BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D21 (853 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 2.2 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 25 2.9 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 6.7 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 6.7 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 24 6.7 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.9 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.4 bits (53), Expect = 2.2 Identities = 13/40 (32%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +2 Query: 236 QCSSC--AKYRXPSDSSFENXRRAARSKPKVCSQCHQSXK 349 QC C KY+ S ++ R K C CHQ K Sbjct: 488 QCLECKNVKYKGKCLDSCKSLPRLYSVDSKTCGDCHQECK 527 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 25.0 bits (52), Expect = 2.9 Identities = 13/62 (20%), Positives = 24/62 (38%) Frame = +2 Query: 26 GILKI*LPVFNRYNQHVQVFSIQFSSGAVLCSGFVPEVHPADLQATANTAPDNTYSATSW 205 G+ + P+F + + + + G + +G PE HPA D + + Sbjct: 236 GLRVVWFPLFKLFPVLLTIAIMWTVCGVLTATGVFPEGHPARTDVRLRVLQDAEWFRVPY 295 Query: 206 PG 211 PG Sbjct: 296 PG 297 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 6.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 662 DXNXYRXALRIFVXELSXFLENIPRNQKSAHYXAA 558 + N Y R++ EL FL+ P+ Q ++ Y A Sbjct: 2638 ETNLYNFHARLYDPELGRFLQLDPKEQYASPYLYA 2672 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 6.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 662 DXNXYRXALRIFVXELSXFLENIPRNQKSAHYXAA 558 + N Y R++ EL FL+ P+ Q ++ Y A Sbjct: 2639 ETNLYNFHARLYDPELGRFLQLDPKEQYASPYLYA 2673 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.8 bits (49), Expect = 6.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 466 LFQRFLRLTQANIY*YGKPLPTTCVXGSRT 555 LFQ+ + AN+Y G + T+ + GSRT Sbjct: 363 LFQQQIDEVNANVYGSGYQVVTSHLRGSRT 392 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 8.9 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = -2 Query: 324 HTFGLDRAARRXFSKEESDGXRYLAHEEHCH 232 H GLD +EE DG R H H Sbjct: 1844 HEPGLDHGPAEDHVEEEEDGTRSAIHMHAAH 1874 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 812,729 Number of Sequences: 2352 Number of extensions: 15765 Number of successful extensions: 73 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90545769 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -