BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D16 (928 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 4.5 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 7.8 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 22 7.8 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 4.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 198 GRDHDRVHEDRRGLYLH 148 G+D VH RRGL LH Sbjct: 14 GQDKHMVHWFRRGLRLH 30 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 654 SWYWNCVCASSKKLLKVLRCNH 719 S Y+ CV SK + +CNH Sbjct: 456 SVYYTCVSDGSKLVSIQRKCNH 477 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 527 KDNSASNGSGDFLAALHTQTNMTVVVANGNK 435 K NS +NGS D + ++ + NG+K Sbjct: 279 KPNSTTNGSPDVIKVEPELSDSEKTLCNGSK 309 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,305 Number of Sequences: 336 Number of extensions: 3819 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25961683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -