LMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 599 RAPPPPPXXXXKKKXXPXPXXXPXXKXXTXXP 694 RAPPPPP +++ P P P + + P Sbjct: 41 RAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/58 (27%), Positives = 19/58 (32%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP P + PP + PPP + PPPPP P P Sbjct: 16 PPPPPPLMRRRAPLPPPPPPP--LMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRP 71 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP G PPPPPP Sbjct: 246 PPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 338 PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPPPP PPPPPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 570 FXXXKKXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGP 707 F K PPPPPP K+ P P P PP P Sbjct: 234 FEFVKPDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 585 KXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 K P PPPPPP K+ P P K P PP Sbjct: 238 KPDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 P PPP PPPPP PPPPP Sbjct: 241 PTPPP-----PPPPPIPVKQSATPPPPPPP 265 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 7/51 (13%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP---XXXXXPPPPP----XXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP PPP P Sbjct: 248 PPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAP 298 >At4g08410.1 68417.m01390 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 707 Score = 40.3 bits (90), Expect = 0.001 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPPP PPPP PPPP + F P Sbjct: 461 PPPYYSPSPKVDYKPPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSFPP 511 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP G PPPP + P Sbjct: 136 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPP 186 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ KG PPP PPPP PPPP + P Sbjct: 161 PPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 211 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 261 PPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPP 311 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 311 PPPYYSPSPKVNYKSPPPPYVYGSPPPPYYSPSPKVDYKSPPPPYVYSSPP 361 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 536 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYIYSSPP 586 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 186 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 236 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 211 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 261 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 336 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSTP 386 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 386 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYIYSSTP 436 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 511 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 561 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 586 PPPYYAPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 636 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 611 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 661 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 236 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPP 286 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 286 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYGSPP 336 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 561 PPPYYSPSPKVEYKSPPPPYIYSSPPPPYYAPSPKVDYKSPPPPYVYSSPP 611 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 P P+ K PPP PPPP PPPPP + P Sbjct: 436 PLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKPPPPPYVYSSPP 486 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 486 PPPYYSPSPKVDYKSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYVYSSPP 536 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPP PPPP + P Sbjct: 361 PPPYYSPSPKVDYKSPPPPYVYSSTPPPYYSPSPKVDYKSPPPPYVYSSPP 411 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PP PPPP PPPP + P Sbjct: 111 PPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 161 Score = 29.1 bits (62), Expect = 3.7 Identities = 22/72 (30%), Positives = 24/72 (33%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP P + PP K K PPP+ F P P PPPP Sbjct: 475 PPP--PPYVYSSPPPPYYSPSPKVDY-KSPPPPYVYSFPPPPYYSPSPKVDYKSPPPPYV 531 Query: 377 XXXGGGXXPPPP 412 PPPP Sbjct: 532 Y-----SSPPPP 538 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP+ K PPP PPPP Sbjct: 636 PPPYYSPSPKVNYKSPPPPYVYSSPPPP 663 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/51 (41%), Positives = 23/51 (45%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G + GGGGGG GGGGG + GGGGG K GGG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGGXXF 278 GGGGGG GGGGG + GGG + Sbjct: 74 GGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWY 105 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 40.3 bits (90), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%) Frame = -1 Query: 432 KKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 K GGGGGG PP G GGG GG GG PP GGG Sbjct: 39 KPPQHGGGGGGGSKPP-PHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGG 86 Score = 34.3 bits (75), Expect = 0.097 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G K GG GG PPP G GGG GGGGG Sbjct: 50 GSKPPPHHGGKGGGKPPP---HGGKGGGPPHHGGGGGG 84 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPP---PPP 415 PPP KGG PPP PP GGG PP PPP Sbjct: 53 PPPHHGG--KGGGKPPPHGGKGGGPPHHGGGGGGGGKSPPVVRPPP 96 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGG 355 G PPP G K GG GG PP GGGGG Sbjct: 50 GSKPPPHHGGKGGGKPPPHGGKGGG--PPHHGGGGGGGG 86 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPP 385 G PPP G GGGGGG PP Sbjct: 62 GGKPPPHGGKGGGPPHHGGGGGGGGKSPP 90 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPPPP PPPP PPPPPP ++ Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYY 57 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFF 433 PPPPP P PPP PPPPPP ++ Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYY 57 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 PPPPPP ++ P P PP PP Sbjct: 47 PPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPP 82 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 P PP PPPPP PPPP + + P Sbjct: 12 PQPPSQNSLAPPPPPPSLPPP--VPPPPPSHQPYSYPP 47 Score = 28.3 bits (60), Expect = 6.4 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 11/55 (20%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP----XXXXXPPPPPXXXXXGGGXXP-------PPPPP 418 PPP PPPP PPPPP G P PPPPP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPP 76 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 +K P PPPPPP ++ P P K P PP PP Sbjct: 306 QKSIPPPPPPPPPPLLQQP-----PPPPSVSKAPPPPPPPPPP 343 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPPP PPPPP Sbjct: 303 PPPQKSIPPPPPPPPPPLL---QQPPPPP 328 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP Sbjct: 303 PPPQKSIPPPPPPPPPPL---LQQPPPPP 328 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/51 (39%), Positives = 21/51 (41%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 G PPPPP PPPP GG PPPP + P GG P Sbjct: 249 GGPPPPPHIGGSAPPPPHM----GGSAPPPPHMGQNYGPPPPNNMGGPRHP 295 Score = 37.1 bits (82), Expect = 0.014 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 2/94 (2%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPPQ P G PP G PPP G PPPP PPPP Sbjct: 241 PPPQRPPMGGP---PPPPHIGGS-----APPPPHMG----GSAPPPPHMGQNYGPPPP-- 286 Query: 377 XXXGGGXXPPP--PPPXXFFFXPXXXXXGGGXXP 472 GG PPP PP P GG P Sbjct: 287 NNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPP 320 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 G PPP PPPPP GG PPPP Sbjct: 239 GGPPPQRPPMGGPPPPPHI----GGSAPPPP 265 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPPPP PPPPP G PPPPP F P G G Sbjct: 232 PPPPPPHQAQPPPPPP----SGLFPPPPPPMANNGFRPMPPAGGFG 273 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PPPPP PPPP G PPPPPP Sbjct: 228 GLPPPPPPPPHQAQPPPPPP----SGLFPPPPPP 257 Score = 35.5 bits (78), Expect = 0.042 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP + PPPPP PPPPP G P PP Sbjct: 230 PPPPPPPPHQAQPPPPPPSGLFPPPPPP---MANNGFRPMPP 268 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXPL 475 PPPPP PPPPPP F P G P+ Sbjct: 230 PPPPPPPPHQA---QPPPPPPSGLFPPPPPPMANNGFRPM 266 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP P PPP PPP PP Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPP 1122 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP P PPP PPPPP F Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALF 1100 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXP--PPPPP 418 PPP P PP PPPPP P PPPPP Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPPP P PPP G PPPPPP F Sbjct: 26 PPPPPMRRSAPSPPPM----SGRVPPPPPPPPMF 55 Score = 34.7 bits (76), Expect = 0.073 Identities = 25/77 (32%), Positives = 26/77 (33%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 +I PPP IP PP PPP G P P P P Sbjct: 592 RIRPPPSIPR-------PPSRPRYACCRIPAVNPPPRLVC----GPYPLPRLVRVGSPSP 640 Query: 368 PXXXXXGGGXXPPPPPP 418 P GG PPPPPP Sbjct: 641 PPPSMSGGAPPPPPPPP 657 Score = 31.1 bits (67), Expect = 0.90 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPPP PPPPP PPP Sbjct: 640 PPPPSMSGGAPPPPPPPPMLVASRTAPPP 668 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP 370 PPPPP PPPPP Sbjct: 151 PPPPPMPRRSPPPPP 165 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 P P PPP GG PPPPP Sbjct: 688 PLPLLVREGAPPPTLPSMSGGAPPPPPP 715 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G P P PPP GG PPPP P Sbjct: 685 GTSPLPLLVREGAPPPTLPSMSGGAPPPPPPLP 717 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 7/41 (17%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXG-------GGXXPPPPPPXXFF 430 PP PPPPP G PPPPPP F Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMF 55 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP + PPP PPPPP Sbjct: 24 PPPPPPPMRRSAPSPPPMSGRVPPPPPP 51 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/85 (27%), Positives = 29/85 (34%), Gaps = 4/85 (4%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP----P 364 PPP ++ PP PPP + + PPPP PP P Sbjct: 568 PPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSP 627 Query: 365 PPXXXXXGGGXXPPPPPPXXFFFXP 439 PP P PPPP ++ P Sbjct: 628 PPPSPVYYPPVTPSPPPPSPVYYPP 652 Score = 37.5 bits (83), Expect = 0.010 Identities = 22/85 (25%), Positives = 28/85 (32%), Gaps = 4/85 (4%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP----P 364 PPP ++ PP PPP + PPPP PP P Sbjct: 598 PPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSP 657 Query: 365 PPXXXXXGGGXXPPPPPPXXFFFXP 439 PP PPPP +++ P Sbjct: 658 PPPSPVYYPSETQSPPPPTEYYYSP 682 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP+ P PPP PPPP PPPP P + Sbjct: 514 PPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYY 560 Score = 35.5 bits (78), Expect = 0.042 Identities = 22/83 (26%), Positives = 27/83 (32%), Gaps = 4/83 (4%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP----P 364 PPP ++ PP PPP + PPPP PP P Sbjct: 583 PPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSP 642 Query: 365 PPXXXXXGGGXXPPPPPPXXFFF 433 PP P PPPP ++ Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVYY 665 Score = 33.5 bits (73), Expect = 0.17 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPP-----PPPPXXFFFXP 439 PPP+ PPPPP PPPPP PP PPPP + P Sbjct: 476 PPPYVY-----SSPPPPPYVYSSPPPPPYVY---SSPPPPYVYSSPPPPYVYSSPP 523 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP+ PPPP PPPPP PPPP Sbjct: 505 PPPYVY-----SSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP PPPPP PPPP Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPP-----PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + PP PPP PPPP P PPPP Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPP 532 Score = 31.5 bits (68), Expect = 0.68 Identities = 17/53 (32%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGG--XXPPPPPPXXFFFXP 439 PPP+ PPPP PPPP PPPPP + P Sbjct: 443 PPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPP 495 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP-----PXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP PPPP P PPPP PPPP P + Sbjct: 539 PPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYY 590 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXG--GGXXPPPPP 415 PPP + PPP PPPPP PPPPP Sbjct: 384 PPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAYSPPPPP 428 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 8/39 (20%) Frame = +2 Query: 326 PPPPPXXXXXP------PPPPXXXXXGGGXX--PPPPPP 418 PPPPP P PPPP PPPPPP Sbjct: 424 PPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPP 462 Score = 29.9 bits (64), Expect = 2.1 Identities = 22/86 (25%), Positives = 27/86 (31%), Gaps = 8/86 (9%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPP--------PPXXXX 352 PPP ++ PP + PPP + PPP PP Sbjct: 643 PPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATP 702 Query: 353 XPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPP PPPP P +F Sbjct: 703 SYEPPPEYSYSSS---PPPPSPTSYF 725 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/74 (24%), Positives = 25/74 (33%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP ++ + PP + + + P PPPP PP P Sbjct: 671 SPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPS 730 Query: 374 XXXXGGGXXPPPPP 415 PPPPP Sbjct: 731 VSYDAS---PPPPP 741 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP K P PPP PPPPP PPPPPP Sbjct: 674 PPPISNSDKKPALPRPPP-----PPPPPPMQHSTVTKVPPPPPP 712 Score = 37.1 bits (82), Expect = 0.014 Identities = 24/75 (32%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXP-PPFXXXFXKGGXPPPPPXXXXXPPPPP 370 +PPP P PP + G P PP PPPP PPPPP Sbjct: 726 SPPPPPP--PPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTA---PPPPP 780 Query: 371 XXXXXGGGXXPPPPP 415 PPPPP Sbjct: 781 LGQTRAPSAPPPPPP 795 Score = 35.1 bits (77), Expect = 0.056 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PP P PPPPPP Sbjct: 695 PPPMQHSTVTKVPPPPPPAPPA--PPTPIVHTSSPPPPPPPPPP 736 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PP PPPPP PP P PP PP Sbjct: 717 PPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPP 758 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P PPPPP PP P PP PP Sbjct: 715 PAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPP 758 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -1 Query: 417 GGGGGGXXPP---PXXXXXGGGGGXXFXXGGGGGXPP 316 GGGGGG P GGGGG GGGGG PP Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXK 310 GGGGGG GGGGG GGGGG P K Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPK 142 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -1 Query: 417 GGGGGGXXPP---PXXXXXGGGGGXXFXXGGGGGXPP 316 GGGGGG P GGGGG GGGGG PP Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPP 141 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXK 310 GGGGGG GGGGG GGGGG P K Sbjct: 107 GGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGGPPK 142 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GG GGG P GGGG GGG KKGGG Sbjct: 345 GGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGG 388 Score = 31.5 bits (68), Expect = 0.68 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGGG P GGGGG GGG K K GGG Sbjct: 313 GGGGGG--PGGKKGGPGGGGGNMGNQNQGGG---GKNGGKGGGG 351 Score = 31.5 bits (68), Expect = 0.68 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGG---GGXPPXKKXXKKGGG 286 G GGGG P GGGGG GGG GG PP + GGG Sbjct: 363 GGPNGNKGGGGVQMNGGPNGGKKGGGGGG--GGGGGPMSGGLPPGFRPMGGGGG 414 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 405 GGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GG P G G GGGGG P KK GGG Sbjct: 291 GGGPGPAGGKIEGKGMPFPVQMGGGGGGPGGKKGGPGGGG 330 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G KK GGGGG GGG GGGG P K GGG Sbjct: 320 GGKKGGPGGGGGNMG------NQNQGGGGKNGGKGGGGHPLDGKMGGGGGG 364 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXP 319 G KK GGGGGG P G GGGGG P Sbjct: 382 GGKKG--GGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGGP 419 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPP-----XXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPP + PPPPP PPPPP PPPPPP F Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLPMF 80 Score = 35.1 bits (77), Expect = 0.056 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 +G P PPP PPPPP PPPPPP Sbjct: 18 RGRVPLPPP-----PPPPPPPMRRRAPLPPPPPPP 47 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPP----XXXXXPPPPPXXXXXGGGXXPPPPP 415 PP PPPPP PPPPP PPPPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 32.3 bits (70), Expect = 0.39 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGP 707 PPPPPP +++ P P + P PP P Sbjct: 26 PPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPP 60 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/67 (23%), Positives = 21/67 (31%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPPXXGXXXXXXXXXXXXTKKNXXXKX 782 PPPPPP ++ P + P PP PP T+ Sbjct: 41 PPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYPPTRVRREAPL 100 Query: 783 XPPXXLF 803 PP +F Sbjct: 101 PPPPLIF 107 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 38.3 bits (85), Expect = 0.006 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPPPP PPPPP PPP PP ++ P Sbjct: 745 PPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYS----PPPSPPVYYYNSP 791 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP + PPPP PPPP PPPPP Sbjct: 779 PPPSPPVYYYNSPPPPPAVHYSPPPPPVIHH-----SQPPPPP 816 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP + PPPPP PP P PPPPP Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHY-----ISPPPPP 739 Score = 33.1 bits (72), Expect = 0.22 Identities = 24/86 (27%), Positives = 29/86 (33%) Frame = +2 Query: 182 LKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP 361 L +PPP P++ + PP PPP PPPPP PP Sbjct: 697 LNLASPPPPAPYYYSSPQPPPPPHYS--------LPPPTPTYHYIS--PPPPPTPIHSPP 746 Query: 362 PPPXXXXXGGGXXPPPPPPXXFFFXP 439 P PPPPP + P Sbjct: 747 PQSHPPCI---EYSPPPPPTVHYNPP 769 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP P PP PPPPP PPPPP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVH-----YSPPPPP 805 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPP PPPPP + P Sbjct: 768 PPPPPSPAHYSPPPSPPVYY---YNSPPPPPAVHYSPP 802 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 38.3 bits (85), Expect = 0.006 Identities = 20/76 (26%), Positives = 26/76 (34%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP + + PP + + P P + PPPP PPPP Sbjct: 565 PPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPTYYATQSPPPPPPP 624 Query: 380 XXGGGXXPPPPPPXXF 427 PPPPPP + Sbjct: 625 TYYAVQSPPPPPPVYY 640 Score = 37.5 bits (83), Expect = 0.010 Identities = 23/80 (28%), Positives = 26/80 (32%), Gaps = 3/80 (3%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFX---KGGXPPPPPXXXXXP 358 + TPPP + P + PPP K PPPPP Sbjct: 453 RATPPPPSSKMSPSFRATPPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPS 512 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP Sbjct: 513 PPPPSSEMSPSVRAYPPPPP 532 Score = 37.5 bits (83), Expect = 0.010 Identities = 24/85 (28%), Positives = 28/85 (32%), Gaps = 1/85 (1%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP-PP 364 + TPPP K P ++ PP PPPPP P PP Sbjct: 483 RATPPPPSSKMSPSVKAYPPPPPPPEYEP-SPPPPSSEMSPSVRAYPPPPPLSPPPPSPP 541 Query: 365 PPXXXXXGGGXXPPPPPPXXFFFXP 439 PP P PPPP + P Sbjct: 542 PPYIYSSPPPPSPSPPPPYIYSSPP 566 Score = 35.5 bits (78), Expect = 0.042 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP PPPP PPPP PPPPP + Sbjct: 608 PPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYY 654 Score = 34.7 bits (76), Expect = 0.073 Identities = 23/84 (27%), Positives = 26/84 (30%), Gaps = 7/84 (8%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKG--GXPPPP-----PXXXXX 355 PPP + PP + PPP PPPP P Sbjct: 426 PPPSFKMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPSSKMSPSFRAT 485 Query: 356 PPPPPXXXXXGGGXXPPPPPPXXF 427 PPPP PPPPPP + Sbjct: 486 PPPPSSKMSPSVKAYPPPPPPPEY 509 Score = 34.7 bits (76), Expect = 0.073 Identities = 23/84 (27%), Positives = 31/84 (36%), Gaps = 4/84 (4%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP----PPP 367 PP ++ + PP + + PPP + PPPP P PPP Sbjct: 607 PPPPTYYATQSPPPPPPPT---YYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPP 663 Query: 368 PXXXXXGGGXXPPPPPPXXFFFXP 439 P PPPPPP ++ P Sbjct: 664 PPVYYSPVTQSPPPPPP--VYYPP 685 Score = 33.9 bits (74), Expect = 0.13 Identities = 21/83 (25%), Positives = 29/83 (34%), Gaps = 4/83 (4%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP----P 361 +PPP ++ + PP + PPP + PPPP P P Sbjct: 660 SPPPPPVYYSPVTQSPPPPPPV-YYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSP 718 Query: 362 PPPXXXXXGGGXXPPPPPPXXFF 430 PPP PPPP ++ Sbjct: 719 PPPSPVYYPPVAKSPPPPSPVYY 741 Score = 33.5 bits (73), Expect = 0.17 Identities = 21/76 (27%), Positives = 24/76 (31%), Gaps = 3/76 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP---PXXXXXPPPP 367 PPP + + + PP PPP PP P P PPPP Sbjct: 648 PPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPP 707 Query: 368 PXXXXXGGGXXPPPPP 415 P PPP P Sbjct: 708 PVYYLPVTQSPPPPSP 723 Score = 33.1 bits (72), Expect = 0.22 Identities = 22/81 (27%), Positives = 26/81 (32%), Gaps = 3/81 (3%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP---PP 364 +PPP P + P + PPP PPPPP P P Sbjct: 631 SPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSP 690 Query: 365 PPXXXXXGGGXXPPPPPPXXF 427 PP PPPPP + Sbjct: 691 PPSPVYYPPVTQSPPPPPVYY 711 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/96 (21%), Positives = 29/96 (30%), Gaps = 3/96 (3%) Frame = +2 Query: 161 PXFXXXXLKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP- 337 P + + PPP + + + PP PP + + PP P Sbjct: 665 PVYYSPVTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSPV 724 Query: 338 --PXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 P PPPP PPPP + P Sbjct: 725 YYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPP 760 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPP 409 PPP+ P PPP PPP PPP Sbjct: 541 PPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPP 581 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPPP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP PPPPP PPPPP PPPP Sbjct: 537 PPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP PPPPP PPPPP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP PPPPPP Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPP 564 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPPP PPPPP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPP----PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP F PPP PP PPP P PPPPPP Sbjct: 570 PPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP PPPP PPPP PPPP Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 PPPPPP P P P PP PP Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPP 569 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPP PPPPP PPP + P Sbjct: 590 PPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSP 640 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPP---PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP P PPPP PPPP P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPP 695 PPPPPP P P P PP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 >At4g08400.1 68417.m01388 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 513 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP G PPPP + P Sbjct: 118 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKGDYKSPPPPYVYSSPP 168 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ KG PPP PPPP PPPP + P Sbjct: 143 PPPYYSPSPKGDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 193 Score = 35.1 bits (77), Expect = 0.056 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 442 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPNVDYKSPPPPYVYSSPP 492 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 417 PPPYYSPSPKVNYKTPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 467 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 168 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 218 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 193 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 243 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 267 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 317 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 292 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 342 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 317 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 367 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 392 PPPYYSPSPKVDYKSPPPPYIYNSPPPPYYSPSPKVNYKTPPPPYVYSSPP 442 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 342 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 392 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 367 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYIYNSPP 417 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ K PPP PPPP PPPP Sbjct: 243 PPPYYSPSPKVNYKSPPPPYYRSPPPPYYSPSPKVDYKSPPPP 285 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP+ K PPP PPPP PPPP Sbjct: 218 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPP 261 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PP PPPP PPPP + P Sbjct: 93 PPPYYSPSPKVDYKSLPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 143 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/47 (27%), Positives = 15/47 (31%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP+ PPP PP P PPPP + Sbjct: 467 PPPYYSPSPNVDYKSPPPPYVYSSPPTPYYSPSSKVTYKSPPPPYVY 513 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPPP PP PP PP PPP F Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPPAF 97 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.5 bits (83), Expect = 0.010 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 7/80 (8%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXK-GGXPPPP------PXXXXXP 358 PP P G GK PP F K PPPP P P Sbjct: 327 PPLKPPPGRTASVLSGKSFSGKVEPLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPP 386 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 PPP G G PPPPP Sbjct: 387 RPPPPAPPPGSGGPKPPPPP 406 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP GG PPPP P PPP PP P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP P PPP G P PPPP Sbjct: 390 PPAPPPGSGGPKPPPPPGPKG----PRPPPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 37.5 bits (83), Expect = 0.010 Identities = 26/80 (32%), Positives = 26/80 (32%), Gaps = 7/80 (8%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXK-GGXPPPP------PXXXXXP 358 PP P G GK PP F K PPPP P P Sbjct: 327 PPLKPPPGRTASVLSGKSFSGKVEPLPPEPPKFLKVSSKKASAPPPPVPAPQMPSSAGPP 386 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 PPP G G PPPPP Sbjct: 387 RPPPPAPPPGSGGPKPPPPP 406 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP GG PPPP P PPP PP P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP P PPP G P PPPP Sbjct: 390 PPAPPPGSGGPKPPPPPGPKG----PRPPPP 416 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 37.5 bits (83), Expect = 0.010 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXP-----PPPPPXXFFFXP 439 PPP + PPPPP PPPPP P PPPPP + P Sbjct: 55 PPPSPYLYSS---PPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPPFVYSSPP 107 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGG----XXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPPP + P Sbjct: 176 PPPPPYVYNSPPPPPYVYESVPRIPFIYSSPPPPPYVYNSAP 217 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPP PPPPP Sbjct: 96 PPPPPFVYSSPPPPTYIY-----NSPPPPP 120 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP + PP P PPPPP PPPPPP + P Sbjct: 44 PPLPSPYVYKSPPPSPYLYSS-PPPPPYVY-----NSPPPPPPYIYNSPP 87 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 37.5 bits (83), Expect = 0.010 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPP PPPPP PPPPP Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPP---PPXXXXXPPPPPXXXXXGGGXXPPPP 412 PP F PPP PP PPPPP PPPP Sbjct: 658 PPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 31.5 bits (68), Expect = 0.68 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP---PXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPP P PPPP PPPPP Sbjct: 693 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP---PPPXXXXXGGGXXPPPPPP 418 PPP PPPP PP PPP PPPPP Sbjct: 692 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP PPPPP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/75 (29%), Positives = 24/75 (32%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P + PP PPP PPPP PPPP Sbjct: 741 SPPPPAPIYSP----PPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP----VHSPPPPV 792 Query: 374 XXXXGGGXXPPPPPP 418 PPPP P Sbjct: 793 HSPPPPVHSPPPPSP 807 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 329 PPPPXXXXXPP---PPPXXXXXGGGXXPPPPPP 418 PPPP PP PPP PPPPP Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP PPPPP PPPP PPPP Sbjct: 671 PPPVYSPPPPVHSPPPPPV---HSPPPPVHSPPPPVHSPPPP 709 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +2 Query: 326 PPPP---PXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP P PPPP PPPPP Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 29.5 bits (63), Expect = 2.8 Identities = 21/77 (27%), Positives = 23/77 (29%), Gaps = 3/77 (3%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP---PXXXXXPPP 364 +PPP + PP PPP PPPP P PP Sbjct: 669 SPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 728 Query: 365 PPXXXXXGGGXXPPPPP 415 PP PPPP Sbjct: 729 PPVQSPPPPPVFSPPPP 745 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPPPP PPPP PPPP Sbjct: 647 PPPPPP--VHSPPPPVFSPPPPMHSPPPP 673 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP---PXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPP P PPPP PPPP Sbjct: 650 PPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPP---PPXXFFFXP 439 P P PPPPP PPPP PP + P Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPP 678 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPP P PPP F P Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPP 105 Score = 35.1 bits (77), Expect = 0.056 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGX 466 PPP + PPPP PPPP PP PPP P GG Sbjct: 104 PPPIDSPPPESTNSPPPPEVFEPPPPPADE-----DESPPAPPPPEQLPPPASSPQGGPK 158 Query: 467 XP 472 P Sbjct: 159 KP 160 Score = 30.3 bits (65), Expect = 1.6 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 2/76 (2%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP--PP 367 +PPP +P PP PPP PPPP P PP Sbjct: 46 SPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPP 105 Query: 368 PXXXXXGGGXXPPPPP 415 P PPPP Sbjct: 106 PIDSPPPESTNSPPPP 121 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +2 Query: 326 PPPPPXXXXX---PPPPPXXXXXGGGXXPPPPPPXXF 427 PPPPP PPPPP PPPPPP + Sbjct: 194 PPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKY 230 Score = 36.3 bits (80), Expect = 0.024 Identities = 25/83 (30%), Positives = 31/83 (37%), Gaps = 4/83 (4%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXP----PP 364 PPP I + PP + + K PPP + + PPPPP PP Sbjct: 171 PPPTIT----RSPPPPRPQAAAYY---KKTPPPPPYKYGRVYPPPPPPPQAARSYKRSPP 223 Query: 365 PPXXXXXGGGXXPPPPPPXXFFF 433 PP G PPPP +F Sbjct: 224 PPPPSKYGRVYSPPPPGKSWLWF 246 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPP PPPP PPPPP + Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKY 201 Score = 32.7 bits (71), Expect = 0.30 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 8/46 (17%) Frame = +2 Query: 326 PPPPPXXXXXPPPP----PXXXXXGGGXXPPP----PPPXXFFFXP 439 PPPPP PPPP P PPP PPP F P Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSP 161 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPP PPPP P Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPP 126 Score = 31.5 bits (68), Expect = 0.68 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 12/43 (27%) Frame = +2 Query: 326 PPPPPXXXXXPPPP------------PXXXXXGGGXXPPPPPP 418 PPPPP PPPP P G PPPPPP Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPP 211 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGG--GXXPPPPP 415 PPPPP PPPP PPPPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPP 75 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 101 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP PPPP Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 518 PPPPPPVYSPPPPPPV-------YSPPPPPP 541 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPPPP PPPPP PPPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 35.1 bits (77), Expect = 0.056 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP PPPPP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 34.3 bits (75), Expect = 0.097 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PP P PPPPPP Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPP PPP P PPPPP + Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVY 525 Score = 33.1 bits (72), Expect = 0.22 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP PPPPP PPPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 31.9 bits (69), Expect = 0.52 Identities = 25/90 (27%), Positives = 28/90 (31%), Gaps = 8/90 (8%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-----PXXXXXP 358 +PPP + PP PPP PPPP P P Sbjct: 558 SPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 617 Query: 359 PPPPXXXXXGGGXXPPPP---PPXXFFFXP 439 PPPP PPPP PP + P Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPP 647 Score = 31.1 bits (67), Expect = 0.90 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP---PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPPP P PPPP PPPPP Sbjct: 619 PPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPP---PPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP + PP PPP PPPP PPPP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP---PPPXXXXXGGGXXPPPPP 415 PPP + PPPPP PP PPP PPPP Sbjct: 527 PPPPPPVY---SPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 6/44 (13%) Frame = +2 Query: 326 PPPP---PXXXXXPPPPPXXXXXGGGXXPPPP---PPXXFFFXP 439 PPPP P PPPP PPPP PP + P Sbjct: 545 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 588 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + F P Sbjct: 267 PPPYYSPSPKPIYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPP 317 Score = 36.3 bits (80), Expect = 0.024 Identities = 22/82 (26%), Positives = 28/82 (34%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P++ K P + PPP+ K PPP PPPP Sbjct: 717 SPPP--PYYSPSPK-PTYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPPPPY 773 Query: 374 XXXXGGGXXPPPPPPXXFFFXP 439 PPPP + P Sbjct: 774 YSPSPKVEYKSPPPPYVYSSPP 795 Score = 35.1 bits (77), Expect = 0.056 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 342 PPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPP 392 Score = 34.7 bits (76), Expect = 0.073 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 242 PPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSPP 292 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 167 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPP 217 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 192 PPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSPP 242 Score = 34.3 bits (75), Expect = 0.097 Identities = 21/80 (26%), Positives = 26/80 (32%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP P++ K P + PPP+ K PPP PPPP Sbjct: 567 PPPPPYYSPSPK--PAYKSSPPPYVYSSPPPPYYSPAPKPVYKSPPPPYVYNSPPPPYYS 624 Query: 380 XXGGGXXPPPPPPXXFFFXP 439 PPPP + P Sbjct: 625 PSPKPTYKSPPPPYVYSSPP 644 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 619 PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSPP 669 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 644 PPPYYSPTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPP 694 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 669 PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSPP 719 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 694 PPPYYSPAPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPP 744 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 92 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSPP 142 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 117 PPPYYSPSPKPTYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPP 167 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 217 PPPYYSPSPKPVYKSPPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPP 267 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 317 PPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSPP 367 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 367 PPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPP 417 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 392 PPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSPP 442 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 67 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 117 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 292 PPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPP 342 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 142 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 192 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 467 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKPSYKSPPPPYVYNSPP 517 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXX-XXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPPP PPPP + P Sbjct: 770 PPPYYSPSPKVEYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSSPP 821 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PP + K PPP PPPP PPPP ++ Sbjct: 848 PPAYYSPSPKIEYKSPPPPYVYSSPPPPSYSPSPKAEYKSPPPPSLYY 895 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPP + P Sbjct: 417 PPPYYSPSPKPSYKSPPPPYVYSSPPPPYYSPSPKLTYKSSPPPYVYSSPP 467 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPP + P Sbjct: 796 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYYSPSPKVEYKSPPPPYVYNSP 846 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PP PPPP PPPP + P Sbjct: 442 PPPYYSPSPKLTYKSSPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 492 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP+ K PPP PPPP PP P Sbjct: 492 PPPYYSPSPKPSYKSPPPPYVYNSPPPPYYSPSPKVIYKSPPHP 535 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPP PPPP + P Sbjct: 837 PPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSPP 873 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPP PPPP + P Sbjct: 31 PPPPYVYSSPPPPLSYSPSPKVDYKSPPPPYVYSSPP 67 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP PPPP PPPP Sbjct: 57 PPPPYVYSSPPPPYYSPSPKVEYKSPPPP 85 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 287 PPPFXXX-FXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 41 PPPLSYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 92 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/52 (30%), Positives = 18/52 (34%), Gaps = 1/52 (1%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP-PXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PP P PPPPP PP P + P Sbjct: 517 PPPYYSPSPKVIYKSPPHPHVCVCPPPPPCYSHSPKIEYKSPPTPYVYHSPP 568 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/51 (27%), Positives = 16/51 (31%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP + K PPP PPPP PPP + P Sbjct: 822 PPTYYSPSPKVEYKSPPPPYVYNSPPPPAYYSPSPKIEYKSPPPPYVYSSP 872 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 36.3 bits (80), Expect = 0.024 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPPPPP Sbjct: 44 PPPPP-----PPPPPPLYFSYFSLPPPPPPP 69 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 P PPP PPPPP PPPPP Sbjct: 42 PHPPPPPP--PPPPPLYFSYFSLPPPPPPP 69 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 36.3 bits (80), Expect = 0.024 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP P P PPPP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPP 92 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PPP P PPPP P PP P Sbjct: 72 PPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 31.5 bits (68), Expect = 0.68 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P P PPPPP PP PPP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPP 82 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPP--PP 418 PPPP PPPP PPPP PP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P PPPPP PPPP P Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPP--PPP 418 PPPP PPP P PPP PPP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 P P P PPPPP PPPP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPP 83 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P PPPPP P PPPP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPP 83 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPP--PPPP 418 PPPP PPP P PP PPPP Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 36.3 bits (80), Expect = 0.024 Identities = 25/82 (30%), Positives = 30/82 (36%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP P+ PP + PPP+ PPPPP PPPPP Sbjct: 168 SPPPPPPYVYQSPPPPP-------YVYSSPPPPPYVYK-----SPPPPPYVYSSPPPPPY 215 Query: 374 XXXXGGGXXPPPPPPXXFFFXP 439 PPPPP + P Sbjct: 216 V------YKSPPPPPYVYSSPP 231 Score = 35.9 bits (79), Expect = 0.032 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 62 PPPYIY-----SSPPPPPYVYSSPPPPPYV------YNSPPPPPYVYSSPP 101 Score = 35.9 bits (79), Expect = 0.032 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 82 PPPYVY-----NSPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 121 Score = 35.9 bits (79), Expect = 0.032 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 292 PPPYVY-----SSPPPPPYVYSSPPPPPYV------YKSPPPPPYVYTSPP 331 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 102 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 141 Score = 35.5 bits (78), Expect = 0.042 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 5/56 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPP-----PPPXXFFFXP 439 PPP+ PPPPP PPPPP PPP PPP + + P Sbjct: 122 PPPYVYK-----SPPPPPYVYSSPPPPPYVY---SSPPPPPYVYKSPPPPPYVYSP 169 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 152 PPPYVYK-----SPPPPPYVYSPPPPPPYV------YQSPPPPPYVYSSPP 191 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 212 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 251 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 232 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 271 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 252 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 291 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 272 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YSSPPPPPYVYSSPP 311 Score = 35.1 bits (77), Expect = 0.056 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ PPPPP PPPPP PPPPP Sbjct: 312 PPPYVYK-----SPPPPPYVYTSPPPPPYVY-----KSPPPPP 344 Score = 32.7 bits (71), Expect = 0.30 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ PPPPP PPPPP PPP P Sbjct: 322 PPPYVYT-----SPPPPPYVYKSPPPPPYV----DSYSPPPAP 355 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP P PPP PPPP + P Sbjct: 45 PPPYVYNSPSPPPYVYKPPPYIYSSPPPPPYVYSSP 80 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 36.3 bits (80), Expect = 0.024 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP + PPPPP PPPPP PPPPP + P Sbjct: 360 PPPSPYVYKS---PPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 401 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 62 PPPYIYK-----SPPPPPYVYSSPPPPPYI------YKSPPPPPYVYSSPP 101 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 82 PPPYIYK-----SPPPPPYVYSSPPPPPYI------YKSPPPPPYVYSSPP 121 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 122 PPPYVYK-----SPPPPPYVYNSPPPPPYV------YKSPPPPPYVYSSPP 161 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 142 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 181 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 162 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 201 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 182 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 221 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 202 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 241 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 222 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 261 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 242 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 281 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 262 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 301 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 282 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 321 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 322 PPPYVYK-----SPPPPPYVYNSPPPPPYV------YKSPPPPPYVYSSPP 361 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 382 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 421 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/51 (37%), Positives = 21/51 (41%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPPPP PPPPP + P Sbjct: 402 PPPYVYK-----SPPPPPYVYSSPPPPPYV------YKSPPPPPYVYSSPP 441 Score = 35.1 bits (77), Expect = 0.056 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP PPPPP + P Sbjct: 50 PPPPPYVYSSPPPPPYI------YKSPPPPPYVYSSPP 81 Score = 35.1 bits (77), Expect = 0.056 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ PPPPP PPPPP PPPPP Sbjct: 102 PPPYIYK-----SPPPPPYVYSSPPPPPYVY-----KSPPPPP 134 Score = 35.1 bits (77), Expect = 0.056 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ PPPPP PPPPP PPPPP Sbjct: 302 PPPYVYK-----SPPPPPYVYSSPPPPPYVY-----KSPPPPP 334 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGG----XXPPPPPP 418 PPP+ PPPPP PPPPP PPPPP Sbjct: 422 PPPYVYK-----SPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPPPP 464 Score = 32.3 bits (70), Expect = 0.39 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPPP PPP P PPPPP + P Sbjct: 342 PPPYVYK-----SPPPPPYVYSSPPPSPYV------YKSPPPPPYVYSSPP 381 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPP+ P PPP PPPPP PPPP Sbjct: 442 PPPYVYK-----SPSPPPYVYKSPPPPPSYSYSYSS--PPPP 476 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 35.9 bits (79), Expect = 0.032 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXX-XXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPPP PPPP + F P Sbjct: 161 PPPYYSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFPP 212 Score = 35.9 bits (79), Expect = 0.032 Identities = 21/73 (28%), Positives = 25/73 (34%), Gaps = 1/73 (1%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXP-PPPPXXXXXPPPPPXX 376 PP P++ K + PPP+ K PPPP PPPPP Sbjct: 211 PPPPPYYSPSPKVG-YKSPPAPYVYSSPPPPPYYSPSPKVNYKSPPPPYVYSSPPPPPYS 269 Query: 377 XXXGGGXXPPPPP 415 PPPP Sbjct: 270 PSPKVEFKSPPPP 282 Score = 34.3 bits (75), Expect = 0.097 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXX-XXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP+ F K PPP PPPPP PPPP + Sbjct: 377 PPPYYSPFPKVEYKSPPPPYIYNSPPPPPYYSPSPKITYKSPPPPYIY 424 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPPP PPPP + P Sbjct: 150 PPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSPP 186 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 287 PPPFXXXFXKGGXP-PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPP PPPPP PPPP + P Sbjct: 351 PPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPP 402 Score = 31.5 bits (68), Expect = 0.68 Identities = 23/82 (28%), Positives = 27/82 (32%), Gaps = 1/82 (1%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXK-GGXPPPPPXXXXXPPPPPX 373 PPP P + K PP + PP + K PPPP PPPP Sbjct: 265 PPPYSPSPKVEFKSPPPP-----YIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSPPPPTY 319 Query: 374 XXXXGGGXXPPPPPPXXFFFXP 439 PPPP + P Sbjct: 320 YSPSPRVDYKSPPPPYVYNSLP 341 Score = 30.7 bits (66), Expect = 1.2 Identities = 23/84 (27%), Positives = 26/84 (30%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 K PPP + PP K PPP+ PPP PPPP Sbjct: 303 KSPPPPYV----YSSPPPPTYYSPSPRVDYKSPPPPYVYNSL------PPPYVYNSPPPP 352 Query: 368 PXXXXXGGGXXPPPPPPXXFFFXP 439 P PPPP + P Sbjct: 353 PYYSPSPTVNYKSPPPPYVYNSPP 376 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGX--PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ K PPPP PPPP G PP P Sbjct: 187 PPPYYSPSPKVEYKSPPPPYVYSFPPPPPYYSPSPKVGYKSPPAP 231 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPP + P Sbjct: 264 PPPPYSPSPKVEFKSPPPPYIYNSPPPPSYYSPSPKIDYKSPPPPYVYSSP 314 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 35.5 bits (78), Expect = 0.042 Identities = 19/50 (38%), Positives = 21/50 (42%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 K PPP + PPPPP PPPPP PPPPP + Sbjct: 34 KYSPPP-PPVYSPPISPPPPP-----PPPPPQSHAAAYKRYSPPPPPSKY 77 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 7/50 (14%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX-------PPPPPXXXXXGGGXXPPPPP 415 PP + PPPPP PPPPP G PPPPP Sbjct: 40 PPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKY---GRVYPPPPP 86 >At3g54580.1 68416.m06039 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 951 Score = 35.5 bits (78), Expect = 0.042 Identities = 24/84 (28%), Positives = 27/84 (32%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 K PPP + PP K K PPP+ K PPP PPP Sbjct: 736 KSPPPPYV----YSSPPPPYYSPSPKVHY-KSPPPPYYAPTPKVHYKSPPPPYVYSSPPP 790 Query: 368 PXXXXXGGGXXPPPPPPXXFFFXP 439 P PPPP + P Sbjct: 791 PYYSPSPKVHYKSPPPPYVYSSPP 814 Score = 35.1 bits (77), Expect = 0.056 Identities = 24/84 (28%), Positives = 27/84 (32%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 K PPP + PP K K PPP+ K PPP PPP Sbjct: 519 KSPPPPYV----YSSPPPPYYSPSPKVYY-KSPPPPYYSPSPKVYYKSPPPPYVYSSPPP 573 Query: 368 PXXXXXGGGXXPPPPPPXXFFFXP 439 P PPPP + P Sbjct: 574 PYYSPSPKVYYKSPPPPYVYSSPP 597 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 306 PPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 356 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 839 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 889 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 597 PPPYHSPSPKVQYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 647 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 789 PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 839 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 814 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 864 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 864 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPVVDYKSPPPPYVYSSPP 914 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 481 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 531 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 572 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYHSPSPKVQYKSPPPPYVYSSPP 622 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 622 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 672 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXP-PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ K PPPP PPPP PPPP Sbjct: 206 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 249 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 231 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 281 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXP-PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ K PPPP PPPP PPPP Sbjct: 256 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 299 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 281 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 331 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXP-PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ K PPPP PPPP PPPP Sbjct: 431 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 474 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 456 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 506 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP+ K PPP PPPP PPPP Sbjct: 506 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 549 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP-PXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PP P PPPPP PPPP + P Sbjct: 672 PPPYYSPSPKVYYKSPPHPHVCVCPPPPPCYSPSPKVVYKSPPPPYVYSSPP 723 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 81 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 131 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 106 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 156 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 131 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 181 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 156 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 206 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 181 PPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 231 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 331 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 381 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 356 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 406 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 381 PPPTYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 431 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 406 PPPTYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 456 Score = 31.1 bits (67), Expect = 0.90 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 698 PPPCYSPSPKVVYKSPPPPYVYSSPPPPHYSPSPKVYYKSPPPPYVYSSPP 748 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPP PPPP PPPP + P Sbjct: 889 PPPYYSPSPVVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYKSPP 939 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP K PPP PPPP PPPP Sbjct: 723 PPPHYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPP 766 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP + PPP PPPP PPPP + P Sbjct: 56 PPPTYSPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVEYKSPPPPYVYSSPP 106 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP+ K PPP PPPP PP P Sbjct: 647 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPHP 690 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 35.1 bits (77), Expect = 0.056 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP G PPP P PP PP PPPPP Sbjct: 32 PPPPCICICNPGPPPPQP--DPQPPTPPTFQPAPPANDQPPPPP 73 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXP--PPPPP 418 K PPP PPPPP PPPPP P PPPP Sbjct: 91 KPLPPPLSPPQTT---PPPPPA--ITPPPPPAITPPLSPPPPAITPPPP 134 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 3/45 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP---PXXXXXGGGXXPPPP 412 P P PPPP PPPP P PPPP Sbjct: 90 PKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +3 Query: 600 GPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 GPPPP P P P + P P PP Sbjct: 43 GPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPP 79 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 9/53 (16%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP---------PPPXXXXXGGGXXPPPPPP 418 PP F PPPPP PP P P PPPPP Sbjct: 56 PPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPP 108 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 2/32 (6%) Frame = +2 Query: 329 PPPPXXXXXP--PPPPXXXXXGGGXXPPPPPP 418 PPPP P PP P PPPPP Sbjct: 131 PPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPPP PP PP Sbjct: 262 PPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 35.1 bits (77), Expect = 0.056 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPPP PPPPPP F P Sbjct: 9 PPPP-----PPPPPRLLVLPPLPPPPPPPPPQLPFGP 40 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 35.1 bits (77), Expect = 0.056 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP PP PPPPP PPPP P Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 31.9 bits (69), Expect = 0.52 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 7/58 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPP----PPXXXXXPPPPPXXXXXGGGXXPPPP---PPXXFFFXP 439 PPP PPP PP PPP P PPPP PP F P Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPP 640 Score = 27.9 bits (59), Expect = 8.4 Identities = 22/86 (25%), Positives = 26/86 (30%), Gaps = 8/86 (9%) Frame = +2 Query: 185 KKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-----PXXX 349 ++ PPP++ PP PP PPPP P Sbjct: 520 RRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPV 579 Query: 350 XXPPPPPXXXXXGGGXXPP---PPPP 418 PPPP PP PPPP Sbjct: 580 ASPPPPSPPPPVHSPPPPPVFSPPPP 605 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 34.7 bits (76), Expect = 0.073 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP F PPPPP PP PPPPP Sbjct: 12 PPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPP 54 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 34.7 bits (76), Expect = 0.073 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 K PPP+ K PPP PPPP PPPP + P Sbjct: 70 KSPPPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 123 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 98 PPPYYSPSPKVDYKSPPPPYVYSSPPPPIYSPSPKVDYKSPPPPYVYSSPP 148 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 273 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 323 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 323 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 373 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 423 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 473 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 473 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVLYKSPPPPYVYSSPP 523 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 865 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 915 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 890 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 940 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 915 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPAPKVDYKSPPPPYVYSSPP 965 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 223 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 273 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 348 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKIVYKSPPPPYVYSSPP 398 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 665 PPPYHSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 715 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 690 PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 740 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 198 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 248 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 298 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 348 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 398 PPPYYTPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 448 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 448 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 498 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 523 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 573 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 548 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 598 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 715 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 765 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 740 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 790 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 765 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 815 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 790 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 840 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 815 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 865 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 840 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 890 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 248 PPPYYSPSPKIVYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 298 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 373 PPPYYSPSPKIVYKSPPPPYVYSSPPPPYYTPSPKVVYKSPPPPYVYSSPP 423 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 498 PPPYYSPSPKVLYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 548 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP+ K PPP PPPP PPPP Sbjct: 940 PPPYYSPAPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPP 983 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP + K PPP PPPP PPPP + P Sbjct: 173 PPSYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPP 223 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/61 (31%), Positives = 21/61 (34%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPP 367 K PPP + PP K K PPP+ K PPP PPP Sbjct: 953 KSPPPPYV----YSSPPPPYYSPSPKVDY-KSPPPPYYSPSPKVDYKSPPPPYVYSSPPP 1007 Query: 368 P 370 P Sbjct: 1008 P 1008 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PP P + P Sbjct: 123 PPPIYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPSPYVYNSPP 173 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP+ K PPP PPPP PP P Sbjct: 573 PPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPSP 616 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP-PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP+ K PP P PPPP PPPP Sbjct: 31 PPPYSVPLPKVEYKSPPLPDVYSSPPPPLEYSPAPKVDYKSPPPP 75 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PP PPPP PPPP + P Sbjct: 640 PPPCYSPSPKVVYKSSPPPYVYSSPPPPYHSPSPKVHYKSPPPPYVYSSPP 690 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 34.7 bits (76), Expect = 0.073 Identities = 22/75 (29%), Positives = 25/75 (33%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP + K PP E K PPP+ PPP PPPP Sbjct: 44 SPPPPV------KSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPV 97 Query: 374 XXXXGGGXXPPPPPP 418 PPPP Sbjct: 98 KSPPPPYYYHSPPPP 112 Score = 33.1 bits (72), Expect = 0.22 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP E K PPP+ PPP PPPP PPPP Sbjct: 37 PPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPP 96 Score = 31.9 bits (69), Expect = 0.52 Identities = 21/75 (28%), Positives = 24/75 (32%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP + K PP K PPP+ PPP PPPP Sbjct: 76 SPPPPV------KSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 129 Query: 374 XXXXGGGXXPPPPPP 418 PPPP Sbjct: 130 KSPPPPYYYHSPPPP 144 Score = 31.9 bits (69), Expect = 0.52 Identities = 21/75 (28%), Positives = 24/75 (32%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP + K PP K PPP+ PPP PPPP Sbjct: 108 SPPPPV------KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPV 161 Query: 374 XXXXGGGXXPPPPPP 418 PPPP Sbjct: 162 KSPPPPYYYHSPPPP 176 Score = 31.1 bits (67), Expect = 0.90 Identities = 26/89 (29%), Positives = 30/89 (33%), Gaps = 7/89 (7%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXP-PPPPXXXXXPPPP- 367 +PPP + K PP K PPP+ PPPP PPPP Sbjct: 60 SPPPPV------KSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPV 113 Query: 368 --PXXXXXGGGXXPP---PPPPXXFFFXP 439 P PP PPPP + P Sbjct: 114 KSPPPPYYYHSPPPPVKSPPPPYYYHSPP 142 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +2 Query: 329 PPPPXXXXXPPPP---PXXXXXGGGXXPP---PPPPXXFFFXP 439 PPPP PPPP P PP PPPP + P Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPP 78 Score = 28.7 bits (61), Expect = 4.8 Identities = 22/82 (26%), Positives = 26/82 (31%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP + K PP K PPP+ PPP PPPP Sbjct: 140 SPPPPV------KSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPP- 192 Query: 374 XXXXGGGXXPPPPPPXXFFFXP 439 PPPP + P Sbjct: 193 --------VKSPPPPVYIYASP 206 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 34.7 bits (76), Expect = 0.073 Identities = 25/86 (29%), Positives = 28/86 (32%), Gaps = 2/86 (2%) Frame = +2 Query: 188 KITPPPQI--PFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPP 361 K +PPPQ P K PP PPP+ K PPP P Sbjct: 54 KSSPPPQYYTPSPKVNYKSPPPPYVYSS------PPPPYYSPSPKVDYKSPPPPYVYSSP 107 Query: 362 PPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP PPPP + P Sbjct: 108 PPPYYSPSPKVDYKSPPPPYVYSSPP 133 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 133 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 183 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 158 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 208 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 108 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 158 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 183 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 233 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 208 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 258 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 233 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 283 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 258 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 308 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 283 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 333 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 308 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 358 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 333 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 383 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 383 PPPYYSPSPKVYYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 433 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 408 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 458 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 483 PPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 533 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 358 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYNSPP 408 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP+ K PPP PPPP PPPP + Sbjct: 508 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPPYVY 554 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPP + P Sbjct: 433 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPP 483 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPP + P Sbjct: 458 PPPYYSPSPKVYYKSPPPSYVYSSPPPPYYSPSPKVYYKSPPPSYVYSSPP 508 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 34.7 bits (76), Expect = 0.073 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGGG GGGGG G GGG + GGG Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGG 444 Score = 29.5 bits (63), Expect = 2.8 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 7/67 (10%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGG-----GXXFXXGGGGGXP--PXKKXXKKGGGXXF*XXNFP 259 GGGG P GGGG G GGGG P P K+GGG P Sbjct: 128 GGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAP 187 Query: 258 KXSXXGG 238 GG Sbjct: 188 PPKRGGG 194 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 7/51 (13%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGG-----GXXFXXGGGGGXP--PXKKXXKKGGG 286 GGGG P GGGG G GGGG P P K+GGG Sbjct: 176 GGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGG 226 >At5g49080.1 68418.m06074 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 609 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 58 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYTPSPKVDYKSPPPPYEYSSPP 108 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 158 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 208 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 183 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 233 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 208 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 258 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 283 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 333 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 308 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 358 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 333 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 383 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 358 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 408 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 383 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 433 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 433 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 483 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 458 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 508 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 483 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 533 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 533 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 583 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 83 PPPYYTPSPKVDYKSPPPPYEYSSPPPPYYSPSPKIDYKSPPPPYVYSSPP 133 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 408 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 458 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 508 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 558 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 P P+ K PPP PPPP PPPP + P Sbjct: 133 PLPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPTPKVDYKSPPPPYVYSSPP 183 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PP P + P Sbjct: 233 PPPYYSPTPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPLPYVYSSPP 283 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PP PPPP PPPP + P Sbjct: 258 PPPYYSPSPKVDYKSPPLPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 308 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PP P PPPP + P Sbjct: 108 PPPYYSPSPKIDYKSPPPPYVYSSPPLPYYSPSPKVDYKSPPPPYVYSSPP 158 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP+ K PPP PPPP PPP + Sbjct: 558 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVTYKSLPPPYVY 604 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 34.3 bits (75), Expect = 0.097 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPP--PPP 418 PPP PPPPP PPPPP PPP PPP Sbjct: 54 PPPPPVYSRPVAFPPPPPI--YSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 32.3 bits (70), Expect = 0.39 Identities = 20/57 (35%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX---PPPPPXXXXXGGGXXPPP---PPPXXFFFXP 439 PPP+ PPPPP PPPPP PPP PPP + P Sbjct: 44 PPPYRSPVT---IPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 326 PPPPPX--XXXXPPPPPXXXXXGGGXXPPP---PPPXXFFFXP 439 PPPPP PPPPP PPP PPP + P Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPP 84 >At5g06640.1 68418.m00750 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 689 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 413 PPPYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 463 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 538 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPKVNYKSPPPPYVYSSPP 588 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 113 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 163 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 213 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 263 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 338 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 388 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 438 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 488 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPP + F P Sbjct: 563 PPPYYSPSPKVNYKSPPPPYVYSSPPPPYYSPSPMVDYKSTPPPYVYSFPP 613 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 138 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYNSPP 188 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 238 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYFSPSPKVEYKSPPPPYVYNSPP 288 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 263 PPPYFSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYSSPP 313 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 288 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 338 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 463 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 513 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 488 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYHSPSPKVNYKSPPPPYVYSSHP 538 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 163 PPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSPSPKIEYKSPPPPYVYSSPP 213 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 313 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 363 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 188 PPPYYSPSPKIEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 238 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP + K PPP PPPP PPPP + P Sbjct: 88 PPSYYSPSPKVNYKSPPPPNVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 138 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP + K PPP PPPP PPPP + P Sbjct: 388 PPQYYSPSPKVAYKSPPPPYVYSSPPPPYYSPSPKVAYKSPPPPYVYSSPP 438 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPP PPPP + P Sbjct: 363 PPPYYSPSPKVDYKSPPPPYVYSSPPPQYYSPSPKVAYKSPPPPYVYSSPP 413 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPP PPPP + P Sbjct: 513 PPPYHSPSPKVNYKSPPPPYVYSSHPPPYYSPSPKVNYKSPPPPYVYSSPP 563 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PP + K PPP PPPP PPPP + Sbjct: 638 PPLYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVTYKSPPPPYVY 684 >At5g06630.1 68418.m00749 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 440 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 64 PPPYYTPSPKVNYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 114 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 314 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPNVYYKSPPPPYVYSSPP 364 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 364 PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 414 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 89 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 139 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 164 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 214 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 189 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 239 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 214 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 264 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 239 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 289 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 264 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 314 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 289 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 339 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP+ K PPP PPPP PPPP + Sbjct: 389 PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVTYKSPPPPYVY 435 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPP PPPP PPPP + P Sbjct: 339 PPPYYSPSPNVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 389 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPP PPPP + P Sbjct: 114 PPPYYSPSPKVYYKSPPPPYVYSSPPPLYYSPSPKVYYKSPPPPYVYSSPP 164 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP + K PPP PPPP PPPP + P Sbjct: 139 PPLYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 189 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP--PP 418 G PPPP PPP P GG PP P PP Sbjct: 218 GPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 32.3 bits (70), Expect = 0.39 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 12/56 (21%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP-----PP-------PXXXXXGGGXXPPPPPP 418 PPPF G PPPP PP PP P GG PPPPP Sbjct: 168 PPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + + PPP PPPPP G PPPP P Sbjct: 198 PPP--PQYGQRPMIPPPGGMMRGPPPPPH-----GMQGPPPPRP 234 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPP--PP 418 G PPPP PPP P GG PP P PP Sbjct: 218 GPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPP 252 Score = 32.3 bits (70), Expect = 0.39 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 12/56 (21%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP-----PP-------PXXXXXGGGXXPPPPPP 418 PPPF G PPPP PP PP P GG PPPPP Sbjct: 168 PPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPP 223 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + + PPP PPPPP G PPPP P Sbjct: 198 PPP--PQYGQRPMIPPPGGMMRGPPPPPH-----GMQGPPPPRP 234 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 34.3 bits (75), Expect = 0.097 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 6/50 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP------PXXXXXGGGXXPPPPPP 418 PPP + PPPPP PPPP P G PPPPP Sbjct: 446 PPPPSIHYSS---PPPPPVHHSSPPPPSPEFEGPLPPVIGVSYASPPPPP 492 Score = 32.3 bits (70), Expect = 0.39 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PP PPPPP PPP PP Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPP 432 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP + PPPPP PPPP PPPP P Sbjct: 436 PPPSPPVYS----PPPPPSIHYSSPPPPPVHHSS----PPPPSP 471 Score = 31.5 bits (68), Expect = 0.68 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 7/45 (15%) Frame = +2 Query: 326 PPPPPXXXXXPP---PPPXXXXXGGGXXPP----PPPPXXFFFXP 439 PPPPP PP PPP PP PPPP + P Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSP 456 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP PPP PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 PPPPPP P P P PP PP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPP 446 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 P P PPPPP PPP P F Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSPPVF 434 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 34.3 bits (75), Expect = 0.097 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G GG G PP GGGGG GGGGG Sbjct: 167 GNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGG 204 >At5g35190.1 68418.m04170 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 328 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 83 PPPYYSPSPKEDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYNSPP 133 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 108 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVEYKSPPPPYVYNSPP 158 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 133 PPPYYSPSPKVEYKSPPPPYVYNSPPPPYYSLSPKVDYKSPPPPYVYNSPP 183 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGG--GXXPPPPPP 418 PPP+ K PPP PPPP PPPPP Sbjct: 233 PPPYFSPSPKVDYKSPPPPYVYSSPPPPPYYSPSPEVSYKSPPPPP 278 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PP+ K PPP PPPP PPPP + P Sbjct: 209 PPYYSPSPKVDYKSPPPPYVYNSPPPPYFSPSPKVDYKSPPPPYVYSSPP 258 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/76 (26%), Positives = 25/76 (32%), Gaps = 1/76 (1%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXX-XXPPPPP 370 +PPP P+ PP + PPP+ + PPP PPPPP Sbjct: 247 SPPP--PYVYSSPPPPPYYSPSPEVSYKSPPPPPYYSPSLEVSYKSPPPLFVYNFPPPPP 304 Query: 371 XXXXXGGGXXPPPPPP 418 PP P Sbjct: 305 FYSPSPKVSYKSPPAP 320 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP+ K PPP PPPP PPP + Sbjct: 158 PPPYYSLSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKFSPPPYVY 204 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GG GGG GGGGG + GGGGG GGG Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGG-YSGGGGGGYERRSGGYGSGGG 137 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG GGGGG + GGGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGG--YSGGGGGG 116 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGG---GGXPPXKKXXKKGGG 286 GGGGGG GGGGG GGG GG GGG Sbjct: 119 GGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGG 165 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGG--GGXXFXXGGGGG 325 GGGGGG GGG GG GGGGG Sbjct: 135 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPP PPP PP Sbjct: 277 PPPPPPPKPQPPPPPKI------ARPPPAPP 301 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 320 GXPPPP-PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PP P PPPPP PPPP P Sbjct: 252 GLPPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKP 285 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 P PPPPPP + P P + P PP G P Sbjct: 274 PPQPPPPPPPKPQP------PPPPKIARPPPAPPKGAAP 306 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 106 PPPYYSPSPKVDYKSPPPPYVYNSPPPPYYSPSPKVDYKSPPPPYVYSSPP 156 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 131 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 181 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 181 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 231 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 231 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 281 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 256 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 306 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 281 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 331 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 306 PPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 356 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 156 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 206 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 206 PPPYYSPSPKVEYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPP 256 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 381 PPPYYSPSPKVEYKSPPPPYVYSSPPPPTYSPSPKVYYKSPPPPYVYSSPP 431 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 556 PPPYYSPSPKVHYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPYVYSSPP 606 Score = 33.5 bits (73), Expect = 0.17 Identities = 25/85 (29%), Positives = 28/85 (32%), Gaps = 1/85 (1%) Frame = +2 Query: 188 KITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-PXXXXXPPP 364 K PPP + PP K K PPP+ K PP P PPP Sbjct: 619 KSPPPPYV----YSSPPPPYYSPSPKVYY-KSPPPPYYSPSPKVYYKSPPHPHVCVCPPP 673 Query: 365 PPXXXXXGGGXXPPPPPPXXFFFXP 439 PP PPPP + P Sbjct: 674 PPCYSPSPKVVYKSPPPPYVYNSPP 698 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 431 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 481 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 456 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 506 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 481 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 531 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 506 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYSSPP 556 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 531 PPPYYSPSPKVHYKSPPPPYVYSSPPPPYYSPSPKVHYKSPPPPYVYNSPP 581 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ K PPP PPPP PPPP + P Sbjct: 581 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 631 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 287 PPPFXXXFXKGGXP-PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP+ K PPPP PPPP PPPP Sbjct: 331 PPPYYSPSPKVDYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPP 374 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 356 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVEYKSPPPPYVYSSPP 406 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP+ K PPP PPPP PPPP Sbjct: 606 PPPYYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPP 649 Score = 31.5 bits (68), Expect = 0.68 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 81 PPPTYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYNSPP 131 Score = 31.1 bits (67), Expect = 0.90 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP K PPP PPPP PPPP + P Sbjct: 406 PPPTYSPSPKVYYKSPPPPYVYSSPPPPYYSPSPKVYYKSPPPPYVYSSPP 456 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP K PPP PPPP PPPP + Sbjct: 673 PPPCYSPSPKVVYKSPPPPYVYNSPPPPYYSPSPKVYYKSPPPPSYY 719 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP + PPP PPPP PPPP + P Sbjct: 56 PPPTYTPAPEVEYKSPPPPYVYSSPPPPTYSPSPKVDYKSPPPPYVYSSPP 106 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 33.9 bits (74), Expect = 0.13 Identities = 22/76 (28%), Positives = 25/76 (32%), Gaps = 1/76 (1%) Frame = +2 Query: 194 TPPPQIPFWGXKKK-CPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 +PPP+ P + PP G PPP P PPP PPP Sbjct: 61 SPPPETPLSSPPPEPSPPSPSLTG--------PPPTTIPVSPPPEPSPPPPLPTEAPPPA 112 Query: 371 XXXXXGGGXXPPPPPP 418 PPPPP Sbjct: 113 NPVSSPPPESSPPPPP 128 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/74 (27%), Positives = 21/74 (28%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 P +IP PP E P P K PPPP P PP Sbjct: 187 PASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGSKRPTPSPPSP 246 Query: 377 XXXGGGXXPPPPPP 418 P PP P Sbjct: 247 SDSKRPVHPSPPSP 260 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPPPXXXXXP----PPPPXXXXXGGGXXPPPPPP 418 PPPPP P PP G PPPPPP Sbjct: 239 PPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPP 273 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +3 Query: 582 KKXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGP 707 K+ P PPPPP K+ P P P PP P Sbjct: 232 KQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPP 273 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 7/51 (13%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXX----PPPPPXXXXXG---GGXXPPPPPP 418 PPP P PPP PPPPP G PPP P Sbjct: 241 PPPSIAVKQSAPTPSPPPPIKKGSSPSPPPPPPVKKVGALSSSASKPPPAP 291 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGG 331 G +K GGGGGG GGGGG GGG Sbjct: 61 GGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -1 Query: 411 GGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGG GGGG GGGGG + GGG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGG 85 Score = 31.1 bits (67), Expect = 0.90 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G GG GGG GG GG GGGG +K K GGG Sbjct: 23 GTHSLQAGGNGGGSGKGQWLHGGGGEGGG--GEGGGGEGGGGQKISKGGGG 71 Score = 31.1 bits (67), Expect = 0.90 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -1 Query: 414 GGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGG GGGG GGGGG ++ GGG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGG 86 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G + G GGGG G GGG GGGGG Sbjct: 50 GGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXXP---PPPPXXXXXGGGXXPPPPPP 418 PPPP P PPPP PPPPPP Sbjct: 55 PPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFF 433 PPP P PPP PPP PPPPPP + F Sbjct: 49 PPPPPSPPPPSCTPSPPPPSP--PPPKKSSCPPSPLPPPPPPPPPNYVF 95 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 338 PXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPPPP PPPP P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSP 69 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 33.1 bits (72), Expect = 0.22 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG GGGGG + GGGGG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGG--YSGGGGGG 116 Score = 33.1 bits (72), Expect = 0.22 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GG GGG GGGGG GGGGG Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P PPPPP GG PPPP Sbjct: 44 PVPSSYSPPPPPPSSSGGGGSYYYSPPPP 72 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGX----PPPPPXXXXXPPPPPXXXXXGGGXXPPP 409 PPP GG PPPP PPP GG PPP Sbjct: 52 PPPPPSSSGGGGSYYYSPPPPSSSGGVKYPPPYGGDGYGGYYPPP 96 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGG--XXPPPPP 415 P P PPPPP GGG PPPP Sbjct: 41 PCNPVPSSYSPPPPPPSSSGGGGSYYYSPPPP 72 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 32.7 bits (71), Expect = 0.30 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 4/78 (5%) Frame = +2 Query: 197 PPPQIPFWGXKKKCP-PXXEXXGKFXX*KXXPPPFXXX-FXKGGXPPPPPXXXXXPPP-- 364 PPP P + P P K PPP F PPPPP P P Sbjct: 42 PPPYQPPVSSQPPSPSPHTHHHHKKHLTTTTPPPHEKHLFSSVANPPPPPPSPPHPNPFF 101 Query: 365 PPXXXXXGGGXXPPPPPP 418 P PP PPP Sbjct: 102 PSSDPTSTASHPPPAPPP 119 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +2 Query: 326 PPPPPXXXXXPPPP--PXXXXXGGGXXPPPPPPXXFFF 433 PPP P PPPP P PPPPP F + Sbjct: 65 PPPSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLY 102 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPP PPPPP + P Sbjct: 59 PPPPSPPPPSPPPPACPPPPA--LPPPPPKKVSSYCP 93 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +2 Query: 326 PPPPPXXXXXPP--PPPXXXXXGGGXXPPPPPPXXFFFXP 439 P PPP PP PPP PPPP + P Sbjct: 67 PSPPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGP 106 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPP P PPP PPPP + P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPP 94 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 32.3 bits (70), Expect = 0.39 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPP GGG PPP Sbjct: 55 PPPPSTPTTACPPPPSPPSSGGGSSYYYPPP 85 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/54 (27%), Positives = 18/54 (33%), Gaps = 5/54 (9%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP-----XXFFFXPXXXXXGGGXXP 472 P P PP PP PPP PP +++ P GG P Sbjct: 42 PCSPVQSSPPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYP 95 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 32.3 bits (70), Expect = 0.39 Identities = 22/78 (28%), Positives = 25/78 (32%) Frame = +2 Query: 185 KKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP 364 ++ PPP P PP + PPP PPPPP PP Sbjct: 117 RRSPPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPP---------PPPPPPPPPTITPP 167 Query: 365 PPXXXXXGGGXXPPPPPP 418 PPPPPP Sbjct: 168 VTTTTTGHHHHRPPPPPP 185 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 32.3 bits (70), Expect = 0.39 Identities = 17/60 (28%), Positives = 23/60 (38%), Gaps = 2/60 (3%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPP--FXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP P++ PP + PPP + + + PPPP PPPP Sbjct: 70 PPPPTPYYSPPADLPPPTPI---YPPPVAFPPPQAYQAYYYRKSPPPPPSKYGKVYPPPP 126 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP---PPPXXXXXGGGXXPPPPPPXXF 427 PPP PPP P PP PPP PPPPP + Sbjct: 71 PPPTPYYSPPADLPPPTP--IYPPPVAFPPPQAYQAYYYRKSPPPPPSKY 118 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPP-PXXXXXGGGXXPPPPPP 418 GG PP P PPPP P PPPP P Sbjct: 70 GGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTP 104 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 32.3 bits (70), Expect = 0.39 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXG--GGGGXPPXKKXXKKGGG 286 GGG GG GGGGG G GGGG K GGG Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G K GG GGG GG GG GGGGG Sbjct: 12 GGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG G GG GGGGG Sbjct: 83 GGGGGGGISGGGAGGKSGCGGGKSGGGGGGG 113 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG GG GG GGGG Sbjct: 108 GGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 28.7 bits (61), Expect = 4.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G GG G GG GG GGGG K GGG Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGG 46 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGGG G GGG GGGGG GGG Sbjct: 84 GGGGGGISGGGAGGKSGCGGGKS--GGGGGGGKNGGGCGGGGGG 125 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGGXXFL 275 GGGGGG GGGG K GG ++ Sbjct: 108 GGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYM 140 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GG GG GGG G GGGGG K GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGG 45 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGGXXFLXXKF 263 GGGGGG GGG G + G KF Sbjct: 120 GGGGGGKGGKSGGGSGGGGYMVAPGSNGSSTISRDKF 156 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPP----PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP PPP P PPPPPP Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPP 192 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPP---PPPPXXFFFXP 439 P PPP PPPPP P PPPP + P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITP 101 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP+ PPPP PPPPP Sbjct: 92 PPPYHHYITPS---PPPPRPLPPPPPPP 116 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 290 PPFXXXFXKGGXPPP--PPXXXXXPPPPPXXXXXGGGXXPPPP 412 PP + GG PPP PP PPP G PPPP Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPP---YGSSGSNPPPP 44 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 290 PPFXXXFXKGGXPPP--PPXXXXXPPPPPXXXXXGGGXXPPPP 412 PP + GG PPP PP PPP G PPPP Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPP---YGSSGSNPPPP 44 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 290 PPFXXXFXKGGXPPP--PPXXXXXPPPPPXXXXXGGGXXPPPP 412 PP + GG PPP PP PPP G PPPP Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPP---YGSSGSNPPPP 44 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 31.9 bits (69), Expect = 0.52 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXX--GGGGGXPPXKKXXKKGGG 286 G K GG GG GGGG GGGGG P K GGG Sbjct: 269 GGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGG 321 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXP 319 G + G GGG P GGGG G GGG P Sbjct: 283 GNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGP 322 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPP 316 GG GG P GGGGG G GG P Sbjct: 289 GGKNGGGGHPQDGKNGGGGGGPNAGKKGNGGGGP 322 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG GGGG GGGGG Sbjct: 103 GGGGGGNNNNNKKGQKNGGGGGG---GGGGG 130 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPP 316 GGGGGG P G GGG G GG P Sbjct: 304 GGGGGG----PNAGKKGNGGGGPMAGGVSGGFRP 333 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPP--XXXXXGGGXXPPPPPP 418 GG PPPPP P PP PPPPP Sbjct: 200 GGAPPPPPHIGNNPNMPPHIQPPNMNQNYRGPPPPP 235 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/71 (28%), Positives = 22/71 (30%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PP P G PP + + PPP G P P PPP Sbjct: 203 PPPPPHIGNNPNMPPHIQPPNMNQNYRGPPPPPNMNQNYQGPPAPNMNQNYQGPPPSNMG 262 Query: 380 XXGGGXXPPPP 412 G PPPP Sbjct: 263 QNYQG--PPPP 271 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.5 bits (68), Expect = 0.68 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP PPPPP PPPPP Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 8/50 (16%) Frame = +2 Query: 293 PFXXXFXKGGXPPPPPXXXXX--------PPPPPXXXXXGGGXXPPPPPP 418 P+ K PPPPP P PPP PPPPPP Sbjct: 336 PYSQNKPKFSQPPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPP 385 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP G P PP P P P PPPPP Sbjct: 133 PPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PP PPPP PPP PP Sbjct: 45 PQSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G P PP PP P PPPPP Sbjct: 143 GETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 31.5 bits (68), Expect = 0.68 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPP G P P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTPGPDSPLPSPGP 195 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPP G P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSP 193 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP K PPPPP PPPPP Sbjct: 55 PPPACAITLKDSPPPPPPP----PPPPP 78 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPPP Sbjct: 54 PPPPACAITLKDSPPPPPPPP 74 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGG----XXPPPPPP 418 PP PP PPPPP GG P PPP Sbjct: 221 PPSPPRKPPPPPPPPAFMSSSGGSDYSDLPVLPPP 255 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 31.5 bits (68), Expect = 0.68 Identities = 25/89 (28%), Positives = 30/89 (33%), Gaps = 7/89 (7%) Frame = +2 Query: 194 TPPPQIPFWGXK---KKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPP----PPXXXX 352 +PPP + + K PP + K PPP K PPP PP Sbjct: 45 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV-----KYYSPPPVYKSPPPPVY 99 Query: 353 XPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPP + P Sbjct: 100 KSPPPPVKHYSPPPVYKSPPPPVKHYSPP 128 Score = 29.5 bits (63), Expect = 2.8 Identities = 24/90 (26%), Positives = 29/90 (32%), Gaps = 8/90 (8%) Frame = +2 Query: 194 TPPPQIPFWGXK---KKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-----PXXX 349 +PPP + + K PP + K PPP PPPP P Sbjct: 61 SPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKS------PPPPVKHYSPPPV 114 Query: 350 XXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPP + P Sbjct: 115 YKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 144 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 31.5 bits (68), Expect = 0.68 Identities = 25/89 (28%), Positives = 30/89 (33%), Gaps = 7/89 (7%) Frame = +2 Query: 194 TPPPQIPFWGXK---KKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPP----PPXXXX 352 +PPP + + K PP + K PPP K PPP PP Sbjct: 45 SPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPPV-----KYYSPPPVYKSPPPPVY 99 Query: 353 XPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPP + P Sbjct: 100 KSPPPPVKHYSPPPVYKSPPPPVKHYSPP 128 Score = 29.5 bits (63), Expect = 2.8 Identities = 24/90 (26%), Positives = 29/90 (32%), Gaps = 8/90 (8%) Frame = +2 Query: 194 TPPPQIPFWGXK---KKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPP-----PXXX 349 +PPP + + K PP + K PPP PPPP P Sbjct: 61 SPPPPVKHYSPPPVYKSPPPPVKYYSPPPVYKSPPPPVYKS------PPPPVKHYSPPPV 114 Query: 350 XXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPP PPPP + P Sbjct: 115 YKSPPPPVKHYSPPPVYKSPPPPVKHYSPP 144 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.1 bits (67), Expect = 0.90 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP F PPP P PPPP PPPPP Sbjct: 44 PPP--PHFSPPHQPPPSPYPHPHPPPPSPYPHP---HQPPPPP 81 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 P PPP PPPPP PPPP Sbjct: 23 PVPPPPSHISPPPPPFSPP----HHPPPP 47 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPP PPP P Sbjct: 33 PPPPPFSPPHHPPPPHFSPP---HQPPPSP 59 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PP + PPPPP PPP P Sbjct: 65 PPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +2 Query: 326 PPPPPXXXXXPPP----PPXXXXXGGGXXPPPPPPXXF 427 PPPP PPP PP P PPPP + Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPY 71 Score = 27.9 bits (59), Expect = 8.4 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGX---PP--PPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPPF PP PPP P PPP PPPP Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG GGG G GGGGG Sbjct: 152 GGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGG 287 GGGGGG G GGG + GGG Sbjct: 152 GGGGGGYGGGGGYGGGGGGYGGGGRGGGG 180 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGGXXF 278 GGG GG GGGGG + GGG + Sbjct: 155 GGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCY 186 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PP P PPPPPP Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 30.3 bits (65), Expect = 1.6 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 8/52 (15%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPP----PPXXXXXPP----PPPXXXXXGGGXXPPPPPP 418 PPPF F PP PP PP PPP PPPPP Sbjct: 56 PPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 Score = 29.1 bits (62), Expect = 3.7 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPP--PPPXXXXXGGGXXPPPPP-PXXFFFXP 439 PPP PP PP PP PPP PP PP P F P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFP-----ALFPPEPPLPPRFELPP 77 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 31.1 bits (67), Expect = 0.90 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 326 PPP----PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP PPPP G P PPPP Sbjct: 283 PPPMQFRPPQGMPPPPPPQFLNHQQGFGGPRPPPP 317 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP +G PPPPP GG PPPPP Sbjct: 283 PPPMQFRPPQGMPPPPPPQFL-------NHQQGFGGPRPPPPP 318 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P P PPP G PPPPPP Sbjct: 260 PPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQG---MPPPPPP 300 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 31.1 bits (67), Expect = 0.90 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = -1 Query: 462 PPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 P P G + GG G G P GGGGG G G G Sbjct: 69 PGPWSGPRGPRPGGGGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTG 114 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 31.1 bits (67), Expect = 0.90 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 P PPP PPPP PPPP + P Sbjct: 99 PSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGP 136 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 31.1 bits (67), Expect = 0.90 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPP---PPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP P PP PPPPPP Sbjct: 152 PPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP PPPP PPPPP Sbjct: 158 PPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +2 Query: 320 GXPPPP--PXXXXXPPPPPXXXXXGGGXXPPP----PPP 418 G PPPP P PPP P PPP PPP Sbjct: 144 GQPPPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPP 182 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 31.1 bits (67), Expect = 0.90 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 6/50 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPP---PPPXXXXXP---PPPPXXXXXGGGXXPPPPPP 418 PPP GG PP PPP P PPPP G P P P Sbjct: 31 PPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRP 80 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 31.1 bits (67), Expect = 0.90 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = -1 Query: 417 GGG----GGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGG GGG PP GGG G GGGGG P KGGG Sbjct: 402 GGGSPSPGGGSGSPPST---GGGSGSPPSTGGGGGSP------SKGGG 440 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP F + PPPP PPPP Sbjct: 225 PPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPPP PPPPP PP P Sbjct: 65 PPPPSPQYSPPPPPSQSSPPRSRCPPVP 92 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 10/50 (20%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPP----------PXXXXXGGGXXPPPPPPXXFFFXP 439 G PPPP PPPP P G PP PPP + P Sbjct: 63 GNPPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPP 112 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 30.7 bits (66), Expect = 1.2 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGG-GGGXPPXKKXXKKGG 289 G + GGGG G P GGGG GG GGG P K K G Sbjct: 107 GGRFGKPGGGGLGGGGLPGGLGGLGGGGLPGGLGGLGGGENPLAKISKMFG 157 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 K P P P PPPP PPPPPP Sbjct: 5 KYAYPYPAPGNYPQGPPPPVGVPPQYYPPPPPPPP 39 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P + +G PP PPPPP PPPPPP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPP--------PPPPPPPP 44 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPPP PPPP Sbjct: 105 PPPPPP--PPPPPPPSSTWDFWDPFIPPPP 132 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 9/40 (22%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP---------XXXXXGGGXXPPPPPP 418 P PPP PPPPP PPPPPP Sbjct: 71 PSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPP 110 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 30.7 bits (66), Expect = 1.2 Identities = 22/77 (28%), Positives = 23/77 (29%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXX 376 PPP IP + PP F F G PP PP P P Sbjct: 24 PPPGIP---PQSGGPPTGSEAVGFRPFTPSASQPTRPFTASGPPPAPPVGTMRPGQPSPF 80 Query: 377 XXXGGGXXPPPPPPXXF 427 G PPPP F Sbjct: 81 VSQIPGSRPPPPSSNSF 97 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP 370 PPPPP PPPPP Sbjct: 90 PPPPPPIENLPPPPP 104 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP 370 PPPPP PPPPP Sbjct: 91 PPPPPIENLPPPPPP 105 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFF 433 PPP PPPPP PP PPPP ++F Sbjct: 55 PPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYF 103 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/55 (32%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPP--PXXXXXPPP----PPXXXXXGGGXXPPPPPPXXFFF 433 PPP + + PPPP P PP PP G PP P F+F Sbjct: 95 PPPPRFYYFESTPPPPPLSPDGKGSPPSVPSSPPSPKGQSQGQQQPPYPFPYFYF 149 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PP P PPP P PPPPPP Sbjct: 45 PPSKPSPSMSPPPSPSLPLSSS---PPPPPP 72 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G G GG GGGGG GGGGG Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGGGG 134 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGG 287 GGGGGG GG G + + GGG Sbjct: 128 GGGGGGGRGGGGGSGNGEGYGEGGGYGGG 156 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/50 (36%), Positives = 21/50 (42%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGG 289 G + GGGGG GGGGG GGGGG + + GG Sbjct: 112 GSGRGRGSGGGGGH---------GGGGGGGGGRGGGGGSGNGEGYGEGGG 152 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP 370 PPPPP PPPPP Sbjct: 107 PPPPPPKPQPPPPPP 121 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGG-GGGXXFXXGGG---GGXPPXKKXXKKGGG 286 GGGGGG GG GGG GGG G K +KGGG Sbjct: 67 GGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGG 114 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG G GGG G GGG Sbjct: 453 GGGGGGSVGGGGRGSGGAGGGTGGSVGAGGG 483 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G GGGG G GG GG GG GG GGG Sbjct: 150 GGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGG 200 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGG GG GGGGG GGG G Sbjct: 471 GGGTGGSVGAGGGVGVGGGGGIGGGAGGGVG 501 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGG GG GGGG GGGG GGG Sbjct: 86 GGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGG 129 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGG GG G GG GG G + K GGG Sbjct: 127 GGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGG 170 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G GG G PPP G GGG GGGGG Sbjct: 15 GYGGRGRSPPPPPPRRGYGGG-----GGGGG 40 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GG G PPP GGGGG G G Sbjct: 17 GGRGRSPPPPPPRRGYGGGGGGGGRRGSSHG 47 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 365 PPXXXXXGGGXXPPPPPP 418 PP G G PPPPPP Sbjct: 11 PPRRGYGGRGRSPPPPPP 28 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 4/34 (11%) Frame = +2 Query: 326 PPPP----PXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP P PPPP PPPPP Sbjct: 42 PPPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPP 75 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPPP PPPP PPPPP Sbjct: 111 PPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDI----PIPPPPP 149 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPP 406 PPPP PPPPP PP Sbjct: 135 PPPPSTDIPIPPPPPAPVSASPPLTPP 161 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPP P PPPP Sbjct: 517 PPPPSESEDVPPPPPDSY-----SEPIPPPP 542 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPPP PPPP PPPPP Sbjct: 508 PPPPGEEWIPPPPSE-----SEDVPPPPP 531 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPF + PPPP PPP P Sbjct: 48 PPFFPLYSSTSPPPPPSPPQPLPPPAP 74 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP 370 PPPPP PPPPP Sbjct: 24 PPPPPYYYLDPPPPP 38 >At3g05220.2 68416.m00570 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 478 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G G G G GG GGGGG KKGGG Sbjct: 241 GKSGNGDEKKSAGKKDGHGGNKVKSHGGGGGVQHYDSGPKKGGG 284 >At3g05220.1 68416.m00569 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 577 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G G G G GG GGGGG KKGGG Sbjct: 340 GKSGNGDEKKSAGKKDGHGGNKVKSHGGGGGVQHYDSGPKKGGG 383 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP 370 PPPPP PPPPP Sbjct: 107 PPPPPPPSPSPPPPP 121 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXG---GGXXPPPPPP 418 PPPPP P P G PPPPPP Sbjct: 575 PPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPP 608 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 8/39 (20%) Frame = +2 Query: 326 PPPPPXXXXX--------PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPP P PPPPPP Sbjct: 605 PPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPP 643 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGP 707 PPPPPP P K P PP P Sbjct: 637 PPPPPPPPLHSNSRMGAPTSSLVLKSPPVPPPPAP 671 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 30.3 bits (65), Expect = 1.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP 370 PPPPP PPPPP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 329 PPPPXXXXXPPPPPXXXXXGGGXXP 403 PPPP PPPPP G P Sbjct: 247 PPPPPPPPPPPPPPPQRLYGENDTP 271 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +2 Query: 329 PPPPXXXXXPPPP-PXXXXXGGGXXPPPPP 415 PPP PPPP P G PPPP Sbjct: 54 PPPQQQQESPPPPLPENSSDGSSSSSPPPP 83 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 6/50 (12%) Frame = +2 Query: 287 PPPFXXXFXKGGXPP------PPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP PP PPP PPPP G PPP Sbjct: 33 PPPSDNQETTSPPPPSSPDIAPPPQQQQESPPPPLPENSSDGSSSSSPPP 82 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGG 391 PPP PPPPP P P P GG Sbjct: 252 PPPGSMGTNWVSSPPPPPPGNWQPMPSPPAPVSGG 286 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGG 328 GGGGGG GGGG GGGG Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGG 130 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 414 GGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGG GGGGG GGGG Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGG 130 Score = 29.1 bits (62), Expect = 3.7 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGG P GGGGG G GGG GGG Sbjct: 102 GGGGGYGGGTP---GGGGGGGGDTGAGAGGGGYGGGGDTGAGGG 142 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 402 GXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G PP GGGGG GGGG GGG Sbjct: 91 GTTPPGGGDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGG 129 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG G GGG GGG G Sbjct: 114 GGGGGGGDTGAGAGGGGYGGGGDTGAGGGVG 144 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGG 287 GGGGGG G GGG GGG Sbjct: 114 GGGGGGGDTGAGAGGGGYGGGGDTGAGGG 142 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGGG G GGG GGGG GGG Sbjct: 172 GGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGG 215 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 414 GGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGG GGGGG GGGGG Sbjct: 107 GGGGGYGGAAGGHAGGGGGGS----GGGGG 132 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGG-GGXPPXKKXXKKGGG 286 GGG GG GGGGG GG GG GGG Sbjct: 194 GGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGG 238 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG GG G + GGG G Sbjct: 210 GGGGGGGSGGGGAYGGGGAHGGGYGSGGGEG 240 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GG GGG GGGGG G GG GGG Sbjct: 237 GGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGG 280 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPF---XKXXXKGGGXXF 278 GGGGGG GGGGG + + GGG F Sbjct: 443 GGGGGGYNPFHGGGGGGQQYTFHFEGGFPGGGGGF 477 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXP 319 GGGGGG P GGGGG + GG P Sbjct: 442 GGGGGGGYNP---FHGGGGGGQQYTFHFEGGFP 471 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 29.9 bits (64), Expect = 2.1 Identities = 26/85 (30%), Positives = 30/85 (35%) Frame = +2 Query: 161 PXFXXXXLKKITPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPP 340 P + K+I PP + KK+ PP K PPP K PP PP Sbjct: 197 PVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVY-KPPPKVELPPPIP----KKPCPPKPP 251 Query: 341 XXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP P PPP P Sbjct: 252 K-IEHPPPVPVYKPPPKIEKPPPVP 275 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +2 Query: 287 PPPFXXXFXK--GGXPPPPPXXXXXPPP-PPXXXXXGGGXXP---PPPP 415 PPP + PPPPP P P PP G P PPPP Sbjct: 198 PPPSTSGYPPIPSAYPPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPPP 246 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP PPP PPPPP PPPPP Sbjct: 10 PPPLPPRLELRRQRAPPPQPPPPPPPPP----------PPPPP 42 Score = 23.0 bits (47), Expect(2) = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 582 KKXXPXGPPPPPP 620 ++ P PPPPPP Sbjct: 22 QRAPPPQPPPPPP 34 Score = 23.0 bits (47), Expect(2) = 9.1 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +3 Query: 594 PXGPPPPPPXXXKKKKXXXXP 656 P PPPPPP + + P Sbjct: 34 PPPPPPPPPRLGPRLRLRLLP 54 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGG 394 PPPPP P PPP GG Sbjct: 267 PPPPPPGSWQPSPPPPPPPVSGG 289 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 429 KXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 K GGGGGG GGGG F GG GG Sbjct: 57 KPCAGGGGGGSTGNNGGGSGSGGGGGGF--GGSGG 89 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGGXXF 277 GGGG G GGG G GGGGG GGG + Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGY 199 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -1 Query: 414 GGGGGXXPPPXXXXXGGG-GGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGG GGG GG GGGGG KG G Sbjct: 167 GGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKGSG 210 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G GGGG GGGGG GG GG Sbjct: 106 GYGGGGPGYGGGGYGPGGGGGGVVIGGGFGG 136 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP PPP P PP P P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 109 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 278 KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 K PPP P P P P PPP P PP P Sbjct: 61 KPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P PPP P PPP P P PP Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 585 KXXPXGPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 K P P P P K P P P PP G PP Sbjct: 78 KPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPP 119 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGG---GXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGGG GGGG G GGGG + K+GGG Sbjct: 65 GGGGGGGG-------RGGGGARSGGRSRGGGGGSSSSRSRDWKRGGG 104 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 27.1 bits (57), Expect(2) = 2.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 326 PPPPPXXXXXPPPPP 370 P PPP PPPPP Sbjct: 76 PSPPPTLPPSPPPPP 90 Score = 21.0 bits (42), Expect(2) = 2.5 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 386 GGGXXPPPPPP 418 G G PPPP P Sbjct: 120 GSGAAPPPPLP 130 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 24.2 bits (50), Expect(2) = 2.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 386 GGGXXPPPPPP 418 GG PPPPPP Sbjct: 324 GGEFHPPPPPP 334 Score = 23.8 bits (49), Expect(2) = 2.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 401 PPPPPPXXFFFXP 439 PPPPPP ++ P Sbjct: 333 PPPPPPVEYYKSP 345 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 25.4 bits (53), Expect(2) = 2.6 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 603 PPPPPPXXXKKKKXXXXPXXPXXXKXXP 686 PPPPPP + P P K P Sbjct: 156 PPPPPPSKTHEPSRRITPSPPPPSKILP 183 Score = 22.6 bits (46), Expect(2) = 2.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 594 PXGPPPPPP 620 P PPPPPP Sbjct: 152 PNTPPPPPP 160 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPP PPPPP PPPPPP F Sbjct: 98 PPPQ----PPPPPQPLNLFS-PPPPPPPPDPF 124 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 432 KKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPP 316 KK G GGGG GGGGG GG GG PP Sbjct: 56 KKWGGGMGGGG----------GGGGGSGGGGGGRGGGPP 84 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGG 326 GGGGGG GGGGG Sbjct: 63 GGGGGGGGGSGGGGGG 78 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPP 367 G PPPPP PPPP Sbjct: 68 GFPPPPPPPLSPPPPP 83 >At3g21215.1 68416.m02681 RNA-binding protein, putative contains RNA recognition motif, Pfam:PF00076; contains AT-AC splice sites at intron 8 Length = 339 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 293 PFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 P+ + G PPPP PP P PPPPP Sbjct: 8 PYHQQWPPAGAPPPPAAVSSAAPPHPPPIH----HHPPPPP 44 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +2 Query: 203 PQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXX 382 P P + K PP PPP PP P PP P Sbjct: 680 PPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSP 739 Query: 383 XGGGXXPPPP 412 GG PPP Sbjct: 740 PQGGYGTPPP 749 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -1 Query: 474 RGXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 RG P P G GGGGG P GGG G + GGG Sbjct: 59 RGPDPGPGFFFGGAGPGPGYGGGGGHGP----GYGGGGDGRGYGSETGGG 104 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPP 316 G + G G G P P GG G GGGGG P Sbjct: 46 GPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGP 86 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 370 GGGGGXXXXXGGGGGXXPF 314 GGGGG GGGGG P+ Sbjct: 611 GGGGGGGGGPGGGGGGGPY 629 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGG 326 GGGGGG GGGGG Sbjct: 611 GGGGGGGGGPGGGGGG 626 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGG 326 GGGGGG GGGGG Sbjct: 612 GGGGGGGGPGGGGGGG 627 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGG 287 GGGGGG GGGGG G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSG 219 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 414 GGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G G P GGGGG GGGGG Sbjct: 80 GNAHGRADCPGGIVVGGGGGGGGGGGGGGG 109 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGGG G G G GGG G Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G KK G GGGG GGGGG GGG G Sbjct: 34 GKKKNGGGEGGGG----EGTSGEGGGGGGDGTKGGGDG 67 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 411 GGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGG GGGG GGGGG Sbjct: 29 GGGGEGKKKNGGGEGGGGEGTSGEGGGGG 57 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGGG GGG GGG K ++G G Sbjct: 53 GGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDG 96 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGG G GGG G GG GG GGG Sbjct: 14 GGGGDGTKGGGNTITGGGGEGKKKNGGGEGGGGEGTSGEGGGGG 57 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G G G GGGGG GGGGG + + GG Sbjct: 38 GRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGG 81 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G G G GGGGG GGGGG + + GG Sbjct: 38 GRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGG 81 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 317 GGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G PP PP PPPP P PPPP Sbjct: 159 GQMPPQPPFAGQGGPPPPYGMRP---PYPGPPPP 189 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/62 (32%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +2 Query: 290 PPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPP-PPPXXFFFXPXXXXXGGGX 466 PP +GG PPPP P P P GG P PPP P G Sbjct: 162 PPQPPFAGQGG--PPPPYGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGP 219 Query: 467 XP 472 P Sbjct: 220 PP 221 Score = 28.3 bits (60), Expect = 6.4 Identities = 22/73 (30%), Positives = 23/73 (31%) Frame = +2 Query: 200 PPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPXXX 379 PPQ PF G PP PPP + PPP PPPP Sbjct: 162 PPQPPFAGQGGPPPPYGMRPPY-----PGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGM 216 Query: 380 XXGGGXXPPPPPP 418 P PPP Sbjct: 217 QGPPPSRPGMPPP 229 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGG--GGXXFXXGGGGG 325 GGGGGG GGG GG GGGGG Sbjct: 71 GGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 >At4g23882.1 68417.m03434 heavy-metal-associated domain-containing protein Length = 284 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPP P PPP PPPP PP PP Sbjct: 227 PPPQAVPGFTTPIPYPPPSFFPGRPPPPYTGAGMFQSAPPQSPP 270 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 414 GGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGGGG GGGGG G GGG Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +2 Query: 326 PPPPPXXXXXPPPP------PXXXXXGGGXXPPPPPP 418 PPPPP PPP P G PPPP P Sbjct: 28 PPPPPPQSQPPPPQTQQQTYPPVMGYPGYHQPPPPYP 64 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 P P PPPPP PPP PP Sbjct: 44 PSPSSVHRPYPPPPPLPDFAPQPLLPPPSPP 74 Score = 27.9 bits (59), Expect = 8.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPP--PPXXXXXGGGXXPPPPPP 418 PPPPP P P PP PPPPPP Sbjct: 54 PPPPPLPDFAPQPLLPPPS--------PPPPPP 78 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -1 Query: 411 GGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGG GGGGG GGGG + ++GGG Sbjct: 102 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR---REGGG 140 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 29.1 bits (62), Expect = 3.7 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -1 Query: 411 GGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 GGGG GGGGG GGGG + ++GGG Sbjct: 119 GGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR---REGGG 157 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXG--GGGGXPPXKKXXKKGGGXXF 277 GGGGG GGGGG G GGGG GGG + Sbjct: 90 GGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGY 138 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPPPP PPPPPP Sbjct: 224 PPPPPSQPLPRPLLLPPPPPP 244 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPPXXFFFXP 439 PPPPP PPPPP F P Sbjct: 223 PPPPPPSQPLPRPLLLPPPPPPSFHAQP 250 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 338 PXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 P PPP P PPPPPP F Sbjct: 51 PKAPTHPPPNPSQEAPVPSPYPPPPPPSPLF 81 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PP + PPPPP PPPPP Sbjct: 373 PPQYQSLIPPPSPPPPPP-----PPPPP 395 Score = 24.6 bits (51), Expect(2) = 9.2 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 314 KGGXPPPPPXXXXXPPPPP 370 K PP P PPPPP Sbjct: 240 KPSSPPQQPPATPPPPPPP 258 Score = 23.8 bits (49), Expect(2) = 4.2 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 Query: 401 PPPPPPXXFFFXPXXXXXGG 460 PPPPPP F P G Sbjct: 473 PPPPPPPPFRVPPLKYVVSG 492 Score = 23.4 bits (48), Expect(2) = 4.2 Identities = 11/34 (32%), Positives = 11/34 (32%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPPP P G P P P F Sbjct: 424 PPPPPPRYTQFDPQTPPRRVKSGRPPRPTKPKNF 457 Score = 21.4 bits (43), Expect(2) = 9.2 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPPP 418 PPP P PPPPPP Sbjct: 296 PPPSPPPP-------PPPPPP 309 >At5g04170.1 68418.m00405 calcium-binding EF hand family protein low similarity to peflin [Homo sapiens] GI:6015440; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 354 Score = 26.2 bits (55), Expect(2) = 4.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 5/32 (15%) Frame = +2 Query: 332 PPPXXXXXPPP-----PPXXXXXGGGXXPPPP 412 PPP P P PP GGG PPP Sbjct: 73 PPPSAPYAPSPGDYNKPPKEKPYGGGYGAPPP 104 Score = 21.0 bits (42), Expect(2) = 4.4 Identities = 10/32 (31%), Positives = 12/32 (37%) Frame = +2 Query: 239 PPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPP 334 PP + G PPP + GG PP Sbjct: 5 PPTSQGYGYGYGGGNQPPPPQPPYSSGGNNPP 36 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGGXXPFXKXXXKGGG 287 GGGGGG G GGG + GGG Sbjct: 131 GGGGGGYGGSGGYGGGAGGYGGSGGYGGG 159 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGG 326 GGGGGG GGGGG Sbjct: 11 GGGGGGSGGGIGGGGG 26 >At5g53060.1 68418.m06592 KH domain-containing protein Length = 652 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGG 326 GGGGGG GGGGG Sbjct: 35 GGGGGGNNRYRGGGGG 50 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/65 (29%), Positives = 20/65 (30%) Frame = -1 Query: 471 GXXPPPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKG 292 G P G GG GGG GGGG GGGG G Sbjct: 337 GYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNG 396 Query: 291 GGXXF 277 GG + Sbjct: 397 GGSFY 401 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGGXPPXKKXXKKGGG 286 G GGGG G GGG G GGG GGG Sbjct: 363 GAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGG 406 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPPPP PPP P PPPP Sbjct: 47 PPPPPSNPSPPPPSPTTT-----ACPPPP 70 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGGXXP 472 PPPP PPPP G PP + P GG P Sbjct: 56 PPPPSPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGGYYYP 104 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 28.7 bits (61), Expect = 4.8 Identities = 26/83 (31%), Positives = 27/83 (32%), Gaps = 8/83 (9%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXP---PPPPXXXXXPPP 364 +PPP P KK PP K PP F P P PP PPP Sbjct: 89 SPPPPAP-----KKSPPPPTPK------KSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPP 137 Query: 365 PPXXXXXGGGXXPP-----PPPP 418 P PP PPPP Sbjct: 138 APKKSPSTPSLPPPTPKKSPPPP 160 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 11/44 (25%) Frame = +2 Query: 320 GXPPPPPXXXXXP----------PPP-PXXXXXGGGXXPPPPPP 418 G PPPPP P PPP P PPPPPP Sbjct: 11 GPPPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPP 54 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 11/46 (23%) Frame = +2 Query: 314 KGGXPPPPPXXXXX----------PPP-PPXXXXXGGGXXPPPPPP 418 +G PPPPP PPP PP PPPPPP Sbjct: 10 EGPPPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPPP 55 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 373 GGGGGGXXXXXGGGGG 326 GGGGGG GGGGG Sbjct: 160 GGGGGGRYGSGGGGGG 175 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 369 GGGGGXXFXXGGGGG 325 GGGGG + GGGGG Sbjct: 160 GGGGGGRYGSGGGGG 174 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 600 GPPPPPPXXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 G PPPPP P P P PP P Sbjct: 99 GAPPPPPDLFPPPSAQMLPPPPASSPAPPSPPSSSRP 135 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 28.7 bits (61), Expect = 4.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 GGG GG G GGG GGGGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 28.7 bits (61), Expect = 4.8 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 56 SPPPPKKHYEYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 111 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 112 SPPPPKKHYVYKSPPPP 128 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 84 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 139 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 140 SPPPPKKHYVYKSPPPP 156 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 112 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 167 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 168 SPPPPKKHYVYKSPPPP 184 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 140 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 195 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 196 SPPPPKKHYVYKSPPPP 212 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 168 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 223 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 224 SPPPPKKHYVYKSPPPP 240 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 196 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 251 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 252 SPPPPKKHYVYKSPPPP 268 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 224 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 279 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 280 SPPPPKKHYVYKSPPPP 296 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 252 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 307 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 308 SPPPPKKHYVYKSPPPP 324 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 280 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 335 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 336 SPPPPKKHYVYKSPPPP 352 Score = 28.3 bits (60), Expect = 6.4 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 4/77 (5%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPP--- 364 +PPP + K PP + PPP K PPPP PPP Sbjct: 308 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKKHYVYKS---PPPPVKHYSPPPVYH 363 Query: 365 -PPXXXXXGGGXXPPPP 412 PP PPPP Sbjct: 364 SPPPPKKHYVYKSPPPP 380 Score = 28.3 bits (60), Expect = 6.4 Identities = 22/73 (30%), Positives = 25/73 (34%) Frame = +2 Query: 194 TPPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPPX 373 +PPP + K PP + PPP K PPPPP PP P Sbjct: 364 SPPPPKKHYVYKSP-PPPVKHYSPPPVYHSPPPPKEKYVYKS--PPPPPVHHYSPPHHPY 420 Query: 374 XXXXGGGXXPPPP 412 PPPP Sbjct: 421 LY-----KSPPPP 428 >At4g22770.1 68417.m03287 DNA-binding family protein contains a AT hook motif (DNA binding motifs with a preference for A/T rich regions), Pfam:PF02178 Length = 334 Score = 25.0 bits (52), Expect(2) = 5.7 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +2 Query: 401 PPPPPPXXFFFXPXXXXXGGGXXPL 475 PPPPPP F P G P+ Sbjct: 47 PPPPPPPQNSFTPSAAMDGFSSGPI 71 Score = 21.8 bits (44), Expect(2) = 5.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 335 PPXXXXXPPPPP 370 PP PPPPP Sbjct: 41 PPNSVAPPPPPP 52 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP + PPP P PP PP Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPPPPSPP 437 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 28.3 bits (60), Expect = 6.4 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGG-GGXPPXKKXXKKGG 289 G K GG GG GGGG + GGG GG P GG Sbjct: 546 GGKNRRSGGRFGGRDFRRESFSRGGGGADYYGGGGGYGGVPGGGYGAMPGG 596 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 370 GGGGGXXXXXGGGGGXXPFXKXXXKGGG 287 GGGGG GGG G P GGG Sbjct: 577 GGGGGYGGVPGGGYGAMPGGYGPVPGGG 604 >At3g29390.1 68416.m03693 hydroxyproline-rich glycoprotein family protein sequencing discrepancy between cDNA and genomic sequence prevents representation of entire coding sequence Length = 578 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPP 412 PPPPP PP PPPP Sbjct: 480 PPPPPKTIAPPPSKTMSPPSSKSMLPPPP 508 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 582 KKXXPXGPPPPPP----XXXKKKKXXXXPXXPXXXKXXPXPPGGGPP 710 K+ P PPPPPP +KK P P PP PP Sbjct: 29 KEVPPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPPPLPPP 75 >At3g04160.1 68416.m00440 expressed protein ; expression supported by MPSS Length = 712 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +2 Query: 329 PPP---PXXXXXPPPPPXXXXXGGGXXPPPPP 415 PPP P PPPPP P PPP Sbjct: 22 PPPNSNPNFFFRPPPPPLQNPNNYSIVPSPPP 53 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -1 Query: 459 PPXXXXXGXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 PP G + GGGG GGGGG GGGGG Sbjct: 3 PPMRGGGGFRGRGGRDGGGGGRFGGGGGRFGGGGGR---FGGGGG 44 >At2g44790.1 68415.m05574 uclacyanin II strong similarity to uclacyanin II GI:3399769 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin II GI:3399768 Length = 202 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 G P P P P G G PPPPP Sbjct: 143 GTPTTPESPPSGGSPTPTTPTPGAGSTSPPPPP 175 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/38 (42%), Positives = 17/38 (44%) Frame = -1 Query: 438 GXKKXXXGGGGGGXXPPPXXXXXGGGGGXXFXXGGGGG 325 G + GGGGGG GGGGG G GGG Sbjct: 581 GSGRGGYGGGGGGYG---GGGGYGGGGGYGGGGGYGGG 615 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPP 418 PPPPP PP P PPP PP Sbjct: 193 PPPPPP----PPTPRPPRLLSSQPAPPPTPP 219 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPP--PXXXXXGGGXXPPPPPP 418 PPPPP PP P P PP PP Sbjct: 61 PPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP P WG P + PPF PPP PPP P Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAY-PPHQPPFNAGANGNSQFPPPSTGAPIPPPYP 118 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +2 Query: 326 PPPPPXXXXXPPPP--PXXXXXGGGXXPPPPPP 418 PPPPP PP P P PP PP Sbjct: 61 PPPPPPPQWGPPSPHYPQGQPYSSPAYPPHQPP 93 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 197 PPPQIPFWGXKKKCPPXXEXXGKFXX*KXXPPPFXXXFXKGGXPPPPPXXXXXPPPPP 370 PPP P WG P + PPF PPP PPP P Sbjct: 62 PPPPPPQWGPPSPHYPQGQPYSSPAY-PPHQPPFNAGANGNSQFPPPSTGAPIPPPYP 118 >At1g55160.1 68414.m06299 expressed protein Length = 188 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 386 GGGXXPPPPPPXXFF 430 GGG PPPPPP F Sbjct: 53 GGGSVPPPPPPKESF 67 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 332 PPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFFFXPXXXXXGGG 463 PPP PPPP PPP P + P GG Sbjct: 21 PPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYPPPSSRPYEGG 64 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 23.4 bits (48), Expect(2) = 6.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 594 PXGPPPPPP 620 P PPPPPP Sbjct: 27 PKSPPPPPP 35 Score = 23.0 bits (47), Expect(2) = 6.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 603 PPPPPPXXXKKKK 641 PPPPPP K K Sbjct: 32 PPPPPPALPKPPK 44 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGGGXXFXXGGG-GGXPPXKKXXKKGGG 286 GG GGG P GG GG GGG GG GGG Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGG 97 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/56 (28%), Positives = 18/56 (32%), Gaps = 5/56 (8%) Frame = +2 Query: 287 PPPFXXXFXKGGXPPPPPXXXXXPPPP-----PXXXXXGGGXXPPPPPPXXFFFXP 439 PPP+ PPPP PPP P PPP P + P Sbjct: 377 PPPYTYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSP 432 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 356 PPPPPXXXXXGGGXXPPPPP 415 PPPPP PPPPP Sbjct: 325 PPPPPPSPEHKAPAPPPPPP 344 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 359 PPPPXXXXXGGGXXPPPPPP 418 PPPP PPPPPP Sbjct: 325 PPPPPPSPEHKAPAPPPPPP 344 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXFF 430 PPPP P PP PPPPPP F Sbjct: 143 PPPPASTAIWSPSPPSPQH------PPPPPPQPDF 171 >At3g16510.1 68416.m02107 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 360 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 326 PPPPPXXXXXPPPPPXXXXXGGGXXPPPPPPXXF 427 PPPPP PPP PPPP F Sbjct: 243 PPPPPSASNLYPPPYYSTSPPQHQSYPPPPGHSF 276 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -1 Query: 417 GGGGGGXXPPPXXXXXGGGG-GXXFXXGGGGGXPPXKKXXKKGGG 286 GGGGG GGGG G GGGGG GGG Sbjct: 97 GGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 320 GXPPPPPXXXXXPPPPPXXXXXGGGXXPPPPP 415 G PPP PPPPP G PPP P Sbjct: 637 GMMQPPPMAEMPPPPPP-------GEAPPPLP 661 >At1g07280.1 68414.m00774 expressed protein Length = 552 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = -1 Query: 432 KKXXXGGGGGGXXPPPXXXXXGGGGGXXF 346 K GGGGG PPP G G F Sbjct: 337 KTSFVGGGGGNNIPPPVQSGTDGDGSDQF 365 >At3g54220.1 68416.m05993 scarecrow transcription factor, putative nearly identical to SCARECROW [Arabidopsis thaliana] GI:1497987 Length = 653 Score = 23.4 bits (48), Expect(2) = 9.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +3 Query: 600 GPPPPPP 620 GPPPPPP Sbjct: 32 GPPPPPP 38 Score = 22.6 bits (46), Expect(2) = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 603 PPPPPPXXXKKKK 641 PPPPPP +K+ Sbjct: 35 PPPPPPLVMVRKR 47 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,105,518 Number of Sequences: 28952 Number of extensions: 440122 Number of successful extensions: 11837 Number of sequences better than 10.0: 198 Number of HSP's better than 10.0 without gapping: 990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5864 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1843581600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -