BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_D11 (983 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 38 0.012 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 35 0.12 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 34 0.15 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 34 0.15 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.20 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.27 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 33 0.27 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 32 0.62 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 32 0.62 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.4 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 31 1.4 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 31 1.4 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.5 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 30 2.5 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 30 2.5 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 30 2.5 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 4.4 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 29 5.8 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 29 5.8 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.1 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 40.7 bits (91), Expect = 0.002 Identities = 38/128 (29%), Positives = 42/128 (32%), Gaps = 7/128 (5%) Frame = +2 Query: 209 GGXGXGXPPXGG--GGRXPXXKKXXGGXXPPPXKGGGKXXFHGXXGGXXXXXXPPXRXGK 382 GG G G PP G GG P GG PPP G G+ G PP G+ Sbjct: 486 GGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPP--GAGQGWGQPPPGAGQGGGPPPPGAGQ 543 Query: 383 XXXXXXXXFFFFXRPRGXGXXXXXPP-----XKXPPPPXXXXXXPXWGPXXPLPPXKKPP 547 P G G PP PPPP GP P + PP Sbjct: 544 GGGPP---------PPGAGQGWGQPPPGAGQGGGPPPPGAGQG----GPPPPGAGQEGPP 590 Query: 548 XPXGXRGG 571 P +GG Sbjct: 591 PPGAGQGG 598 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +2 Query: 212 GXGXGXPPXGGGGR--XPXXKKXXGGXXPPPXKGGG 313 G G G PP G G+ P GG PPP G G Sbjct: 573 GAGQGGPPPPGAGQEGPPPPGAGQGGGPPPPGAGQG 608 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 37.9 bits (84), Expect = 0.012 Identities = 29/95 (30%), Positives = 32/95 (33%), Gaps = 9/95 (9%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPX-WGPXXPLPPX--KKPPXPXGXRG------GAXXXXXXXXXXX 607 PP PP P P GP P P PP P G +G GA Sbjct: 39 PPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNG 98 Query: 608 XXFPPXXLGGVPPXKKIFXPSXRXPPXPPXTPXTP 712 PP LG + P P + PP PP P P Sbjct: 99 VNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPP 133 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 617 PPXXLGGVPPXKKIFXPSXRXPPXPPXTPXTP 712 PP LG V P P + PP PP P P Sbjct: 357 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 388 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 617 PPXXLGGVPPXKKIFXPSXRXPPXPPXTPXTP 712 PP LG V P P + PP PP P P Sbjct: 442 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 473 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 617 PPXXLGGVPPXKKIFXPSXRXPPXPPXTPXTP 712 PP LG V P P + PP PP P P Sbjct: 527 PPGPLGDVGPPGLPGPPGPQMPPGPPGLPGAP 558 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 37.9 bits (84), Expect = 0.012 Identities = 27/95 (28%), Positives = 29/95 (30%) Frame = +2 Query: 407 FFFFXRPRGXGXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXX 586 +F P P PP P P G LPP PP P G R G Sbjct: 415 YFNLSTPAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPP-NLPPPPGGMR-GMPPPP 472 Query: 587 XXXXXXXXXFPPXXLGGVPPXKKIFXPSXRXPPXP 691 FPP G PP + P PP P Sbjct: 473 MGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/64 (28%), Positives = 20/64 (31%) Frame = +2 Query: 521 PLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLGGVPPXKKIFXPSXRXPPXPPXT 700 P P PP P G PP + G+PP P R P PP Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFG 488 Query: 701 PXTP 712 P P Sbjct: 489 PPPP 492 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXR 565 PP PPPP P P P PP PP P R Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALR 435 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP + PP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP + PPPP P P P PP PP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 437 GXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 G PP PPPP P P PP +PP P Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 390 PPPPQPPPPPPPPPPPP--PPPPPPPPPPPPAP 420 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P P PP PP P Sbjct: 395 PPPPPPPPPPPPPPPPP--PPPPPPPAPPPPPP 425 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPPP P P PP PP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPP P P P PP PP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PPP P P P PP PP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 455 PPXKXPP-PPXXXXXXPXWGPXXPLPPXKKPPXP 553 PP PP PP P P P PP PP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 34.3 bits (75), Expect = 0.15 Identities = 30/106 (28%), Positives = 30/106 (28%) Frame = -3 Query: 774 GXXXRGGGGPXXEKNPXXXAXGVXGVXGGXGGXRXDGXKIFXSGGTPPRXXGGNXXXXXX 595 G GGGG G G GG GG DG GG GG Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGD---GGGGGGGGGGGGGGDGGGY 830 Query: 594 XXXXXXXXXXXXPXGXGGFXXGGRGXXGPQXGKXXSXXGGGGXFXG 457 G GG GG G G G GGGG G Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 30.7 bits (66), Expect = 1.9 Identities = 26/102 (25%), Positives = 28/102 (27%) Frame = -3 Query: 759 GGGGPXXEKNPXXXAXGVXGVXGGXGGXRXDGXKIFXSGGTPPRXXGGNXXXXXXXXXXX 580 GGGG + G G GG GG G G GG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 579 XXXXXXXPXGXGGFXXGGRGXXGPQXGKXXSXXGGGGXFXGG 454 GG+ G G G G GGGG GG Sbjct: 829 GYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 34.3 bits (75), Expect = 0.15 Identities = 24/89 (26%), Positives = 31/89 (34%), Gaps = 4/89 (4%) Frame = +2 Query: 458 PXKXPPP-PXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLG 634 P + PP P P W P+P +P P G FPP +G Sbjct: 918 PYQAPPTLPPTTLTTPSWSQPVPVPSMYQPQPP-GIMQPPTSIPPSQPMAPPSFPPSSMG 976 Query: 635 GVPPXKK--IFXPSXRXPPXP-PXTPXTP 712 G PP + ++ P P P TP P Sbjct: 977 GFPPSSQPSMYNPGQVQPGYPGAMTPGAP 1005 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 34.3 bits (75), Expect = 0.15 Identities = 26/101 (25%), Positives = 27/101 (26%) Frame = -3 Query: 756 GGGPXXEKNPXXXAXGVXGVXGGXGGXRXDGXKIFXSGGTPPRXXGGNXXXXXXXXXXXX 577 GGG G G GG GG DG GG GG Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGV 122 Query: 576 XXXXXXPXGXGGFXXGGRGXXGPQXGKXXSXXGGGGXFXGG 454 GG G G G + GGGG GG Sbjct: 123 GATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGG 163 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.3 bits (75), Expect = 0.15 Identities = 29/100 (29%), Positives = 30/100 (30%) Frame = +2 Query: 431 GXGXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXX 610 G G PP PP P P P PP KPP P G Sbjct: 341 GGGVNPPPPPTNNPPSP----PPPTNNTPPPPPPTNKPPPPPPPTNGPPP---------- 386 Query: 611 XFPPXXLGGVPPXKKIFXPSXRXPPXPPXTPXTPXAXXXG 730 PP G PP P+ PP PP T P G Sbjct: 387 --PPPPTNGPPPPP---PPTNGPPPPPPPTNGPPSEGKCG 421 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 425 PRGXGXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKKPP 547 P G PP PPPP P GP P PP PP Sbjct: 379 PPTNGPPPPPPPTNGPPPPPP----PTNGPPPPPPPTNGPP 415 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 470 PPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRG 568 PPPP P P P PP +PP P G G Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPG 1285 Score = 26.6 bits (56), Expect(2) = 3.6 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 617 PPXXLGGVPPXKKIFXPSXR-XPPXPPXTPXTP 712 PP + +PP P R PP PP P P Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 21.4 bits (43), Expect(2) = 3.6 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = +2 Query: 470 PPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PPPP P P PP P P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMP 1263 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.9 bits (74), Expect = 0.20 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 1/81 (1%) Frame = +2 Query: 455 PPXKXPP-PPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXL 631 PP P PP P + P P PP PP P +PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNA------PYPPPPNPPYPPPPN 137 Query: 632 GGVPPXKKIFXPSXRXPPXPP 694 PP P PP PP Sbjct: 138 APYPPSPNAPYPPPPNPPYPP 158 Score = 33.9 bits (74), Expect = 0.20 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLG 634 PP PPPP P P P PP PP P PP Sbjct: 104 PPPPYPPPPNPPYPPP---PNAPYPPPPNPPYPP-PPNAPYPPSPNAPYPPPPNPPYPPP 159 Query: 635 GVPPXKKIFXPSXRXPPXPPXTPXTP 712 PP P+ PP P P P Sbjct: 160 LYPPPPNPPPPNAPYPPPPYPPPPNP 185 Score = 32.7 bits (71), Expect = 0.47 Identities = 23/80 (28%), Positives = 26/80 (32%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLG 634 PP PPPP P + P P PP PP P +PP Sbjct: 162 PPPPNPPPPNAPYPPPPY-PPPPNPPYPPPPNPPYP---PPPNAPNPPPPNPPYPPPPNA 217 Query: 635 GVPPXKKIFXPSXRXPPXPP 694 PP P+ PP PP Sbjct: 218 PNPPYPP--PPNAPNPPYPP 235 Score = 31.9 bits (69), Expect = 0.82 Identities = 24/86 (27%), Positives = 25/86 (29%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLG 634 PP P PP P P P PP PP P A PP Sbjct: 134 PPPNAPYPPSPNAPYPP-PPNPPYPPPLYPPPPNPPPPNAPYPPPPYP------PPPNPP 186 Query: 635 GVPPXKKIFXPSXRXPPXPPXTPXTP 712 PP + P P PP P P Sbjct: 187 YPPPPNPPYPPPPNAPNPPPPNPPYP 212 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLG 634 PP PPP P P P PP PP P PP LG Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLG 264 Query: 635 GVP 643 +P Sbjct: 265 YLP 267 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.5 bits (73), Expect = 0.27 Identities = 27/100 (27%), Positives = 28/100 (28%) Frame = +2 Query: 242 GGGRXPXXKKXXGGXXPPPXKGGGKXXFHGXXGGXXXXXXPPXRXGKXXXXXXXXFFFFX 421 GG P G PPP GG G PP G Sbjct: 905 GGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP 964 Query: 422 RPRGXGXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKK 541 P G PP PPPP P P P PP +K Sbjct: 965 PPGGGA-----PP--LPPPPGGSAPPPPPPPPPPPPPMRK 997 Score = 30.3 bits (65), Expect = 2.5 Identities = 27/96 (28%), Positives = 27/96 (28%) Frame = +2 Query: 425 PRGXGXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXX 604 P G PP PPP P P PP P GG Sbjct: 904 PGGSESPSASPPGGSVPPPPPPPGGN--APLPPPPPGGSAPSQPPPPGGNAPPPPPPPGG 961 Query: 605 XXXFPPXXLGGVPPXKKIFXPSXRXPPXPPXTPXTP 712 PP GG PP S PP PP P P Sbjct: 962 SAP-PPG--GGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.3 bits (65), Expect = 2.5 Identities = 23/91 (25%), Positives = 23/91 (25%) Frame = +2 Query: 209 GGXGXGXPPXGGGGRXPXXKKXXGGXXPPPXKGGGKXXFHGXXGGXXXXXXPPXRXGKXX 388 G P GG P PPP GG GG PP G Sbjct: 906 GSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP--PGGSA 963 Query: 389 XXXXXXFFFFXRPRGXGXXXXXPPXKXPPPP 481 P G PP PPPP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 230 PPXGGGGRXPXXKKXXGGXXPPPXKGGG 313 PP G GG P GG PPP GGG Sbjct: 198 PPPGPGGIPPPPPPIRGGVPPPPPMGGG 225 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 33.5 bits (73), Expect = 0.27 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGA 574 PP PPPP P PLP PP P GGA Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGA 699 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 455 PPXKXPPPPXXXXXX---PXWGPXXPLPPXKKPPXPXGXR 565 PP PPPP P G P PP KPP P G + Sbjct: 142 PPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNK 181 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 470 PPPPXXXXXXPXWGPXXPLPPXKKPP 547 PPPP P GP P PP ++PP Sbjct: 357 PPPPPGRAPQPLGGPPPP-PPGRRPP 381 Score = 29.1 bits (62), Expect = 5.8 Identities = 39/161 (24%), Positives = 40/161 (24%), Gaps = 6/161 (3%) Frame = +2 Query: 230 PPXGGGGRXPXXKKXXGGXXPPPXKGGGKXXFHGXXGGXXXXXXPPXRXGKXXXXXXXXF 409 PP G P + G PPP K G PP G Sbjct: 243 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSN-----PPPPPTRGPPSNSFTTQG 297 Query: 410 FFFXRPRGXGXXXXXPPXKXPPPP------XXXXXXPXWGPXXPLPPXKKPPXPXGXRGG 571 R P PPPP P G P PP P P R Sbjct: 298 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP-PTSTRSA 356 Query: 572 AXXXXXXXXXXXXXFPPXXLGGVPPXKKIFXPSXRXPPXPP 694 PP G PP KI P PP PP Sbjct: 357 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPP----PPPPP 393 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 455 PPXKXPPPPXXXXXX---PXWGPXXPLPPXKKPPXPXGXR 565 PP PPPP P G P PP KPP P G + Sbjct: 54 PPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNK 93 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 470 PPPPXXXXXXPXWGPXXPLPPXKKPP 547 PPPP P GP P PP ++PP Sbjct: 269 PPPPPGRAPQPLGGPPPP-PPGRRPP 293 Score = 29.1 bits (62), Expect = 5.8 Identities = 39/161 (24%), Positives = 40/161 (24%), Gaps = 6/161 (3%) Frame = +2 Query: 230 PPXGGGGRXPXXKKXXGGXXPPPXKGGGKXXFHGXXGGXXXXXXPPXRXGKXXXXXXXXF 409 PP G P + G PPP K G PP G Sbjct: 155 PPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSN-----PPPPPTRGPPSNSFTTQG 209 Query: 410 FFFXRPRGXGXXXXXPPXKXPPPP------XXXXXXPXWGPXXPLPPXKKPPXPXGXRGG 571 R P PPPP P G P PP P P R Sbjct: 210 PPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKP-PTSTRSA 268 Query: 572 AXXXXXXXXXXXXXFPPXXLGGVPPXKKIFXPSXRXPPXPP 694 PP G PP KI P PP PP Sbjct: 269 PPPPPGRAPQPLGGPPPPPPGRRPPSGKINPP----PPPPP 305 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.5 bits (68), Expect = 1.1 Identities = 28/109 (25%), Positives = 29/109 (26%) Frame = -3 Query: 780 LXGXXXRGGGGPXXEKNPXXXAXGVXGVXGGXGGXRXDGXKIFXSGGTPPRXXGGNXXXX 601 L G GGGG G G GG GG G GG GG Sbjct: 241 LGGGGATGGGGGATGGGGGATGGG-GGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Query: 600 XXXXXXXXXXXXXXPXGXGGFXXGGRGXXGPQXGKXXSXXGGGGXFXGG 454 GG G G G + GGGG GG Sbjct: 300 GGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGG 348 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 431 GXGXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 G G PP PPPP P P P PP PP P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPP---PPTP 496 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXG 559 PP PPP P P P PP + PP P G Sbjct: 558 PPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPPG 592 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 552 GXGGFXXGGRGXXGPQXGKXXSXXGGGGXFXGG 454 G GGF GG G G G GGGG GG Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGG 121 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 552 GXGGFXXGGRGXXGPQXGKXXSXXGGGGXFXG 457 G GGF GG G G G GGGG G Sbjct: 97 GGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.3 bits (65), Expect = 2.5 Identities = 24/80 (30%), Positives = 28/80 (35%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLG 634 PP PPPP P P +PP PP GG PP G Sbjct: 236 PPMGAPPPPHSMPP-PGMPPPGMMPPPGFPPMGMPGMGGMPPPGMP--------PPMPPG 286 Query: 635 GVPPXKKIFXPSXRXPPXPP 694 G+PP + + PP PP Sbjct: 287 GMPPNME------QPPPPPP 300 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPP--XKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXX 628 PP PPPP P P P PP PP P + G PP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPP-----PPPG 749 Query: 629 LGGVPP 646 G+PP Sbjct: 750 CAGLPP 755 Score = 28.7 bits (61), Expect = 7.6 Identities = 22/80 (27%), Positives = 24/80 (30%) Frame = +2 Query: 464 KXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLGGVP 643 K PPPP G +PP PP P G PP G+P Sbjct: 675 KVPPPPPPLPVIE--GSSLSVPPPPPPPPPPLLSGTLPMPPPPPP------PPPGCAGLP 726 Query: 644 PXKKIFXPSXRXPPXPPXTP 703 P P P PP P Sbjct: 727 PPPPSPQPGCAGLPPPPPPP 746 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPP 547 PP PPP P P P+PP + PP Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 470 PPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PPPP P P P PP PP P Sbjct: 197 PPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 512 PXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLGGVPP 646 P +PP PP P G GGA PP L G PP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAP---PPPALNGGPP 231 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 470 PPPPXXXXXXPXWGPXXPLPPXKKPPXP 553 PPPP P P P PP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.5 bits (63), Expect = 4.4 Identities = 26/84 (30%), Positives = 27/84 (32%), Gaps = 1/84 (1%) Frame = +2 Query: 455 PPXKX-PPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXL 631 PP + PPPP P G P PP PP P G PP L Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPP---PPPPVG-------GPPPPPPPIEGRPPSSL 389 Query: 632 GGVPPXKKIFXPSXRXPPXPPXTP 703 G PP P PP P P Sbjct: 390 GNPPPPP---PPGRGAPPPGPMIP 410 Score = 28.7 bits (61), Expect = 7.6 Identities = 25/81 (30%), Positives = 27/81 (33%) Frame = +2 Query: 470 PPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPXXLGGVPPX 649 PPPP P G P PP + P P RG A PP +G PP Sbjct: 287 PPPP------PSRGAAPP-PPSRGAPPPPPSRGSAPPP-----------PPARMGTAPPP 328 Query: 650 KKIFXPSXRXPPXPPXTPXTP 712 S R PP P P Sbjct: 329 PPPSRSSQRPPPPSRGAPPPP 349 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 437 GXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRG 568 G PP PPPP P P P PP P P G Sbjct: 90 GTCGDPPPPATPPPPTMPPTPPP--PQTPAPPGPDTPAPPAPGG 131 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKKPP 547 PP PPPP P P PP PP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 29.1 bits (62), Expect = 5.8 Identities = 22/91 (24%), Positives = 28/91 (30%), Gaps = 4/91 (4%) Frame = +2 Query: 458 PXKXPPPPXXXXXXPXWGPXXPL----PPXKKPPXPXGXRGGAXXXXXXXXXXXXXFPPX 625 P PPPP P P P+ P P P + A + P Sbjct: 457 PPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMPQAPMTMQQQAQMQQPCAPSCAPTYSPS 516 Query: 626 XLGGVPPXKKIFXPSXRXPPXPPXTPXTPXA 718 G P + P+ PP P P +P A Sbjct: 517 CCGSYPAPQPPSPPA--PPPKPAPPPRSPPA 545 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.1 bits (62), Expect = 5.8 Identities = 25/91 (27%), Positives = 27/91 (29%), Gaps = 11/91 (12%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXW---GP---XXPL-----PPXKKPPXPXGXRGGAXXXXXXXXX 601 PP PPPP W GP PL PP PP P R A Sbjct: 685 PPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPPLGRDSAAVFMLTWTP 744 Query: 602 XXXXFPPXXLGGVPPXKKIFXPSXRXPPXPP 694 + PP + R PP PP Sbjct: 745 LTNTSSAANVPPPPPPPAVPGEGARPPPPPP 775 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 5.8 Identities = 23/80 (28%), Positives = 26/80 (32%) Frame = -3 Query: 693 GGXGGXRXDGXKIFXSGGTPPRXXGGNXXXXXXXXXXXXXXXXXXPXGXGGFXXGGRGXX 514 GG GG + D + GG GG G GG+ GG G Sbjct: 718 GGRGGWQKD----YQRGGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYR 773 Query: 513 GPQXGKXXSXXGGGGXFXGG 454 G G GGGG GG Sbjct: 774 G-GGGYGGGHRGGGGYGGGG 792 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 29.1 bits (62), Expect = 5.8 Identities = 23/79 (29%), Positives = 25/79 (31%) Frame = -3 Query: 690 GXGGXRXDGXKIFXSGGTPPRXXGGNXXXXXXXXXXXXXXXXXXPXGXGGFXXGGRGXXG 511 G GG R G GG R GG G GG+ GG G G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGG--YRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGG 180 Query: 510 PQXGKXXSXXGGGGXFXGG 454 G GGG + GG Sbjct: 181 YGGGGHGGGGYGGGGYGGG 199 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXW----GPXXPLPPXKKPPXP 553 PP K PPP P P P PP ++PP P Sbjct: 1043 PPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPP 1079 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 25.8 bits (54), Expect(2) = 6.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 422 RPRGXGXXXXXPPXKXPPPP 481 +P G G PP PPPP Sbjct: 783 KPEGEGVGGITPPPPPPPPP 802 Score = 21.4 bits (43), Expect(2) = 6.1 Identities = 10/29 (34%), Positives = 10/29 (34%) Frame = +2 Query: 455 PPXKXPPPPXXXXXXPXWGPXXPLPPXKK 541 PP PPP P G PP K Sbjct: 798 PPPPPPPPEDLIIPLPRRGSDLFAPPADK 826 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 28.7 bits (61), Expect = 7.6 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 209 GGXGXGXPPXGGGGRX--PXXKKXXGGXXPPPXKGGGKXXFHGXXGG 343 GG G P G GG P G PP +GGG G GG Sbjct: 494 GGPPRGGPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRGG 540 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 28.7 bits (61), Expect = 7.6 Identities = 24/93 (25%), Positives = 28/93 (30%), Gaps = 3/93 (3%) Frame = +2 Query: 425 PRGXGXXXXXPPXKXPPPPXXXXXXPXWGPXXPLPPXKKPPXPXGXRGGAXXXXXXXXXX 604 PRG P PP P GP P PP + PP G Sbjct: 79 PRGHPMRGRGAPYGRGGPPSRG---PPRGPPLPGPPRRGPPPDRDSGYGGYGDRYDRPPP 135 Query: 605 XXXFPPXXLGGVPPXK---KIFXPSXRXPPXPP 694 PP G PP + + + R P PP Sbjct: 136 DRRPPPPDRSGYPPPRDYDRGYADRPRERPPPP 168 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,278,460 Number of Sequences: 59808 Number of extensions: 165655 Number of successful extensions: 1616 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1080 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2919714245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -