BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D17 (886 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66500-13|CAA91312.1| 1780|Caenorhabditis elegans Hypothetical p... 29 5.8 Z48334-10|CAA88315.1| 1780|Caenorhabditis elegans Hypothetical p... 29 5.8 >Z66500-13|CAA91312.1| 1780|Caenorhabditis elegans Hypothetical protein F10B5.7 protein. Length = 1780 Score = 28.7 bits (61), Expect = 5.8 Identities = 19/68 (27%), Positives = 29/68 (42%) Frame = +3 Query: 426 YGYPQNQGITQERTCEQKASKRPGTVKRXRCWRFSIGSAPLTSITKIDAQVRGGETRQDY 605 + YP N+G ++ + S+RP T K C S P T I + RGG ++ Sbjct: 104 FSYPVNRGYLRDYLLQ---SQRPSTSKPVDCSVLKRHSLPSTHILYEKTKHRGGVNIEEQ 160 Query: 606 KDTRRFPW 629 + R W Sbjct: 161 EKLVRMLW 168 >Z48334-10|CAA88315.1| 1780|Caenorhabditis elegans Hypothetical protein F10B5.7 protein. Length = 1780 Score = 28.7 bits (61), Expect = 5.8 Identities = 19/68 (27%), Positives = 29/68 (42%) Frame = +3 Query: 426 YGYPQNQGITQERTCEQKASKRPGTVKRXRCWRFSIGSAPLTSITKIDAQVRGGETRQDY 605 + YP N+G ++ + S+RP T K C S P T I + RGG ++ Sbjct: 104 FSYPVNRGYLRDYLLQ---SQRPSTSKPVDCSVLKRHSLPSTHILYEKTKHRGGVNIEEQ 160 Query: 606 KDTRRFPW 629 + R W Sbjct: 161 EKLVRMLW 168 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,043,940 Number of Sequences: 27780 Number of extensions: 368140 Number of successful extensions: 867 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2234373834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -