BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D13 (1378 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 44 2e-04 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 3e-04 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.008 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 38 0.014 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 31 0.014 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.019 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 38 0.019 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.025 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.033 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.033 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.033 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 37 0.033 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.038 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 36 0.057 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.057 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 36 0.100 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 36 0.100 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.23 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 34 0.23 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.23 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.26 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.28 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.30 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 33 0.40 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.53 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 31 0.56 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.70 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.70 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 33 0.70 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.70 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 33 0.70 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 33 0.70 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 32 0.93 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 32 0.93 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.93 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 1.1 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 32 1.2 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.2 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 31 1.6 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.8 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 30 3.8 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 30 3.8 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 30 3.8 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 30 3.8 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 29 4.3 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 30 5.0 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.0 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 29 6.6 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 25 7.2 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 8.7 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 8.7 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 29 8.7 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 29 8.7 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 8.7 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 29 8.7 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 8.7 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 47.2 bits (107), Expect = 3e-05 Identities = 36/142 (25%), Positives = 40/142 (28%), Gaps = 4/142 (2%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXX-PXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXX 1026 PPP P P PP P P P P PP P + + Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPY--PPPPN 153 Query: 1027 PXPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPP 1206 P PPP +PPP PP + P P PP Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Query: 1207 PXXX--XPXPPXXXXP-PPXPP 1263 P P PP P PP PP Sbjct: 214 PPNAPNPPYPPPPNAPNPPYPP 235 Score = 42.7 bits (96), Expect = 7e-04 Identities = 36/140 (25%), Positives = 37/140 (26%), Gaps = 2/140 (1%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPX-PKTQXPPXXXXXXXPXSFFFXXXXXX 1026 PPP P P PP P P P P PP P + Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLY-----PPP 164 Query: 1027 PXPPPPXHP-PPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXP 1203 P PPPP P PP P PP P PP P Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Query: 1204 PPXXXXPXPPXXXXPPPXPP 1263 PP P PPP P Sbjct: 225 PPNAPNP-----PYPPPPNP 239 Score = 40.3 bits (90), Expect = 0.004 Identities = 30/112 (26%), Positives = 32/112 (28%), Gaps = 2/112 (1%) Frame = +1 Query: 949 PKTQXPPXXXXXXXPXSFFFXXXXXXPXPPPPXHPPP-XPXPPXXXXXXXXXXXXXXXXX 1125 P T P P + P P PP PPP P PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPP----PPNPPYPPPPNAP 139 Query: 1126 FXXSXXXXXXPGXXPPXXXXXXXXXP-PPXXXXPXPPXXXXPPPXPPXXXXP 1278 + S P PP P PP P PP PPP PP P Sbjct: 140 YPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 40.3 bits (90), Expect = 0.004 Identities = 32/129 (24%), Positives = 34/129 (26%), Gaps = 1/129 (0%) Frame = +1 Query: 895 PPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXPXPPPPXHP-PPXPXP 1071 PP P P P PP P + + P PP P P PP P P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 1072 PXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPPPXXXXPXPPXXXXPP 1251 P P PP PPP P PP P Sbjct: 155 PYPPPLYPPPPNPPPPN--APYPPPPYPPPPNPPYPPPPNPPYPPP-PNAPNPPPPNPPY 211 Query: 1252 PXPPXXXXP 1278 P PP P Sbjct: 212 PPPPNAPNP 220 Score = 34.7 bits (76), Expect = 0.17 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 849 PPXPXXKNXXXXPPP-PPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P N PPP PPP P P P P N P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNP 204 Score = 34.3 bits (75), Expect = 0.23 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +3 Query: 1191 PXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXXPPXXAPXTX 1370 P PPP P P P PP P P P P + PP P Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN 166 Query: 1371 XP 1376 P Sbjct: 167 PP 168 Score = 32.7 bits (71), Expect = 0.70 Identities = 18/62 (29%), Positives = 20/62 (32%) Frame = +3 Query: 1191 PXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXXPPXXAPXTX 1370 P PPP P P P PP P P P+ P + PP AP Sbjct: 165 PNPPPPNAPYPPPPYP---PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Query: 1371 XP 1376 P Sbjct: 222 YP 223 Score = 31.9 bits (69), Expect = 1.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 1159 GXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPPXXXXP 1278 G PP PPP PP PPP PP P Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPP 120 Score = 31.5 bits (68), Expect = 1.6 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P N PPP PP P P P P N P Sbjct: 193 PPYPPPPNAPNPPPPNPP-YPPPPNAPNPPYPPPPNAPNP 231 Score = 30.3 bits (65), Expect = 3.8 Identities = 19/73 (26%), Positives = 20/73 (27%) Frame = +3 Query: 1158 GXAPXXXXXXXPXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXX 1337 G P P PPP P P P PP P P P P + Sbjct: 81 GGHPPTNFSPNPPYPPPPYP-PYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Query: 1338 XXPPXXAPXTXXP 1376 P AP P Sbjct: 140 YPPSPNAPYPPPP 152 Score = 30.3 bits (65), Expect = 3.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPP--PPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPP PP P P P P N P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 29.9 bits (64), Expect = 5.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P N PPP PP P P P P N P Sbjct: 177 PPYPPPPNPPYPPPPNPPYPP----PPNAPNPPPPNPPYP 212 Score = 29.5 bits (63), Expect = 6.6 Identities = 18/74 (24%), Positives = 20/74 (27%) Frame = +3 Query: 747 PXXXPPXXXFXXPXPXXXXPGGFFFF*KKXXGXXPPXPXXKNXXXXPPPPPPXXPXXXXX 926 P PP + P P + PP P PPPP P Sbjct: 115 PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPY 174 Query: 927 XXXPXPXPKNTKXP 968 P P P N P Sbjct: 175 PPPPYPPPPNPPYP 188 Score = 29.5 bits (63), Expect = 6.6 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 1/72 (1%) Frame = +3 Query: 1164 APXXXXXXXPXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPS-XPXXSXXX 1340 AP P PPP P P P PP P P P P + Sbjct: 138 APYPPSPNAPYPPPPNPPYPPPL--YPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPY 195 Query: 1341 XPPXXAPXTXXP 1376 PP AP P Sbjct: 196 PPPPNAPNPPPP 207 Score = 29.1 bits (62), Expect = 8.7 Identities = 18/71 (25%), Positives = 19/71 (26%) Frame = +3 Query: 1164 APXXXXXXXPXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXX 1343 AP P PPP P P PP P P P+ P Sbjct: 122 APYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP-PNAPYPPPPYP 180 Query: 1344 PPXXAPXTXXP 1376 PP P P Sbjct: 181 PPPNPPYPPPP 191 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/44 (29%), Positives = 14/44 (31%) Frame = +3 Query: 1191 PXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXP 1322 P PPP P P P PP P P P+ P Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 44.4 bits (100), Expect = 2e-04 Identities = 33/111 (29%), Positives = 33/111 (29%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXX 1179 G GGG GG G G G GG GGG G G GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGG---GGGGGGGGGGG 825 Query: 1178 XXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXXXCLGGXGXGGGWXGGGGXG 1026 GG G GG G GGG GGGG G Sbjct: 826 DGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 44.4 bits (100), Expect = 2e-04 Identities = 37/127 (29%), Positives = 39/127 (30%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGX 1197 G G G GGGG G G G G G GGG GG G GGG Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG- 829 Query: 1196 XXXXXXXXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXXXCLGGXGXGGGWXGGGGXGXXX 1017 GG G + GG G GGG GGGG G Sbjct: 830 ----YGDGGGFGDGGGYADGDGGGGGGGGGG----------GGGGGGGGGGGGGGGGGGG 875 Query: 1016 XXXKKKE 996 K +E Sbjct: 876 GVIKNEE 882 Score = 36.3 bits (80), Expect = 0.057 Identities = 24/75 (32%), Positives = 25/75 (33%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXGXXXXXXKKKEXGXXXXXXXGGFCVFGXGXGXXXXVXXXGXXXGG 894 GG G GGG GGGG G + G GG G G G G G Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Query: 893 XRXXXXGVFXGXGGG 849 G G GGG Sbjct: 846 DGGGGGGGGGGGGGG 860 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +1 Query: 853 PPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXPX 1032 PP P P PP P + P P P PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP----------PP 414 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 415 PPPPAPPPPPPPPP 428 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PPP P P PP P P P P PP P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP-------PPP 418 Query: 1030 XPPPPXHPPPXPXP 1071 PPPP PPP P P Sbjct: 419 APPPPPPPPPPPPP 432 Score = 42.7 bits (96), Expect = 7e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPP 1206 P PPPP PPP P PP P PP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPP-----------------PPQPPPPPPPPPPPPPP 408 Query: 1207 PXXXXPXPPXXXXPPPXPPXXXXP 1278 P P PP PPP PP P Sbjct: 409 PPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 41.9 bits (94), Expect = 0.001 Identities = 26/75 (34%), Positives = 26/75 (34%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PPP P P PP P P P P Q PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPP-------PSPPPPPQPPPPPPPPPPPPP---------P 408 Query: 1030 XPPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 409 PPPPPPPPPPAPPPP 423 Score = 35.5 bits (78), Expect = 0.100 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 1156 PGXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPPXXXXP 1278 P PP PPP P PP PPP PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 33.9 bits (74), Expect = 0.30 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +3 Query: 1200 PPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXXPPXXAPXTXXP 1376 PPP P P P PP P P P P PP AP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 33.9 bits (74), Expect = 0.30 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +3 Query: 1191 PXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXXPPXXAPXTX 1370 P PPP P P P PP P P P P PP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 1371 XP 1376 P Sbjct: 430 PP 431 Score = 33.5 bits (73), Expect = 0.40 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P + PPPPPP P P P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 32.7 bits (71), Expect = 0.70 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 32.3 bits (70), Expect = 0.93 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 32.3 bits (70), Expect = 0.93 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 32.3 bits (70), Expect = 0.93 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 32.3 bits (70), Expect = 0.93 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 32.3 bits (70), Expect = 0.93 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P P P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 32.3 bits (70), Expect = 0.93 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +3 Query: 1200 PPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXXPPXXAPXTXXP 1376 PPP P P P PP P P P P PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/66 (24%), Positives = 18/66 (27%) Frame = +3 Query: 1164 APXXXXXXXPXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXX 1343 +P P P P P P P PP P P P P + Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 1344 PPXXAP 1361 PP P Sbjct: 424 PPPPPP 429 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/62 (25%), Positives = 16/62 (25%) Frame = +3 Query: 1191 PXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXXPPXXAPXTX 1370 P PPP P P P PP P P P PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 1371 XP 1376 P Sbjct: 431 PP 432 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P + P PPPP P P P P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 30.3 bits (65), Expect = 3.8 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXPXXXXXXXPXL 998 PP PPPPPP P P P P P P L Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 Score = 29.9 bits (64), Expect = 5.0 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXPXXXXXXXPXL 998 PP P PPPPPP P P P + P P L Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSPVL 450 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPP P P P P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 29.5 bits (63), Expect = 6.6 Identities = 15/56 (26%), Positives = 16/56 (28%) Frame = +3 Query: 1191 PXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXPXXSXXXXPPXXA 1358 P PPP P P PP P P P+ P PP A Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPP P P P P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPP P P P P P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPP PP P P P P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P P PPPP P P P P P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPP P P P P P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPP PP P P P P P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 39.1 bits (87), Expect = 0.008 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXX 1179 G GGGGGG G G G GG GG GG G GGG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Query: 1178 XXGG 1167 GG Sbjct: 1817 MGGG 1820 Score = 33.5 bits (73), Expect = 0.40 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = -3 Query: 1376 GXGXXXGXXGG--GGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGG 1203 G G G GG GGGG G G G G GGG GG G GG Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Score = 32.3 bits (70), Expect = 0.93 Identities = 25/79 (31%), Positives = 25/79 (31%) Frame = -3 Query: 1262 GGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXX 1083 GG GGG GG G GGG GG G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGG----------- 1807 Query: 1082 XCLGGXGXGGGWXGGGGXG 1026 GG G GGG GGGG G Sbjct: 1808 ---GGMGGGGGGMGGGGEG 1823 Score = 32.3 bits (70), Expect = 0.93 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 1/76 (1%) Frame = -3 Query: 1073 GGXGXGGGW-XGGGGXGXXXXXXKKKEXGXXXXXXXGGFCVFGXGXGXXXXVXXXGXXXG 897 GG G GGG GGGG G E G GG G G G G Sbjct: 1765 GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGM 1824 Query: 896 GXRXXXXGVFXGXGGG 849 G G G GGG Sbjct: 1825 GAAGGGMGA-GGEGGG 1839 Score = 31.9 bits (69), Expect = 1.2 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G G G GGGG G G G G GGG G G GGG Sbjct: 1788 GGGEFGGGEGMGGGG-MAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 31.5 bits (68), Expect = 1.6 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXG 1221 G G G GGGGG G G G G GG GG G Sbjct: 1795 GEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 29.9 bits (64), Expect = 5.0 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = -3 Query: 1277 GXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPGXXXXXXEXXKXXXXXXXXX 1098 G GG GGG GG G GGG GG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMG-GGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Query: 1097 XXXXXXCLGGXGXGGGWXGGGGXG 1026 G G G G GGG G Sbjct: 1819 GGGEGMGAAGGGMGAGGEGGGAGG 1842 Score = 29.1 bits (62), Expect = 8.7 Identities = 19/70 (27%), Positives = 19/70 (27%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGX 1197 G G G GGG G G GG GGG G G GG Sbjct: 1777 GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGE 1836 Query: 1196 XXXXXXXXGG 1167 GG Sbjct: 1837 GGGAGGGGGG 1846 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 38.3 bits (85), Expect = 0.014 Identities = 34/117 (29%), Positives = 34/117 (29%), Gaps = 2/117 (1%) Frame = -3 Query: 1376 GXGXXXGXXGGG--GGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGG 1203 G G G GGG GGG G G G GGG GG G GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGG 183 Query: 1202 GXXXXXXXXXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXXXCLGGXGXGGGWXGGGG 1032 G GG G GG G GGG GGGG Sbjct: 184 GGHGGGGYGGGGYGGGGGGYGGSGYGGGGGY------------GGGGYGGGRSGGGG 228 Score = 33.5 bits (73), Expect = 0.40 Identities = 23/75 (30%), Positives = 27/75 (36%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXGXXXXXXKKKEXGXXXXXXXGGFCVFGXGXGXXXXVXXXGXXXGG 894 GG GGG+ GGGG + + G GG+ G G G G GG Sbjct: 140 GGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGG-GGYGGGGYGGGGHGGGGYGGGGYGG 198 Query: 893 XRXXXXGVFXGXGGG 849 G G GGG Sbjct: 199 GGGGYGGSGYGGGGG 213 Score = 31.9 bits (69), Expect = 1.2 Identities = 22/75 (29%), Positives = 24/75 (32%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXGXXXXXXKKKEXGXXXXXXXGGFCVFGXGXGXXXXVXXXGXXXGG 894 GG GGG+ GG G G G GG+ G G G G GG Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGG 183 Query: 893 XRXXXXGVFXGXGGG 849 G G GG Sbjct: 184 GGHGGGGYGGGGYGG 198 Score = 31.1 bits (67), Expect = 2.1 Identities = 25/98 (25%), Positives = 27/98 (27%) Frame = -3 Query: 1253 GGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXXXCL 1074 GGG GG G GGG GG + Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRG-RGRGGGGYGGGGYGGGGY 181 Query: 1073 GGXGXGGGWXGGGGXGXXXXXXKKKEXGXXXXXXXGGF 960 GG G GGG GGGG G G GG+ Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGY 219 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 31.5 bits (68), Expect = 1.6 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 1349 GGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXG 1206 GG GGG G G G GG GGG GG G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 30.7 bits (66), Expect = 2.8 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXG 1221 G G G GGGGGG G G G GG GGG GG G Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGG-----------GFGGGGGGGGGFGGGGGGG 126 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGG 1245 G G G GG GGG G G G GG GGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 29.5 bits (63), Expect = 6.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXG 1026 GG G GGG+ GGGG G Sbjct: 85 GGFGGGGGFGGGGGGG 100 Score = 29.5 bits (63), Expect(2) = 0.014 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXG 1026 GG G GGG+ GGGG G Sbjct: 111 GGGGGGGGFGGGGGGG 126 Score = 29.1 bits (62), Expect = 8.7 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 1370 GXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXG 1221 G G GGGGG G G G GG GGG GG G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG--GGGGFG 128 Score = 27.9 bits (59), Expect(2) = 0.014 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 1262 GGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGG 1167 GG GGG GG G GGG GG Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGG 116 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.9 bits (84), Expect = 0.019 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 1/73 (1%) Frame = -3 Query: 1370 GXXXGXXGGG-GGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGXX 1194 G G GGG GGG G G G GG GGG GG G GG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAA 88 Query: 1193 XXXXXXXGGXXPG 1155 GG G Sbjct: 89 GAAGAGAGGNVGG 101 Score = 33.9 bits (74), Expect = 0.30 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGG 1203 G G G G GGGG G G G GGG GG G GG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGG 86 Score = 29.1 bits (62), Expect = 8.7 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXG 1221 G G G G GG G G G GG GG GG G Sbjct: 63 GNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 37.9 bits (84), Expect = 0.019 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G GGGGGG G G G GG GGG GG G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 37.1 bits (82), Expect = 0.033 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXG 1206 G G G GGGGGG G G G G GGG GG G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 35.9 bits (79), Expect = 0.076 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGG 1203 G G G GGGGGG G G G GG GGG GG G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGG-------GDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXGXXXXXXKKKEXGXXXXXXXGGFCVFGXGXG 936 GG G GGG GGGG G + G GG G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 1346 GGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGG 1167 GGGGG G G G GG GGG GG G GGG GG Sbjct: 62 GGGGGGGGGGG------------GGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 29.9 bits (64), Expect = 5.0 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXGXXXXXXKKKEXGXXXXXXXGGFCVFGXGXG 936 GG G GGG GGGG G + G GG G G G Sbjct: 67 GGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 29.1 bits (62), Expect = 8.7 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXGXXXXXXKKKEXGXXXXXXXGGFCVFGXGXG 936 GG G GGG GGGG G G GG G G G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 28.7 bits (61), Expect(2) = 0.020 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 1262 GGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPG 1155 GG GGG GG G GGG GG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 28.3 bits (60), Expect(2) = 0.020 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXG 1026 GG G GGG GGGG G Sbjct: 99 GGDGGGGGGGGGGGVG 114 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 37.5 bits (83), Expect = 0.025 Identities = 22/75 (29%), Positives = 23/75 (30%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PPP P P PP P P P P P + Sbjct: 138 PPPPPPIAPATGGPPPP---PPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGG 194 Query: 1030 XPPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 195 PPPPPPPPPPPPPPP 209 Score = 35.5 bits (78), Expect = 0.100 Identities = 26/112 (23%), Positives = 27/112 (24%), Gaps = 3/112 (2%) Frame = +1 Query: 937 PXPXPKTQXPPXXXXXXXPXSFFFXXXXXXPXPPPPXHPP---PXPXPPXXXXXXXXXXX 1107 P P P + P P P PPPP P P P PP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Query: 1108 XXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPP 1263 PP PPP P PP P PP Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 33.9 bits (74), Expect = 0.30 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 7/82 (8%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKT----QXPPXXXXXXXPXSFFFXXX 1017 PPP P PP P P P T PP P Sbjct: 126 PPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAA 185 Query: 1018 XXXPXP---PPPXHPPPXPXPP 1074 P P PPP PPP P PP Sbjct: 186 ASPPPPSGGPPPPPPPPPPPPP 207 Score = 30.7 bits (66), Expect = 2.8 Identities = 22/86 (25%), Positives = 23/86 (26%), Gaps = 2/86 (2%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXP- 1203 P PPPP P PP + P PP P Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP---PPIAPAATVPAPA 180 Query: 1204 -PPXXXXPXPPXXXXPPPXPPXXXXP 1278 P P PP PPP PP P Sbjct: 181 VPLAAASPPPPSGGPPPPPPPPPPPP 206 Score = 29.1 bits (62), Expect = 8.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 840 GXXPPXPXXKNXXXXPPPPPPXXP 911 G PP P PPPPPP P Sbjct: 149 GGPPPPPPIAPATGGPPPPPPIAP 172 Score = 29.1 bits (62), Expect = 8.7 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXP 944 PP P PPPPPP P P P Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.1 bits (82), Expect = 0.033 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPP 1206 P PPPP P P PP + PG P PP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGN-----APPPPPPPGGSAPPPGGGAPPLPP 975 Query: 1207 PXXXXPXPPXXXXPPPXPP 1263 P PP PPP PP Sbjct: 976 PPGGSAPPPPPPPPPPPPP 994 Score = 35.9 bits (79), Expect = 0.076 Identities = 25/76 (32%), Positives = 25/76 (32%), Gaps = 2/76 (2%) Frame = +3 Query: 690 PPKKNXGGXXHFXSX--GGXXPXXXPPXXXFXXPXPXXXXPGGFFFF*KKXXGXXPPXPX 863 PP GG GG P PP P P PGG G PP P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP--PGGSA---PPPGGGAPPLPP 975 Query: 864 XKNXXXXPPPPPPXXP 911 PPPPPP P Sbjct: 976 PPGGSAPPPPPPPPPP 991 Score = 32.3 bits (70), Expect = 0.93 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 2/76 (2%) Frame = +1 Query: 853 PPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXPX 1032 PP P L PP P P P PP P P Sbjct: 920 PPPPPPPGGNAPLPPPP--PGGSAPSQPPPPGGNAPPPPPPPGGSAPPP----GGGAPPL 973 Query: 1033 PPPP--XHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 974 PPPPGGSAPPPPPPPP 989 Score = 30.7 bits (66), Expect = 2.8 Identities = 21/75 (28%), Positives = 22/75 (29%), Gaps = 3/75 (4%) Frame = +1 Query: 850 PPPX---PQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXX 1020 PPP P P P P P P + PP P Sbjct: 924 PPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP----PGG 979 Query: 1021 XXPXPPPPXHPPPXP 1065 P PPPP PPP P Sbjct: 980 SAPPPPPPPPPPPPP 994 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.1 bits (82), Expect = 0.033 Identities = 33/119 (27%), Positives = 33/119 (27%), Gaps = 4/119 (3%) Frame = -3 Query: 1370 GXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXG----GGXXXXGGXGXXXXGG 1203 G G GGGGG G G G GG G GG GG G GG Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Query: 1202 GXXXXXXXXXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXXXCLGGXGXGGGWXGGGGXG 1026 G GG G GG GGG G GG G Sbjct: 308 GATGVGGGATGGG--GGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 35.9 bits (79), Expect = 0.076 Identities = 31/109 (28%), Positives = 31/109 (28%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXX 1179 G GGGGG G G G GG GG GG G GGG Sbjct: 244 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT--GGGGGATGGGGGATGGGGG 301 Query: 1178 XXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXXXCLGGXGXGGGWXGGGG 1032 GG G G G GGG GGGG Sbjct: 302 ATGGGG-GATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Score = 34.7 bits (76), Expect = 0.17 Identities = 28/104 (26%), Positives = 29/104 (27%) Frame = -3 Query: 1343 GGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGX 1164 GGGG G G G G GGG GG G GGG G Sbjct: 242 GGGGATGGGGGATGGGGGATGGG---GGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 1163 XPGXXXXXXEXXKXXXXXXXXXXXXXXXCLGGXGXGGGWXGGGG 1032 G +G G GGG GGGG Sbjct: 299 GGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Score = 34.3 bits (75), Expect = 0.23 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 2/72 (2%) Frame = -3 Query: 1376 GXGXXXGXXG--GGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGG 1203 G G G G GGGGG G G G GG GG GG G GG Sbjct: 278 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGAT--GGGVGATGGGG 335 Query: 1202 GXXXXXXXXXGG 1167 G GG Sbjct: 336 GATGGGGGVTGG 347 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.1 bits (82), Expect = 0.033 Identities = 23/75 (30%), Positives = 25/75 (33%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PPP P P P P P P T PP P + P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP---PTN-------GPP 395 Query: 1030 XPPPPXHPPPXPXPP 1074 PPPP + PP P PP Sbjct: 396 PPPPPTNGPPPPPPP 410 Score = 35.9 bits (79), Expect = 0.076 Identities = 23/82 (28%), Positives = 24/82 (29%) Frame = +1 Query: 1033 PPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPPPX 1212 PPPP + PP P PP P PP PP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNK--------------PPPPPPPTNGPPPPPPPTN 392 Query: 1213 XXXPXPPXXXXPPPXPPXXXXP 1278 P PP PPP PP P Sbjct: 393 GPPPPPPPTNGPPPPPPPTNGP 414 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P N PPPP P P P P T P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 404 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P N PPPP P P P P T P Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 Score = 29.9 bits (64), Expect = 5.0 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +1 Query: 1159 GXXPPXXXXXXXXXPPPXXXX---PXPPXXXXPPPXPPXXXXP 1278 G PP PPP P PP PPP PP P Sbjct: 343 GVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPP 385 Score = 29.9 bits (64), Expect = 5.0 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPP---PXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPP P P P P P N P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Score = 29.5 bits (63), Expect = 6.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 840 GXXPPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 G PP P N PPPP P P P P T P Sbjct: 343 GVNPPPPPTNN-PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGP 384 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 37.1 bits (82), Expect = 0.033 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGG 1203 G G G GGGGGG G G G GG GGG G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 35.1 bits (77), Expect = 0.13 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 1370 GXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G GGGGGG G G G GG GGG G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 33.9 bits (74), Expect = 0.30 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXG 1221 G G G GGGGGG G G G GG G G G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 33.1 bits (72), Expect = 0.53 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G GGGGGG G G G GG GGG GG G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGG-------GGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 29.9 bits (64), Expect(2) = 0.90 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 1277 GXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPG 1155 G GG GGG GG G GGG GG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 29.9 bits (64), Expect = 5.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 1277 GXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPG 1155 G GG GGG GG G GGG GG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 29.5 bits (63), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 1277 GXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPG 1155 G GG GGG GG G GGG GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 29.5 bits (63), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 1277 GXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPG 1155 G GG GGG GG G GGG GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 29.5 bits (63), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 1277 GXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPG 1155 G GG GGG GG G GGG GG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 29.5 bits (63), Expect = 6.6 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXGXXXXXXKKKEXGXXXXXXXGGFCVFGXGXG 936 GG G GGG GGGG G G GG G G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 29.5 bits (63), Expect = 6.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 1277 GXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPG 1155 G GG GGG GG G GGG GG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 21.0 bits (42), Expect(2) = 0.90 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXG 1026 GG G GG G G G Sbjct: 695 GGGGGGGAGGAGAGAG 710 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.1 bits (72), Expect = 0.53 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXP 950 PP P + PPPPPP P P P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 32.3 bits (70), Expect = 0.93 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXP 950 PP P PPPPPP P P P P Sbjct: 217 PPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 31.1 bits (67), Expect = 2.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 1168 PPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PP PPP P P PPP PP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 31.1 bits (67), Expect(2) = 0.038 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 205 PPPPPRPPPSPPPP 218 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 1160 GGXXPXXPPXXXXXPPXXXXXPPXPXXXXPPPXPXXXXP 1276 G P P PP PP P PPP P P Sbjct: 191 GTSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRP 229 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P P PP PPP P PP Sbjct: 207 PPPRPPPSPPPPPPPP 222 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP PPP P PP Sbjct: 212 PPSPPPPPPPPSPSPP 227 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PP P PP Sbjct: 217 PPPPPPSPSPPRPPPP 232 Score = 29.1 bits (62), Expect = 8.7 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +1 Query: 895 PPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXPXPPPPXHPPPXPXPP 1074 PP P P P P PP P P PPP + PP PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPL----AAKLPEPPPIPNMPPTLPPP 261 Score = 29.1 bits (62), Expect = 8.7 Identities = 13/44 (29%), Positives = 14/44 (31%) Frame = +3 Query: 1191 PXXPPPXXPXPXPXXXXXXPPXXPXXXXPXXXXXXXXXXXPSXP 1322 P PPP P P P PP P P P+ P Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Score = 24.6 bits (51), Expect(2) = 0.038 Identities = 12/41 (29%), Positives = 12/41 (29%) Frame = +1 Query: 1156 PGXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPPXXXXP 1278 P PP PPP P P P PP P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 36.3 bits (80), Expect = 0.057 Identities = 32/115 (27%), Positives = 32/115 (27%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGX 1197 G G G GGGGG G G G G GG GG G GGG Sbjct: 53 GGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATG--GGGGATGGGGGA 110 Query: 1196 XXXXXXXXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXXXCLGGXGXGGGWXGGGG 1032 GG G G G GGG GGGG Sbjct: 111 TGGHGGATGGGV-GATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 35.9 bits (79), Expect = 0.076 Identities = 32/115 (27%), Positives = 32/115 (27%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGX 1197 G G G GG GG G G G G GGG GG G GGG Sbjct: 45 GHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGG-GATGGGGGA 103 Query: 1196 XXXXXXXXGGXXPGXXXXXXEXXKXXXXXXXXXXXXXXXCLGGXGXGGGWXGGGG 1032 GG G G G GGG GGGG Sbjct: 104 TGGGGGATGGHG-GATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGG 157 Score = 29.9 bits (64), Expect = 5.0 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G G G GGG G G GGG GG G GGG Sbjct: 107 GGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGGG 165 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 36.3 bits (80), Expect = 0.057 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPP 1206 P PPPP P P PP + P PP P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPP---PI 962 Query: 1207 PXXXXPXPPXXXXPPPXPP 1263 P P PP PPP PP Sbjct: 963 PATQVPPPPLPPLPPPPPP 981 Score = 36.3 bits (80), Expect = 0.057 Identities = 24/75 (32%), Positives = 24/75 (32%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PPP P P PP P T P P TQ P S Sbjct: 909 PPPLPL-APEPPPPLPPPPPPIQTTRPTVPTT-PTTQASTTRPTPPPPTSALPPPIPATQ 966 Query: 1030 XPPPPXHPPPXPXPP 1074 PPPP P P P PP Sbjct: 967 VPPPPLPPLPPPPPP 981 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 35.5 bits (78), Expect = 0.100 Identities = 35/143 (24%), Positives = 38/143 (26%), Gaps = 1/143 (0%) Frame = +1 Query: 853 PPXPQKTPXXXXLXPPXXX-PXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PP P + P PP P P P T+ PP P Sbjct: 250 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLP-PSRDQAP 308 Query: 1030 XPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPPP 1209 PPPP + P P PP P PP PPP Sbjct: 309 APPPPLNATPPPPPP------SRDQVPLPPPPLRGQIAPPPPPISKPP--TSTRSAPPPP 360 Query: 1210 XXXXPXPPXXXXPPPXPPXXXXP 1278 P P PPP PP P Sbjct: 361 PGRAPQP--LGGPPPPPPGRRPP 381 Score = 31.5 bits (68), Expect = 1.6 Identities = 38/152 (25%), Positives = 40/152 (26%), Gaps = 9/152 (5%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PPP P + P L PP T P P P PP P Sbjct: 216 PPPPPGRGPSQRSLAPP------PTGSSRPLPAP----PPGENRPPPP----MRGPTSGG 261 Query: 1030 XPPPPXHPPPXP------XPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXX 1191 PPPP + PP P PP S P PP Sbjct: 262 EPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP---PPPLNATP 318 Query: 1192 XXXPPPXXXXPXPP---XXXXPPPXPPXXXXP 1278 PP P PP PP PP P Sbjct: 319 PPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 29.9 bits (64), Expect(2) = 0.55 Identities = 19/82 (23%), Positives = 19/82 (23%) Frame = +1 Query: 1033 PPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPPPX 1212 PPP P P PP PP PPP Sbjct: 207 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPP 266 Query: 1213 XXXPXPPXXXXPPPXPPXXXXP 1278 P PP P PP P Sbjct: 267 KNAPPPPKRGSSNPPPPPTRGP 288 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P P Sbjct: 2 PPPPPPPGPPPPPSAP 17 Score = 21.8 bits (44), Expect(2) = 0.55 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 1027 PXPPPPXHPPP 1059 P PPP PPP Sbjct: 166 PPPPPMGKPPP 176 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 35.5 bits (78), Expect = 0.100 Identities = 35/143 (24%), Positives = 38/143 (26%), Gaps = 1/143 (0%) Frame = +1 Query: 853 PPXPQKTPXXXXLXPPXXX-PXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PP P + P PP P P P T+ PP P Sbjct: 162 PPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLP-PSRDQAP 220 Query: 1030 XPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPPP 1209 PPPP + P P PP P PP PPP Sbjct: 221 APPPPLNATPPPPPP------SRDQVPLPPPPLRGQIAPPPPPISKPP--TSTRSAPPPP 272 Query: 1210 XXXXPXPPXXXXPPPXPPXXXXP 1278 P P PPP PP P Sbjct: 273 PGRAPQP--LGGPPPPPPGRRPP 293 Score = 31.5 bits (68), Expect = 1.6 Identities = 38/152 (25%), Positives = 40/152 (26%), Gaps = 9/152 (5%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PPP P + P L PP T P P P PP P Sbjct: 128 PPPPPGRGPSQRSLAPP------PTGSSRPLPAP----PPGENRPPPP----MRGPTSGG 173 Query: 1030 XPPPPXHPPPXP------XPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXX 1191 PPPP + PP P PP S P PP Sbjct: 174 EPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP---PPPLNATP 230 Query: 1192 XXXPPPXXXXPXPP---XXXXPPPXPPXXXXP 1278 PP P PP PP PP P Sbjct: 231 PPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 29.9 bits (64), Expect(2) = 0.56 Identities = 19/82 (23%), Positives = 19/82 (23%) Frame = +1 Query: 1033 PPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPPPX 1212 PPP P P PP PP PPP Sbjct: 119 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPP 178 Query: 1213 XXXPXPPXXXXPPPXPPXXXXP 1278 P PP P PP P Sbjct: 179 KNAPPPPKRGSSNPPPPPTRGP 200 Score = 21.8 bits (44), Expect(2) = 0.56 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 1027 PXPPPPXHPPP 1059 P PPP PPP Sbjct: 78 PPPPPMGKPPP 88 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 34.3 bits (75), Expect = 0.23 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G G GG G G G G G GG GGG G G GGG Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGG 194 Score = 33.1 bits (72), Expect = 0.53 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G G GG G G G G G GG GGG G G G G Sbjct: 128 GRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTG 186 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 5/64 (7%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGX-----GGGXXXXGGXGXXX 1212 G G G GGG GR G G G GG GGG GG G Sbjct: 140 GNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGR 199 Query: 1211 XGGG 1200 GG Sbjct: 200 GRGG 203 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 34.3 bits (75), Expect = 0.23 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGX-GGGXXXXGGXGXXXXGGGXXXXXX 1182 G GGGGGG G G G GG GGG GG G GGG Sbjct: 48 GGDGGGGGG--DGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 Query: 1181 XXXGG 1167 GG Sbjct: 106 GGDGG 110 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 34.3 bits (75), Expect = 0.23 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGX-GGGXXXXGGXGXXXXGGGXXXXXX 1182 G GGGGGG G G G GG GGG GG G GGG Sbjct: 63 GGDGGGGGG--DGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 Query: 1181 XXXGG 1167 GG Sbjct: 121 GGDGG 125 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 32.7 bits (71), Expect = 0.70 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXP 950 PP P PPPPPP P P P P Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 840 GXXPPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNT 959 G P P PPPPPP P P P P T Sbjct: 299 GSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPPT 338 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 1156 PGXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPP 1263 P PP PPP PP PPP PP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 29.9 bits (64), Expect(2) = 0.26 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 1168 PPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPP 1263 PP PPP P PP PP PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 1160 GGXXPXXPPXXXXXPPXXXXXPPXPXXXXPPPXPXXXXP 1276 GG P PP PP P PPP P P Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PP P PPPPPP P P P + P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAP 331 Score = 29.5 bits (63), Expect(2) = 0.44 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 1168 PPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPP 1263 PP PPP P P PPP PP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PP P PP Sbjct: 305 PPPPPPGGAPPPPPPP 320 Score = 29.1 bits (62), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP PPP P PP Sbjct: 306 PPPPPGGAPPPPPPPP 321 Score = 23.0 bits (47), Expect(2) = 0.26 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP P P PP Sbjct: 292 PPPPPADGSAPAPPPP 307 Score = 22.6 bits (46), Expect(2) = 0.44 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP P PP Sbjct: 290 PVPPPPPADGSAPAPP 305 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 6.6 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PPP P P PP P P P PP P Sbjct: 50 PPPPPPSPPAAAPAAPP---PPAAAPAAPPPPAAPPAAPPPPPPLPAP------------ 94 Query: 1030 XPPPPXHPPPXPXP 1071 PPPP P P P P Sbjct: 95 -PPPPAQPAPQPPP 107 Score = 29.1 bits (62), Expect(2) = 0.28 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 3/39 (7%) Frame = +1 Query: 1156 PGXXPPXXXXXXXXXPPPXXXXPXPP---XXXXPPPXPP 1263 P PP PPP P PP PPP PP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 23.8 bits (49), Expect(2) = 0.28 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP P P PP Sbjct: 65 PPPPAAAPAAPPPP 78 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.9 bits (74), Expect = 0.30 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +1 Query: 898 PXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXPXPPPPXHPPPXPXPP 1074 P P P P P PP P PPPP PPP P P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMP 151 Score = 29.5 bits (63), Expect = 6.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 1204 PPXXXXPXPPXXXXPPPXPPXXXXP 1278 PP P PP PPP PP P Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 25.4 bits (53), Expect(2) = 4.5 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPP 902 PP P PPPPPP Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 25.4 bits (53), Expect(2) = 4.5 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPP 902 PP P PPPPPP Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 Score = 23.0 bits (47), Expect(2) = 4.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 885 PPPPPPXXP 911 PPPPPP P Sbjct: 138 PPPPPPPPP 146 Score = 23.0 bits (47), Expect(2) = 4.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 885 PPPPPPXXP 911 PPPPPP P Sbjct: 140 PPPPPPPAP 148 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 33.5 bits (73), Expect = 0.40 Identities = 23/81 (28%), Positives = 25/81 (30%), Gaps = 6/81 (7%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFF------FX 1011 PPP P + PP T P P +Q PP P Sbjct: 305 PPPPPSRGSA-----PPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVG 359 Query: 1012 XXXXXPXPPPPXHPPPXPXPP 1074 P PPPP PP P PP Sbjct: 360 GAAPPPPPPPPVGGPPPPPPP 380 Score = 32.3 bits (70), Expect = 0.93 Identities = 21/84 (25%), Positives = 21/84 (25%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPP 1206 P PPPP P PP P PP PP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMG------MAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Query: 1207 PXXXXPXPPXXXXPPPXPPXXXXP 1278 P P PPP PP P Sbjct: 380 PIEGRPPSSLGNPPPPPPPGRGAP 403 Score = 31.9 bits (69), Expect = 1.2 Identities = 25/95 (26%), Positives = 27/95 (28%), Gaps = 4/95 (4%) Frame = +3 Query: 678 RGXSPPKKNXGGXXHFX-SXGGXXPXXXPPXXXFXXPXPXXXX---PGGFFFF*KKXXGX 845 RG PP + G + G P PP P P P G Sbjct: 302 RGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGA 361 Query: 846 XPPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXP 950 PP P PPPPPP P P P Sbjct: 362 APPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPP 396 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 33.1 bits (72), Expect = 0.53 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 1168 PPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPP 1263 PP PPP P PP PPP PP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP PPP P PP Sbjct: 233 PPPPPAAAPPPPPPPP 248 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 30.7 bits (66), Expect = 2.8 Identities = 28/108 (25%), Positives = 28/108 (25%), Gaps = 1/108 (0%) Frame = +1 Query: 943 PXPKTQXPPXXXXXXXPXSFFFXXXXXXPXPPPPXHPPPXPXPPXXXXXXXXXXXXXXXX 1122 P P P P S P PPPP PP P P Sbjct: 217 PSPSPSAAPPSSLRVKPVSGRLGLSNIKP-PPPPVPPPTIPSVP-PGSETYVPPGSATYE 274 Query: 1123 XFXXSXXXXXXPGXXPPXXXXXXXXXPP-PXXXXPXPPXXXXPPPXPP 1263 P PP PP P P PP PPP PP Sbjct: 275 SMDSVNKAPVPPMTPPPAVVTAPPPAPPLPNFTSPSPP---PPPPLPP 319 Score = 30.3 bits (65), Expect = 3.8 Identities = 19/72 (26%), Positives = 19/72 (26%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFFFXXXXXXP 1029 PP P P PP P P PP P P Sbjct: 252 PPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPNFTSPSP 311 Query: 1030 XPPPPXHPPPXP 1065 PPPP PP P Sbjct: 312 PPPPPL-PPAMP 322 Score = 27.5 bits (58), Expect(2) = 0.56 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXP 911 PP P N PPPPP P Sbjct: 298 PPAPPLPNFTSPSPPPPPPLP 318 Score = 24.2 bits (50), Expect(2) = 0.56 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +3 Query: 885 PPPPPPXXPXXXXXXXXPXPXP 950 PPPPPP P P P Sbjct: 336 PPPPPPSEDFYSMPSSLPMPSP 357 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 683 PPPPPPPPPPPPPPPP 698 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 684 PPPPPPPPPPPPPPPP 699 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 685 PPPPPPPPPPPPPPPP 700 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 686 PPPPPPPPPPPPPPPP 701 Score = 31.1 bits (67), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPP 1263 PPP P PP PPP PP Sbjct: 691 PPPPPPPPPPPQPSTPPPPPP 711 Score = 29.9 bits (64), Expect = 5.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 1181 PPXXXXXPPXXXXXPPXPXXXXPPPXPXXXXP 1276 PP PP PP P PPP P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 29.9 bits (64), Expect = 5.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXP 1071 P PPPP PPP P P Sbjct: 689 PPPPPPPPPPPPPQP 703 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P P Sbjct: 688 PPPPPPPPPPPPPPQP 703 Score = 29.5 bits (63), Expect = 6.6 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 885 PPPPPPXXPXXXXXXXXPXPXPKNT 959 PPPPPP P P P P +T Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPST 713 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P P Sbjct: 691 PPPPPPPPPPPQPSTP 706 Score = 29.1 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 29.1 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 29.1 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PP PP P Sbjct: 690 PPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 26.6 bits (56), Expect(2) = 4.0 Identities = 11/32 (34%), Positives = 11/32 (34%) Frame = +1 Query: 1168 PPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPP 1263 PP PPP P P PPP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 21.8 bits (44), Expect(2) = 4.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P P PPP P PP Sbjct: 675 PIPIQTMVPPPPPPPP 690 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 867 PPPPPPPPPPPPPPPP 882 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 868 PPPPPPPPPPPPPPPP 883 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 869 PPPPPPPPPPPPPPPP 884 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 870 PPPPPPPPPPPPPPPP 885 Score = 29.1 bits (62), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP PPP P PP Sbjct: 864 PRRPPPPPPPPPPPPP 879 Score = 26.6 bits (56), Expect(2) = 0.88 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 852 PXPXXKNXXXXPPPPPPXXP 911 P P + PPPPPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPP 879 Score = 24.2 bits (50), Expect(2) = 0.88 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = +3 Query: 885 PPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 PPPPPP P P K P Sbjct: 872 PPPPPPPPPPPPPPASSTGSTPGGDKVP 899 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 464 PPPPPPPPPPPPPPPP 479 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 465 PPPPPPPPPPPPPPPP 480 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 466 PPPPPPPPPPPPPPPP 481 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 467 PPPPPPPPPPPPPPPP 482 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 468 PPPPPPPPPPPPPPPP 483 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 469 PPPPPPPPPPPPPPPP 484 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 470 PPPPPPPPPPPPPPPP 485 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 471 PPPPPPPPPPPPPPPP 486 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 472 PPPPPPPPPPPPPPPP 487 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 475 PPPPPPPPPPPPPFPP 490 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 477 PPPPPPPPPPPFPPPP 492 Score = 32.3 bits (70), Expect = 0.93 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 1163 GXXPXXPPXXXXXPPXXXXXPPXPXXXXPPPXP 1261 G P PP PP PP P PPP P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 32.3 bits (70), Expect = 0.93 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 32.3 bits (70), Expect = 0.93 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPP 490 Score = 32.3 bits (70), Expect = 0.93 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 32.3 bits (70), Expect = 0.93 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP PP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 1159 GXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPPXP 1260 G PP PPP P PP PPP P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 31.1 bits (67), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPP 1263 PPP P PP PPP PP Sbjct: 474 PPPPPPPPPPPPPPFPPPPPP 494 Score = 30.7 bits (66), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 1172 PXXPPXXXXXPPXXXXXPPXPXXXXPPPXP 1261 P PP PP PP P PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 5.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 1168 PPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPP 1263 PP PPP P PP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 5.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P P Sbjct: 481 PPPPPPPFPPPPPPTP 496 Score = 29.5 bits (63), Expect = 6.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 840 GXXPPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXP 950 G PP P PPPPPP P P P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPP-PPPPPPFPPPPPPTP 496 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 54 PPPPPPPPPPPPPPPP 69 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 55 PPPPPPPPPPPPPPPP 70 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 56 PPPPPPPPPPPPPPPP 71 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 32.7 bits (71), Expect = 0.70 Identities = 34/144 (23%), Positives = 36/144 (25%), Gaps = 1/144 (0%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPX-PKTQXPPXXXXXXXPXSFFFXXXXXX 1026 PP P P P P P P P+T PP P + Sbjct: 214 PPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPAS--PNPSIP 271 Query: 1027 PXPPPPXHPPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXPGXXPPXXXXXXXXXPP 1206 P PP P P P P P F S PP P Sbjct: 272 PAPPNPSIPAP-PNPSIPLAPPNPYIPPAPPNLFIPSAPPNPH---IPPAPPNPYIPTAP 327 Query: 1207 PXXXXPXPPXXXXPPPXPPXXXXP 1278 P P P PP PP P Sbjct: 328 PNPSIPPAPPNPSIPPAPPNPSIP 351 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 32.7 bits (71), Expect = 0.70 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P PP Sbjct: 1313 PPPPPPPPPPPPPLPP 1328 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 1311 PPPPPPPPPPPPPP 1324 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 1312 PPPPPPPPPPPPPP 1325 Score = 29.9 bits (64), Expect = 5.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXP 1071 P PPPP PPP P P Sbjct: 1311 PPPPPPPPPPPPPPP 1325 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP PPP P PP Sbjct: 1308 PESPPPPPPPPPPPPP 1323 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P P Sbjct: 1315 PPPPPPPPPPPLPPTP 1330 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 32.3 bits (70), Expect = 0.93 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP PP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 79 PPPPPPPPPPPPPP 92 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 80 PPPPPPPPPPPPPP 93 Score = 29.9 bits (64), Expect = 5.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXP 1071 P PPPP PPP P P Sbjct: 79 PPPPPPPPPPPPPPP 93 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 32.3 bits (70), Expect = 0.93 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP PP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 280 PPPPPPPPPPPPPP 293 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 281 PPPPPPPPPPPPPP 294 Score = 29.9 bits (64), Expect = 5.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXP 1071 P PPPP PPP P P Sbjct: 280 PPPPPPPPPPPPPPP 294 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 32.3 bits (70), Expect = 0.93 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PPP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 31.1 bits (67), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPP 1263 PPP P PP PPP PP Sbjct: 1164 PPPPPSSPSPPPPPPPPPPPP 1184 Score = 30.7 bits (66), Expect = 2.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 1172 PXXPPXXXXXPPXXXXXPPXPXXXXPPPXP 1261 P PP PP PP P PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.9 bits (64), Expect = 5.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP P P P PP Sbjct: 1163 PPPPPPSSPSPPPPPP 1178 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PP P PP Sbjct: 1159 PPPPPPPPPPSSPSPP 1174 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP P P Sbjct: 1171 PSPPPPPPPPPPPPTP 1186 Score = 29.1 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P PP PP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 29.1 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P P PPP PP P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 29.1 bits (62), Expect = 8.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 1201 PPPXXXXPXPPXXXXPPPXPPXXXXP 1278 PPP P P PPP PP P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.1 bits (62), Expect = 8.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXP 911 PP P + PPPPPP P Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPP 1183 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.1 bits (62), Expect(2) = 1.1 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 1/17 (5%) Frame = +1 Query: 1027 PXPPPPXH-PPPXPXPP 1074 P PPPP PPP P PP Sbjct: 29 PPPPPPYEAPPPPPGPP 45 Score = 21.4 bits (43), Expect(2) = 1.1 Identities = 11/41 (26%), Positives = 11/41 (26%) Frame = +1 Query: 1156 PGXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPPXXXXP 1278 P PP P P P PP PP P Sbjct: 40 PPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGP 80 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 31.9 bits (69), Expect = 1.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 828 KKXXGXXPPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPKNTKXP 968 KK PP P + PPPPP P P P P P Sbjct: 674 KKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 29.5 bits (63), Expect = 6.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXPK 953 PP P PPPPPP P P P P+ Sbjct: 700 PPPPLLSGTLPMPPPPPP-PPPGCAGLPPPPPSPQ 733 Score = 29.5 bits (63), Expect = 6.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPPXXPXXXXXXXXPXPXP 950 PP P PPPPP P P P P Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 31.9 bits (69), Expect = 1.2 Identities = 21/76 (27%), Positives = 22/76 (28%), Gaps = 2/76 (2%) Frame = +1 Query: 850 PPPXPQKTPXXXXLXPPXXXPXXXTXXXXPXPXPKTQXPPXXXXXXXPXSFF--FXXXXX 1023 PPP P PP P P P P+ PP P Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSE--PAPPPRQPPPPSTSQPVPPPRQPDPIPTNPA 1099 Query: 1024 XPXPPPPXHPPPXPXP 1071 P PPP P P P P Sbjct: 1100 HPTEPPPRQPKPTPAP 1115 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 31.5 bits (68), Expect = 1.6 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXG 1221 G G G GGGGGG G G G GG GGG G G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGG---GGGGGGGDGDGDGDG 91 Score = 29.9 bits (64), Expect = 5.0 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -3 Query: 1349 GGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGG 1203 GGGGGG G G G GGG GG G G Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDGDG 91 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 31.5 bits (68), Expect = 1.6 Identities = 20/61 (32%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGG--GXXXXGGXGXXXXGG 1203 G G G GGGG G G GG GG G GG G GG Sbjct: 180 GGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Query: 1202 G 1200 G Sbjct: 240 G 240 Score = 29.9 bits (64), Expect = 5.0 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = -3 Query: 1370 GXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXG-GXGGGXXXXGGXGXXXXGGGXX 1194 G G GGG R G G G G G GGG G G GGG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRH 235 Query: 1193 XXXXXXXGG 1167 GG Sbjct: 236 DYGGGSKGG 244 Score = 29.9 bits (64), Expect = 5.0 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXX 1179 G G GGG G G G GG GGG GG G GGG Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYG--GGSGGGGYGGG-RGGGGYGGGHGGGGYGGGGRH 235 Query: 1178 XXGGXXPG 1155 GG G Sbjct: 236 DYGGGSKG 243 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.5 bits (68), Expect = 1.6 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 6/80 (7%) Frame = +1 Query: 1033 PPPPXH-PPPXPXPPXXXXXXXXXXXXXXXXXFXXSXXXXXXP---GXXPP--XXXXXXX 1194 PPPP H PP P PP P G PP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPF 487 Query: 1195 XXPPPXXXXPXPPXXXXPPP 1254 PPP P PP PPP Sbjct: 488 GPPPPFYRGPPPPRGMPPPP 507 Score = 29.9 bits (64), Expect = 5.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 1139 PXXXXXRGGXXPXXPPXXXXXPPXXXXXPPXPXXXXPPP 1255 P +GG P PP P PP P PPP Sbjct: 441 PPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPP 479 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 29.1 bits (62), Expect = 8.7 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G GGG GG G G G G GGG GG G GG Sbjct: 161 GRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGG--GDYGGGPGYGGGQGYGSYSGG 217 Score = 28.7 bits (61), Expect(2) = 2.1 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGGXXXXXXX 1179 G GGGGG R G G GG GGG G G GG Sbjct: 138 GRDGGGGGYR----GGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSY 193 Query: 1178 XXGGXXPG 1155 GG G Sbjct: 194 GGGGDYGG 201 Score = 21.0 bits (42), Expect(2) = 2.1 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXG 1026 GG GGG GGG G Sbjct: 195 GGGDYGGGPGYGGGQG 210 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 30.7 bits (66), Expect = 2.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXP 1071 P PPPP H PP P P Sbjct: 363 PTPPPPPHSPPPPLP 377 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 30.3 bits (65), Expect = 3.8 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G GGGG G G GG GGG G G GGG Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 69 PPPPPPPPPLPPPP 82 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 293 PPPPPPPPPLPPPP 306 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 1033 PPPPXHPPPXPXPP 1074 PPPP PPP P PP Sbjct: 211 PPPPPPPPPPPPPP 224 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 29.1 bits (62), Expect = 8.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 783 PXPXXXXPGGFFFF*KKXXGXXPPXPXXKNXXXXPPPPPP 902 P P PGG + G PP P PPPPPP Sbjct: 661 PPPPPPPPGG------QAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 25.8 bits (54), Expect(2) = 4.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 1156 PGXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPPXPP 1263 P PP PPP P P PPP PP Sbjct: 661 PPPPPPPPGGQAGGAPPPPP--PPLPGGAAPPPPPP 694 Score = 22.6 bits (46), Expect(2) = 4.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 1033 PPPPXHPPP 1059 PPPP PPP Sbjct: 660 PPPPPPPPP 668 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 29.9 bits (64), Expect = 5.0 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 1079 CLGGXGXGGGWXGGGGXG 1026 C GG G GGG GGGG G Sbjct: 84 CGGGGGGGGGVGGGGGGG 101 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 29.9 bits (64), Expect = 5.0 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 1073 GGXGXGGGWXGGGGXG 1026 GG G GGG+ GGGG G Sbjct: 100 GGRGGGGGYGGGGGYG 115 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PP P PP Sbjct: 461 PIPPPPPMSPPPPTPP 476 Score = 29.1 bits (62), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP PPP P PP Sbjct: 463 PPPPPMSPPPPTPPPP 478 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP PPP P PP Sbjct: 171 PSPPPSGAPPPPPPPP 186 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 29.5 bits (63), Expect = 6.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PP P PPP P PP Sbjct: 524 PQPPSPPAPPPKPAPP 539 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.5 bits (63), Expect = 6.6 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = -3 Query: 1370 GXXXGXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 G G GGG R G G GG GGG GG G GGG Sbjct: 731 GRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGY-GGGGGGYRGGGGYGGGHRGGG 786 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 25.4 bits (53), Expect(2) = 7.2 Identities = 11/33 (33%), Positives = 11/33 (33%) Frame = +1 Query: 1156 PGXXPPXXXXXXXXXPPPXXXXPXPPXXXXPPP 1254 P PP PPP P PP PP Sbjct: 199 PPPPPPGFPGGAPPPPPPPFGAPPPPALNGGPP 231 Score = 22.2 bits (45), Expect(2) = 7.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P P PPP P PP Sbjct: 188 PSPMAGMPPPPPPPPP 203 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 29.1 bits (62), Expect = 8.7 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = -3 Query: 1358 GXXGGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGG 1203 G GGGGGG G G G GG GGG GG G G Sbjct: 132 GGGGGGGGGGGGGGG---------GGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 29.1 bits (62), Expect = 8.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 1262 GGXGGGXXXXGGXGXXXXGGGXXXXXXXXXGGXXPG 1155 GG GGG GG G GGG GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.1 bits (62), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPPP PPP PP Sbjct: 143 PPPPPPPSPPPPCHPP 158 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 29.1 bits (62), Expect = 8.7 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -3 Query: 1349 GGGGGGRXXGXGXXXXXXXXXXXXGXXXXGGXGGGXXXXGGXGXXXXGGG 1200 GGGGGG G G G G G G G G G G Sbjct: 322 GGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDG 371 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 29.1 bits (62), Expect = 8.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 1027 PXPPPPXHPPPXPXPP 1074 P PPP PPP P PP Sbjct: 426 PPPPPAPLPPPPPPPP 441 Score = 25.4 bits (53), Expect(2) = 9.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 Query: 849 PPXPXXKNXXXXPPPPPP 902 PP P PPPPPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 21.8 bits (44), Expect(2) = 9.7 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +3 Query: 888 PPPPPXXPXXXXXXXXPXPXPK 953 PPPPP P P P+ Sbjct: 434 PPPPPPPPQPTTALPDPLQGPE 455 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.1 bits (62), Expect = 8.7 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 2/39 (5%) Frame = +1 Query: 1168 PPXXXXXXXXXPPPXXXXPXPPXXXXPPP--XPPXXXXP 1278 PP PPP P PP PPP PP P Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPP 60 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 29.1 bits (62), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXG 1314 G G G GGGGGGR G G Sbjct: 345 GGGGGGGGGGGGGGGRGGGGG 365 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 8.7 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 1376 GXGXXXGXXGGGGGGRXXGXG 1314 G G G GGGGGGR G G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRG 1023 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,818,772 Number of Sequences: 59808 Number of extensions: 283242 Number of successful extensions: 6503 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3354 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4378190821 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -